F419123

General Info

Members Datasets Scaffolds Average Seq Length
352 142 704 230

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0050566|Ga0453683_0050566_1650_2438
Length 262
Sequence MVETRPKWLEKFRDDAPASYREFVDEGGRAMRKLIAAVAGLTLVVGGVAFLEGTRTATAQGGGTIEAEVKYNGAPQVDKLKVNKDVEKCGTEAMIEKVVVGGNKGLANVVVSVPEAKGAPTAKKITIDQHGCKFVPHVSAMTPGEVDLKNSDDILHNIHTYSTANPSINKAQPKFKKVMVEKFEKPEIIKLTCDVHSWMLGWIAVMPNPYFGVTDGNGVAKVENVPPGKYKVEAWHETLGKQTKDVEVKAGQTTKVAFEMKK

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 1.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.42
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0050566 3300044673 Bacteria 2604
2 JGI25406J46586_10011491 3300003203 Bacteria 3883
3 Ga0058862_12834889 3300004803 Unclassified 1227
4 Ga0065704_10155466 3300005289 Bacteria 1394
5 Ga0065707_10116024 3300005295 Bacteria 2248
6 Ga0065707_10175646 3300005295 Bacteria 1447
7 Ga0070666_10274568 3300005335 Bacteria 1197
8 Ga0070680_100106685 3300005336 Bacteria 2329
9 Ga0070692_10142502 3300005345 Unclassified 1358
10 Ga0070668_100105022 3300005347 Bacteria 2243
11 Ga0070668_100251335 3300005347 Bacteria 1468
12 Ga0070669_100638905 3300005353 Unclassified 895
13 Ga0070659_100344122 3300005366 Bacteria 1250
14 Ga0070667_100260656 3300005367 Bacteria 1552
15 Ga0070705_100005627 3300005440 Bacteria 6114
16 Ga0070705_100075599 3300005440 Bacteria 2051
17 Ga0070705_100140087 3300005440 Unclassified 1591
18 Ga0070700_100430851 3300005441 Unclassified 999
19 Ga0070708_100003289 3300005445 Bacteria 12625
20 Ga0070708_100656687 3300005445 Bacteria 988
21 Ga0070663_100346905 3300005455 Bacteria 1201
22 Ga0070662_100182093 3300005457 Bacteria 1657
23 Ga0070681_10025464 3300005458 Bacteria 5952
24 Ga0070706_100054009 3300005467 Bacteria 3709
25 Ga0070706_100083497 3300005467 Bacteria 2959
26 Ga0070706_100301659 3300005467 Unclassified 1494
27 Ga0070707_100015246 3300005468 Bacteria 7212
28 Ga0070707_100111761 3300005468 Bacteria 2650
29 Ga0070707_100742489 3300005468 Bacteria 945
30 Ga0070698_100011134 3300005471 Bacteria 9555
31 Ga0070698_100059362 3300005471 Bacteria 3863
32 Ga0070698_100733529 3300005471 Bacteria 931
33 Ga0070699_100006523 3300005518 Bacteria 10160
34 Ga0070699_100056908 3300005518 Bacteria 3386
35 Ga0070699_100113595 3300005518 Bacteria 2379
36 Ga0070699_100114354 3300005518 Unclassified 2371
37 Ga0070697_100024894 3300005536 Bacteria 4768
38 Ga0070697_100050227 3300005536 Bacteria 3385
39 Ga0070697_100058167 3300005536 Bacteria 3146
40 Ga0070697_100849566 3300005536 Bacteria 809
41 Ga0070695_100115925 3300005545 Unclassified 1826
42 Ga0070696_100040769 3300005546 Bacteria 3207
43 Ga0070696_100718756 3300005546 Unclassified 816
44 Ga0070704_100009531 3300005549 Bacteria 5874
45 Ga0070704_100035537 3300005549 Bacteria 3388
46 Ga0068857_100255002 3300005577 Bacteria 1609
47 Ga0068852_101127357 3300005616 Bacteria 805
48 Ga0068861_100101033 3300005719 Bacteria 2294
49 Ga0068860_100551454 3300005843 Unclassified 1155
50 Ga0068862_100335737 3300005844 Unclassified 1399
51 Ga0068862_100447750 3300005844 Unclassified 1217
52 Ga0081455_10035271 3300005937 Bacteria 4473
53 Ga0081539_10000702 3300005985 Bacteria 67205
54 Ga0075432_10020660 3300006058 Bacteria 2252
55 Ga0070715_10108850 3300006163 Bacteria 1304
56 Ga0075428_100000123 3300006844 Bacteria 66826
57 Ga0075428_100012036 3300006844 Bacteria 9624
58 Ga0075428_100017412 3300006844 Bacteria 7941
59 Ga0075428_100053335 3300006844 Bacteria 4430
60 Ga0075428_100085149 3300006844 Unclassified 3447
61 Ga0075428_100087462 3300006844 Bacteria 3399
62 Ga0075428_100105900 3300006844 Bacteria 3066
63 Ga0075428_100630735 3300006844 Unclassified 1144
64 Ga0075428_100683500 3300006844 Unclassified 1094
65 Ga0075430_100001228 3300006846 Bacteria 20620
66 Ga0075430_100030940 3300006846 Bacteria 4545
67 Ga0075430_100057147 3300006846 Bacteria 3282
68 Ga0075430_100096009 3300006846 Unclassified 2478
69 Ga0075430_100384840 3300006846 Bacteria 1158
70 Ga0075431_100006732 3300006847 Bacteria 11413
71 Ga0075431_100007721 3300006847 Bacteria 10713
72 Ga0075431_100022283 3300006847 Bacteria 6474
73 Ga0075431_100027148 3300006847 Bacteria 5872
74 Ga0075431_100030594 3300006847 Bacteria 5546
75 Ga0075431_100036618 3300006847 Bacteria 5053
76 Ga0075431_100131283 3300006847 Bacteria 2583
77 Ga0075431_100138045 3300006847 Unclassified 2514
78 Ga0075431_100181009 3300006847 Bacteria 2163
79 Ga0075433_10001044 3300006852 Bacteria 19805
80 Ga0075433_10004252 3300006852 Bacteria 11122
81 Ga0075433_10008044 3300006852 Bacteria 8395
82 Ga0075433_10068288 3300006852 Bacteria 3120
83 Ga0075433_10126093 3300006852 Bacteria 2273
84 Ga0075433_10130844 3300006852 Bacteria 2229
85 Ga0075433_10175602 3300006852 Unclassified 1906
86 Ga0075433_10273683 3300006852 Unclassified 1496
87 Ga0075433_10621817 3300006852 Bacteria 947
88 Ga0075433_10902887 3300006852 Bacteria 770
89 Ga0075434_100005031 3300006871 Bacteria 12002
90 Ga0075434_100006853 3300006871 Bacteria 10492
91 Ga0075434_100016235 3300006871 Bacteria 7156
92 Ga0075434_100038242 3300006871 Bacteria 4753
93 Ga0075434_100225773 3300006871 Bacteria 1892
94 Ga0075434_100658242 3300006871 Bacteria 1065
95 Ga0075434_100659324 3300006871 Bacteria 1065
96 Ga0075429_100000222 3300006880 Bacteria 38478
97 Ga0075429_100002747 3300006880 Bacteria 14866
98 Ga0075429_100005935 3300006880 Bacteria 10543
99 Ga0075429_100014852 3300006880 Bacteria 6752
100 Ga0075429_100016702 3300006880 Bacteria 6357
101 Ga0075429_100115529 3300006880 Bacteria 2346
102 Ga0075429_100937000 3300006880 Bacteria 758
103 Ga0068865_100462923 3300006881 Bacteria 1051
104 Ga0075436_100005948 3300006914 Bacteria 8380
105 Ga0075436_100082988 3300006914 Bacteria 2224
106 Ga0075436_100173045 3300006914 Unclassified 1524
107 Ga0075436_100661850 3300006914 Bacteria 772
108 Ga0075435_100003909 3300007076 Bacteria 10175
109 Ga0075435_100008082 3300007076 Bacteria 7532
110 Ga0075435_100025222 3300007076 Bacteria 4626
111 Ga0075435_100069724 3300007076 Bacteria 2868
112 Ga0075435_100150277 3300007076 Bacteria 1958
113 Ga0075435_100560937 3300007076 Unclassified 989
114 Ga0075435_100872012 3300007076 Bacteria 785
115 Ga0099794_10009197 3300007265 Bacteria 4140
116 Ga0111539_10115403 3300009094 Bacteria 3149
117 Ga0111539_10182050 3300009094 Bacteria 2454
118 Ga0114129_10000003 3300009147 Bacteria 183186
119 Ga0114129_10003687 3300009147 Bacteria 21565
120 Ga0114129_10017728 3300009147 Bacteria 10139
121 Ga0114129_10038484 3300009147 Bacteria 6746
122 Ga0114129_10044497 3300009147 Bacteria 6245
123 Ga0114129_10069742 3300009147 Bacteria 4900
124 Ga0114129_10115964 3300009147 Bacteria 3691
125 Ga0114129_10190679 3300009147 Bacteria 2784
126 Ga0114129_10262380 3300009147 Bacteria 2314
127 Ga0114129_10318205 3300009147 Bacteria 2069
128 Ga0114129_10325796 3300009147 Bacteria 2041
129 Ga0114129_11063397 3300009147 Unclassified 1015
130 Ga0105241_10456217 3300009174 Bacteria 1131
131 Ga0105242_10578791 3300009176 Bacteria 1081
132 Ga0157373_10220757 3300013100 Bacteria 1337
133 Ga0157378_10061715 3300013297 Bacteria 3347
134 Ga0157378_10707499 3300013297 Bacteria 1027
135 Ga0163162_10127239 3300013306 Bacteria 2655
136 Ga0157375_10521235 3300013308 Bacteria 1352
137 Ga0157380_10170581 3300014326 Bacteria 1901
138 Ga0206356_11503538 3300020070 Bacteria 1042
139 Ga0206353_10712742 3300020082 Bacteria 744
140 Ga0207680_10128521 3300025903 Bacteria 1667
141 Ga0207684_10000888 3300025910 Bacteria 33994
142 Ga0207684_10011837 3300025910 Bacteria 7605
143 Ga0207684_10012601 3300025910 Bacteria 7349
144 Ga0207684_10120091 3300025910 Bacteria 2253
145 Ga0207654_10198627 3300025911 Bacteria 1319
146 Ga0207707_10146762 3300025912 Bacteria 2062
147 Ga0207660_10057470 3300025917 Bacteria 2786
148 Ga0207646_10026379 3300025922 Bacteria 5302
149 Ga0207646_10029470 3300025922 Bacteria 4988
150 Ga0207681_10154688 3300025923 Bacteria 1722
151 Ga0207690_10889850 3300025932 Bacteria 738
152 Ga0207706_10198659 3300025933 Bacteria 1759
153 Ga0207709_10322427 3300025935 Bacteria 1157
154 Ga0207704_10013327 3300025938 Bacteria 4110
155 Ga0207712_10571844 3300025961 Bacteria 974
156 Ga0207712_10899639 3300025961 Unclassified 782
157 Ga0207668_10294329 3300025972 Bacteria 1337
158 Ga0207708_10267595 3300026075 Unclassified 1381
159 Ga0207648_10262684 3300026089 Bacteria 1541
160 Ga0207675_100725929 3300026118 Bacteria 1004
161 Ga0209998_10014213 3300027717 Bacteria 1661
162 Ga0209974_10079679 3300027876 Bacteria 1125
163 Ga0207428_10000035 3300027907 Bacteria 229100
164 Ga0207428_10009951 3300027907 Bacteria 8514
165 Ga0268265_10436256 3300028380 Bacteria 1220
166 Ga0268264_10527538 3300028381 Unclassified 1155
167 Ga0307408_100080425 3300031548 Bacteria 2434
168 Ga0307408_100135494 3300031548 Unclassified 1927
169 Ga0307410_10069662 3300031852 Bacteria 2434
170 Ga0307406_10408611 3300031901 Unclassified 1078
171 Ga0307409_100194154 3300031995 Bacteria 1810
172 Ga0307409_100588005 3300031995 Bacteria 1098
173 Ga0307416_100075805 3300032002 Bacteria 2816
174 Ga0307411_10090175 3300032005 Bacteria 2138
175 Ga0373928_0034093 3300035084 Unclassified 1141
176 Ga0373939_0009029 3300035114 Bacteria 2461
177 Ga0373931_0042652 3300035691 Bacteria 2386
178 Ga0373931_0121131 3300035691 Bacteria 1495
179 Ga0395899_0016473 3300037312 Bacteria 5636
180 Ga0395900_0146275 3300037418 Bacteria 2416
181 Ga0395900_0319859 3300037418 Bacteria 1532
182 Ga0395898_0027152 3300037466 Bacteria 5750
183 Ga0395905_0048481 3300037471 Bacteria 3981
184 Ga0395901_0026657 3300038443 Bacteria 5934
185 Ga0395901_0508061 3300038443 Bacteria 1226
186 Ga0395901_0571183 3300038443 Bacteria 1144
187 Ga0242420_024021 3300038996 Bacteria 1103
188 Ga0439435_0031590 3300042436 Bacteria 1441
189 Ga0451577_0220766 3300042876 Bacteria 1713
190 Ga0453683_0085994 3300044673 Bacteria 1970
191 Ga0453684_0813173 3300044712 Bacteria 1007
192 Ga0451576_0121181 3300045051 Bacteria 2723
193 Ga0495584_0139278 3300046491 Bacteria 1232
194 Ga0495659_0019669 3300046664 Bacteria 2260
195 Ga0495669_0031853 3300046684 Bacteria 2316
196 Ga0495636_0143247 3300047318 Bacteria 1068
197 Ga0496100_0771357 3300048903 Bacteria 753
198 Ga0496101_0447994 3300048904 Bacteria 1018
199 Ga0496102_0052298 3300048905 Bacteria 3721
200 Ga0496110_0845092 3300048913 Bacteria 821
201 Ga0496113_0456103 3300048916 Bacteria 1027
202 Ga0501312_022605 3300049528 Bacteria 943
203 Ga0501318_016367 3300049534 Bacteria 895
204 Ga0501033_0175670 3300049570 Unclassified 1537
205 Ga0501033_0234824 3300049570 Bacteria 1302
206 Ga0501036_0046084 3300049572 Bacteria 3692
207 Ga0501036_0238741 3300049572 Bacteria 1525
208 Ga0501036_0291853 3300049572 Unclassified 1364
209 Ga0501036_0488508 3300049572 Bacteria 1025
210 Ga0501038_0164333 3300049574 Bacteria 1802
211 Ga0501038_0570244 3300049574 Bacteria 859
212 Ga0501039_0124605 3300049575 Bacteria 2021
213 Ga0501040_0015154 3300049576 Bacteria 5094
214 Ga0501040_0021893 3300049576 Bacteria 4274
215 Ga0501040_0134654 3300049576 Bacteria 1739
216 Ga0501040_0572667 3300049576 Bacteria 815
217 Ga0501041_0087209 3300049577 Unclassified 1926
218 Ga0501041_0099331 3300049577 Bacteria 1800
219 Ga0501041_0105406 3300049577 Bacteria 1747
220 Ga0501042_0028807 3300049578 Bacteria 3917
221 Ga0501042_0070417 3300049578 Bacteria 2502
222 Ga0501046_0028156 3300049580 Bacteria 4579
223 Ga0501048_0019922 3300049582 Bacteria 4918
224 Ga0501048_0104600 3300049582 Bacteria 1998
225 Ga0501048_0451717 3300049582 Bacteria 920
226 Ga0501067_0019073 3300049583 Bacteria 3796
227 Ga0501068_0010699 3300049584 Bacteria 5159
228 Ga0501070_0640386 3300049586 Bacteria 845
229 Ga0501071_0054410 3300049587 Bacteria 2888
230 Ga0501071_0253352 3300049587 Unclassified 1329
231 Ga0501072_0004100 3300049588 Bacteria 11029
232 Ga0501072_0012251 3300049588 Bacteria 6554
233 Ga0501072_0054538 3300049588 Bacteria 3149
234 Ga0501072_0184548 3300049588 Bacteria 1664
235 Ga0501072_0230922 3300049588 Bacteria 1474
236 Ga0501075_0012719 3300049591 Bacteria 5988
237 Ga0501075_0013811 3300049591 Bacteria 5774
238 Ga0501075_0060057 3300049591 Bacteria 2865
239 Ga0501075_0074594 3300049591 Bacteria 2566
240 Ga0501075_0107590 3300049591 Unclassified 2120
241 Ga0501075_0261735 3300049591 Bacteria 1318
242 Ga0501076_0041268 3300049592 Bacteria 3629
243 Ga0501076_0130945 3300049592 Unclassified 2034
244 Ga0501076_0567392 3300049592 Bacteria 936
245 Ga0501077_0002319 3300049593 Bacteria 11460
246 Ga0501077_0006817 3300049593 Bacteria 7028
247 Ga0501077_0009253 3300049593 Bacteria 6118
248 Ga0501077_0071315 3300049593 Bacteria 2202
249 Ga0501077_0206209 3300049593 Bacteria 1249
250 Ga0501079_0007951 3300049741 Bacteria 8041
251 Ga0501079_0020077 3300049741 Bacteria 5105
252 Ga0501079_0043988 3300049741 Bacteria 3447
253 Ga0501079_0128400 3300049741 Bacteria 1972
254 Ga0501079_0129232 3300049741 Bacteria 1966
255 Ga0501079_0310842 3300049741 Bacteria 1233
256 Ga0501080_0014862 3300049742 Bacteria 7169
257 Ga0501080_0168449 3300049742 Unclassified 2021
258 Ga0501080_0193823 3300049742 Bacteria 1867
259 Ga0501080_0310941 3300049742 Bacteria 1428
260 Ga0501081_0022012 3300049743 Bacteria 4261
261 Ga0501081_0037318 3300049743 Bacteria 3315
262 Ga0501081_0038041 3300049743 Bacteria 3285
263 Ga0501081_0075819 3300049743 Bacteria 2348
264 Ga0501081_0131419 3300049743 Bacteria 1789
265 Ga0501081_0697061 3300049743 Bacteria 762
266 Ga0501083_0023898 3300049744 Bacteria 4238
267 Ga0501035_0423579 3300049822 Bacteria 1105
268 Ga0501045_0050486 3300049824 Bacteria 3035
269 nmdc:mga05p37_1013010_c1 3300050507 Bacteria 881
270 nmdc:mga05p37_112038_c1 3300050507 Bacteria 3355
271 nmdc:mga05p37_115044_c1 3300050507 Bacteria 3307
272 nmdc:mga05p37_11767_c1 3300050507 Bacteria 10430
273 nmdc:mga05p37_118779_c1 3300050507 Bacteria 3249
274 nmdc:mga05p37_12275_c1 3300050507 Bacteria 10230
275 nmdc:mga05p37_1260_c1 3300050507 Bacteria 29358
276 nmdc:mga05p37_131949_c1 3300050507 Bacteria 3065
277 nmdc:mga05p37_183568_c1 3300050507 Bacteria 2544
278 nmdc:mga05p37_212230_c1 3300050507 Unclassified 2340
279 nmdc:mga05p37_30612_c1 3300050507 Bacteria 6567
280 nmdc:mga05p37_3525_c1 3300050507 Bacteria 18277
281 nmdc:mga05p37_430289_c1 3300050507 Bacteria 1533
282 nmdc:mga05p37_4304_c1 3300050507 Bacteria 16620
283 nmdc:mga05p37_5284_c1 3300050507 Bacteria 15158
284 nmdc:mga05p37_66863_c1 3300050507 Bacteria 4421
285 nmdc:mga05p37_67669_c1 3300050507 Unclassified 4394
286 nmdc:mga05p37_84866_c1 3300050507 Bacteria 3901
287 nmdc:mga05p37_857_c1 3300050507 Bacteria 34239
288 nmdc:mga09592_108404_c1 3300050508 Bacteria 2382
289 nmdc:mga09592_1634_c1 3300050508 Bacteria 10939
290 nmdc:mga09592_2243_c1 3300050508 Bacteria 15566
291 nmdc:mga09592_360896_c1 3300050508 Unclassified 1257
292 nmdc:mga09592_46682_c1 3300050508 Bacteria 3649
293 nmdc:mga09592_67027_c1 3300050508 Bacteria 3044
294 nmdc:mga09592_68174_c1 3300050508 Bacteria 3018
295 nmdc:mga09592_9047_c1 3300050508 Bacteria 8096
296 nmdc:mga0qj67_115812_c1 3300050509 Bacteria 2166
297 nmdc:mga0qj67_118_c1 3300050509 Bacteria 52561
298 nmdc:mga0qj67_136463_c1 3300050509 Bacteria 1988
299 nmdc:mga0qj67_2147_c1 3300050509 Bacteria 14022
300 nmdc:mga06r32_106494_c1 3300050510 Bacteria 2755
301 nmdc:mga06r32_127547_c1 3300050510 Unclassified 2514
302 nmdc:mga06r32_1432_c1 3300050510 Bacteria 21539
303 nmdc:mga06r32_481747_c1 3300050510 Bacteria 1219
304 nmdc:mga06r32_485_c1 3300050510 Bacteria 34276
305 nmdc:mga06r32_5732_c1 3300050510 Bacteria 11183
306 nmdc:mga06r32_59859_c1 3300050510 Bacteria 3664
307 nmdc:mga06r32_75296_c1 3300050510 Bacteria 3275
308 nmdc:mga06r32_92174_c1 3300050510 Bacteria 2962
309 nmdc:mga08y16_145954_c1 3300050511 Bacteria 2460
310 nmdc:mga08y16_727_c1 3300050511 Bacteria 31229
311 nmdc:mga0n895_105273_c1 3300050512 Bacteria 2834
312 nmdc:mga0n895_15721_c1 3300050512 Bacteria 6916
313 nmdc:mga0n895_18877_c1 3300050512 Bacteria 6394
314 nmdc:mga0n895_331210_c1 3300050512 Unclassified 1543
315 nmdc:mga0n895_35655_c1 3300050512 Bacteria 4798
316 nmdc:mga0n895_380_c1 3300050512 Bacteria 30032
317 nmdc:mga0n895_94480_c1 3300050512 Bacteria 2994
318 nmdc:mga0rr50_1303_c1 3300050513 Bacteria 13613
319 nmdc:mga0rr50_153754_c1 3300050513 Bacteria 1862
320 nmdc:mga0rr50_25822_c1 3300050513 Bacteria 4090
321 nmdc:mga0rr50_491687_c1 3300050513 Bacteria 1043
322 nmdc:mga0rr50_53111_c1 3300050513 Bacteria 3014
323 nmdc:mga0rr50_95313_c1 3300050513 Bacteria 2326
324 nmdc:mga08x19_13744_c1 3300050514 Bacteria 4901
325 nmdc:mga08x19_383319_c1 3300050514 Bacteria 985
326 nmdc:mga08x19_66127_c1 3300050514 Bacteria 2349
327 nmdc:mga0a205_12967_c1 3300050515 Bacteria 7736
328 nmdc:mga0a205_148748_c1 3300050515 Bacteria 2242
329 nmdc:mga0a205_17796_c1 3300050515 Bacteria 6669
330 nmdc:mga0a205_186362_c1 3300050515 Bacteria 1968
331 nmdc:mga0a205_19087_c1 3300050515 Bacteria 6462
332 nmdc:mga0a205_20583_c1 3300050515 Bacteria 6228
333 nmdc:mga0a205_254576_c1 3300050515 Unclassified 1635
334 nmdc:mga0a205_61282_c1 3300050515 Bacteria 3634
335 nmdc:mga0a205_71964_c1 3300050515 Bacteria 3340
336 Ga0501084_0011809 3300054114 Bacteria 7229
337 Ga0501084_0131393 3300054114 Unclassified 2107
338 Ga0501084_0218935 3300054114 Unclassified 1606
339 Ga0501084_0360776 3300054114 Bacteria 1228
340 Ga0501084_0447166 3300054114 Bacteria 1092
341 Ga0501082_0010365 3300060353 Bacteria 8026
342 Ga0501082_0029606 3300060353 Bacteria 4717
343 Ga0501082_0074555 3300060353 Bacteria 2923
344 Ga0501082_0093312 3300060353 Bacteria 2601
345 Ga0501082_0148329 3300060353 Unclassified 2037
346 Ga0501082_0608342 3300060353 Bacteria 956
347 Ga0530510_0000785 3300061734 Bacteria 20630
348 Ga0530510_0003255 3300061734 Bacteria 11164
349 Ga0530510_0013074 3300061734 Bacteria 5837
350 Ga0530510_0092951 3300061734 Bacteria 2202
351 Ga0530510_0605501 3300061734 Bacteria 833
352 Ga0530510_0652756 3300061734 Bacteria 801
353 Ga0453683_0050566
354 JGI25406J46586_10011491
355 Ga0058862_12834889
356 Ga0065704_10155466
357 Ga0065707_10116024
358 Ga0065707_10175646
359 Ga0070666_10274568
360 Ga0070680_100106685
361 Ga0070692_10142502
362 Ga0070668_100105022
363 Ga0070668_100251335
364 Ga0070669_100638905
365 Ga0070659_100344122
366 Ga0070667_100260656
367 Ga0070705_100005627
368 Ga0070705_100075599
369 Ga0070705_100140087
370 Ga0070700_100430851
371 Ga0070708_100003289
372 Ga0070708_100656687
373 Ga0070663_100346905
374 Ga0070662_100182093
375 Ga0070681_10025464
376 Ga0070706_100054009
377 Ga0070706_100083497
378 Ga0070706_100301659
379 Ga0070707_100015246
380 Ga0070707_100111761
381 Ga0070707_100742489
382 Ga0070698_100011134
383 Ga0070698_100059362
384 Ga0070698_100733529
385 Ga0070699_100006523
386 Ga0070699_100056908
387 Ga0070699_100113595
388 Ga0070699_100114354
389 Ga0070697_100024894
390 Ga0070697_100050227
391 Ga0070697_100058167
392 Ga0070697_100849566
393 Ga0070695_100115925
394 Ga0070696_100040769
395 Ga0070696_100718756
396 Ga0070704_100009531
397 Ga0070704_100035537
398 Ga0068857_100255002
399 Ga0068852_101127357
400 Ga0068861_100101033
401 Ga0068860_100551454
402 Ga0068862_100335737
403 Ga0068862_100447750
404 Ga0081455_10035271
405 Ga0081539_10000702
406 Ga0075432_10020660
407 Ga0070715_10108850
408 Ga0075428_100000123
409 Ga0075428_100012036
410 Ga0075428_100017412
411 Ga0075428_100053335
412 Ga0075428_100085149
413 Ga0075428_100087462
414 Ga0075428_100105900
415 Ga0075428_100630735
416 Ga0075428_100683500
417 Ga0075430_100001228
418 Ga0075430_100030940
419 Ga0075430_100057147
420 Ga0075430_100096009
421 Ga0075430_100384840
422 Ga0075431_100006732
423 Ga0075431_100007721
424 Ga0075431_100022283
425 Ga0075431_100027148
426 Ga0075431_100030594
427 Ga0075431_100036618
428 Ga0075431_100131283
429 Ga0075431_100138045
430 Ga0075431_100181009
431 Ga0075433_10001044
432 Ga0075433_10004252
433 Ga0075433_10008044
434 Ga0075433_10068288
435 Ga0075433_10126093
436 Ga0075433_10130844
437 Ga0075433_10175602
438 Ga0075433_10273683
439 Ga0075433_10621817
440 Ga0075433_10902887
441 Ga0075434_100005031
442 Ga0075434_100006853
443 Ga0075434_100016235
444 Ga0075434_100038242
445 Ga0075434_100225773
446 Ga0075434_100658242
447 Ga0075434_100659324
448 Ga0075429_100000222
449 Ga0075429_100002747
450 Ga0075429_100005935
451 Ga0075429_100014852
452 Ga0075429_100016702
453 Ga0075429_100115529
454 Ga0075429_100937000
455 Ga0068865_100462923
456 Ga0075436_100005948
457 Ga0075436_100082988
458 Ga0075436_100173045
459 Ga0075436_100661850
460 Ga0075435_100003909
461 Ga0075435_100008082
462 Ga0075435_100025222
463 Ga0075435_100069724
464 Ga0075435_100150277
465 Ga0075435_100560937
466 Ga0075435_100872012
467 Ga0099794_10009197
468 Ga0111539_10115403
469 Ga0111539_10182050
470 Ga0114129_10000003
471 Ga0114129_10003687
472 Ga0114129_10017728
473 Ga0114129_10038484
474 Ga0114129_10044497
475 Ga0114129_10069742
476 Ga0114129_10115964
477 Ga0114129_10190679
478 Ga0114129_10262380
479 Ga0114129_10318205
480 Ga0114129_10325796
481 Ga0114129_11063397
482 Ga0105241_10456217
483 Ga0105242_10578791
484 Ga0157373_10220757
485 Ga0157378_10061715
486 Ga0157378_10707499
487 Ga0163162_10127239
488 Ga0157375_10521235
489 Ga0157380_10170581
490 Ga0206356_11503538
491 Ga0206353_10712742
492 Ga0207680_10128521
493 Ga0207684_10000888
494 Ga0207684_10011837
495 Ga0207684_10012601
496 Ga0207684_10120091
497 Ga0207654_10198627
498 Ga0207707_10146762
499 Ga0207660_10057470
500 Ga0207646_10026379
501 Ga0207646_10029470
502 Ga0207681_10154688
503 Ga0207690_10889850
504 Ga0207706_10198659
505 Ga0207709_10322427
506 Ga0207704_10013327
507 Ga0207712_10571844
508 Ga0207712_10899639
509 Ga0207668_10294329
510 Ga0207708_10267595
511 Ga0207648_10262684
512 Ga0207675_100725929
513 Ga0209998_10014213
514 Ga0209974_10079679
515 Ga0207428_10000035
516 Ga0207428_10009951
517 Ga0268265_10436256
518 Ga0268264_10527538
519 Ga0307408_100080425
520 Ga0307408_100135494
521 Ga0307410_10069662
522 Ga0307406_10408611
523 Ga0307409_100194154
524 Ga0307409_100588005
525 Ga0307416_100075805
526 Ga0307411_10090175
527 Ga0373928_0034093
528 Ga0373939_0009029
529 Ga0373931_0042652
530 Ga0373931_0121131
531 Ga0395899_0016473
532 Ga0395900_0146275
533 Ga0395900_0319859
534 Ga0395898_0027152
535 Ga0395905_0048481
536 Ga0395901_0026657
537 Ga0395901_0508061
538 Ga0395901_0571183
539 Ga0242420_024021
540 Ga0439435_0031590
541 Ga0451577_0220766
542 Ga0453683_0085994
543 Ga0453684_0813173
544 Ga0451576_0121181
545 Ga0495584_0139278
546 Ga0495659_0019669
547 Ga0495669_0031853
548 Ga0495636_0143247
549 Ga0496100_0771357
550 Ga0496101_0447994
551 Ga0496102_0052298
552 Ga0496110_0845092
553 Ga0496113_0456103
554 Ga0501312_022605
555 Ga0501318_016367
556 Ga0501033_0175670
557 Ga0501033_0234824
558 Ga0501036_0046084
559 Ga0501036_0238741
560 Ga0501036_0291853
561 Ga0501036_0488508
562 Ga0501038_0164333
563 Ga0501038_0570244
564 Ga0501039_0124605
565 Ga0501040_0015154
566 Ga0501040_0021893
567 Ga0501040_0134654
568 Ga0501040_0572667
569 Ga0501041_0087209
570 Ga0501041_0099331
571 Ga0501041_0105406
572 Ga0501042_0028807
573 Ga0501042_0070417
574 Ga0501046_0028156
575 Ga0501048_0019922
576 Ga0501048_0104600
577 Ga0501048_0451717
578 Ga0501067_0019073
579 Ga0501068_0010699
580 Ga0501070_0640386
581 Ga0501071_0054410
582 Ga0501071_0253352
583 Ga0501072_0004100
584 Ga0501072_0012251
585 Ga0501072_0054538
586 Ga0501072_0184548
587 Ga0501072_0230922
588 Ga0501075_0012719
589 Ga0501075_0013811
590 Ga0501075_0060057
591 Ga0501075_0074594
592 Ga0501075_0107590
593 Ga0501075_0261735
594 Ga0501076_0041268
595 Ga0501076_0130945
596 Ga0501076_0567392
597 Ga0501077_0002319
598 Ga0501077_0006817
599 Ga0501077_0009253
600 Ga0501077_0071315
601 Ga0501077_0206209
602 Ga0501079_0007951
603 Ga0501079_0020077
604 Ga0501079_0043988
605 Ga0501079_0128400
606 Ga0501079_0129232
607 Ga0501079_0310842
608 Ga0501080_0014862
609 Ga0501080_0168449
610 Ga0501080_0193823
611 Ga0501080_0310941
612 Ga0501081_0022012
613 Ga0501081_0037318
614 Ga0501081_0038041
615 Ga0501081_0075819
616 Ga0501081_0131419
617 Ga0501081_0697061
618 Ga0501083_0023898
619 Ga0501035_0423579
620 Ga0501045_0050486
621 nmdc:mga05p37_1013010_c1
622 nmdc:mga05p37_112038_c1
623 nmdc:mga05p37_115044_c1
624 nmdc:mga05p37_11767_c1
625 nmdc:mga05p37_118779_c1
626 nmdc:mga05p37_12275_c1
627 nmdc:mga05p37_1260_c1
628 nmdc:mga05p37_131949_c1
629 nmdc:mga05p37_183568_c1
630 nmdc:mga05p37_212230_c1
631 nmdc:mga05p37_30612_c1
632 nmdc:mga05p37_3525_c1
633 nmdc:mga05p37_430289_c1
634 nmdc:mga05p37_4304_c1
635 nmdc:mga05p37_5284_c1
636 nmdc:mga05p37_66863_c1
637 nmdc:mga05p37_67669_c1
638 nmdc:mga05p37_84866_c1
639 nmdc:mga05p37_857_c1
640 nmdc:mga09592_108404_c1
641 nmdc:mga09592_1634_c1
642 nmdc:mga09592_2243_c1
643 nmdc:mga09592_360896_c1
644 nmdc:mga09592_46682_c1
645 nmdc:mga09592_67027_c1
646 nmdc:mga09592_68174_c1
647 nmdc:mga09592_9047_c1
648 nmdc:mga0qj67_115812_c1
649 nmdc:mga0qj67_118_c1
650 nmdc:mga0qj67_136463_c1
651 nmdc:mga0qj67_2147_c1
652 nmdc:mga06r32_106494_c1
653 nmdc:mga06r32_127547_c1
654 nmdc:mga06r32_1432_c1
655 nmdc:mga06r32_481747_c1
656 nmdc:mga06r32_485_c1
657 nmdc:mga06r32_5732_c1
658 nmdc:mga06r32_59859_c1
659 nmdc:mga06r32_75296_c1
660 nmdc:mga06r32_92174_c1
661 nmdc:mga08y16_145954_c1
662 nmdc:mga08y16_727_c1
663 nmdc:mga0n895_105273_c1
664 nmdc:mga0n895_15721_c1
665 nmdc:mga0n895_18877_c1
666 nmdc:mga0n895_331210_c1
667 nmdc:mga0n895_35655_c1
668 nmdc:mga0n895_380_c1
669 nmdc:mga0n895_94480_c1
670 nmdc:mga0rr50_1303_c1
671 nmdc:mga0rr50_153754_c1
672 nmdc:mga0rr50_25822_c1
673 nmdc:mga0rr50_491687_c1
674 nmdc:mga0rr50_53111_c1
675 nmdc:mga0rr50_95313_c1
676 nmdc:mga08x19_13744_c1
677 nmdc:mga08x19_383319_c1
678 nmdc:mga08x19_66127_c1
679 nmdc:mga0a205_12967_c1
680 nmdc:mga0a205_148748_c1
681 nmdc:mga0a205_17796_c1
682 nmdc:mga0a205_186362_c1
683 nmdc:mga0a205_19087_c1
684 nmdc:mga0a205_20583_c1
685 nmdc:mga0a205_254576_c1
686 nmdc:mga0a205_61282_c1
687 nmdc:mga0a205_71964_c1
688 Ga0501084_0011809
689 Ga0501084_0131393
690 Ga0501084_0218935
691 Ga0501084_0360776
692 Ga0501084_0447166
693 Ga0501082_0010365
694 Ga0501082_0029606
695 Ga0501082_0074555
696 Ga0501082_0093312
697 Ga0501082_0148329
698 Ga0501082_0608342
699 Ga0530510_0000785
700 Ga0530510_0003255
701 Ga0530510_0013074
702 Ga0530510_0092951
703 Ga0530510_0605501
704 Ga0530510_0652756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14686

fn3_3

Polysaccharide lyase family 4, domain II

190

256

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ztd-assembly2.cif.gz_B x-ray crystal structure of pseudoazurin met16val variant 0.7923 92 174
4bwu-assembly1.cif.gz_A three-dimensional structure of the k109a mutant of paracoccus pantotrophus pseudoazurin at ph 5.5 0.7882 92 176
4u3s-assembly1.cif.gz_B crystal structure of coh3scab-xdoc_m1scaa complex: a n-terminal interface mutant of type ii cohesin-x-dockerin complex from acetivibrio cellulolyticus 0.787 178 226
5k39-assembly1.cif.gz_B the type ii cohesin dockerin complex from clostridium thermocellum 0.7712 178 226
1py0-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7696 93 174
ID Description Score Start End Superfamily
5m0yB01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8547 178 226 2.60.40.1120
af_Q9JHW1_795_903_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8442 179 227 2.60.40.1120
af_A1Z843_320_390_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8196 180 224 2.60.40.1120
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8073 179 228 2.60.40.1120
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8043 178 227 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A2T2UQN1-F1-model_v4 VWFA domain-containing protein 0.956 178 227 GO:0030246
AF-A0A7X4EFC6-F1-model_v4 TonB-dependent receptor 0.9478 177 227 GO:0009279
GO:0030246
AF-A0A1P9WWT7-F1-model_v4 TonB-dependent receptor 0.9418 178 230 GO:0009279
GO:0015344
GO:0030246
AF-A0A843T4S0-F1-model_v4 SusC/RagA family TonB-linked outer membrane protein 0.9374 177 227 GO:0009279
GO:0015344
AF-A0A418PX17-F1-model_v4 TonB-dependent receptor 0.9305 178 227

Map