F419100

General Info

Members Datasets Scaffolds Average Seq Length
352 220 704 116

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0287846|Ga0436364_0287846_242_652
Length 136
Sequence MTRYLLAIQQPDDPTDLDARPPGPERLAAIMRDVEAVRQDMVDAGVWVFSGGLHSASSATVVRTRGDEVLLTDGPYAEGKEQIGGLTILDAEDLDAALHWAGRLAKAIHPLPIEVRPFRDGGDEAERSSTIEQDDR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
137 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
142 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
143 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
144 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
145 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
146 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
147 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
151 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 2.84
Rhizosphere 92.9
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0287846 3300037853 Bacteria 4127
2 JGI25406J46586_10042011 3300003203 Bacteria 1604
3 JGI25405J52794_10115434 3300003911 Bacteria 604
4 Ga0065715_10148405 3300005293 Bacteria 1759
5 Ga0065707_10158986 3300005295 Bacteria 1581
6 Ga0070683_100002858 3300005329 Bacteria 13830
7 Ga0070690_100230833 3300005330 Bacteria 1301
8 Ga0070670_100257328 3300005331 Bacteria 1521
9 Ga0070677_10277457 3300005333 Bacteria 843
10 Ga0070666_10141284 3300005335 Bacteria 1677
11 Ga0070682_101231687 3300005337 Bacteria 633
12 Ga0070682_101800733 3300005337 Bacteria 534
13 Ga0070689_101918536 3300005340 Unclassified 541
14 Ga0070661_100463067 3300005344 Bacteria 1010
15 Ga0070675_100393470 3300005354 Bacteria 1235
16 Ga0070675_100697064 3300005354 Bacteria 925
17 Ga0070688_101220291 3300005365 Unclassified 605
18 Ga0070659_100019851 3300005366 Bacteria 5101
19 Ga0070667_101142464 3300005367 Unclassified 728
20 Ga0070709_10012142 3300005434 Bacteria 4816
21 Ga0070714_100022901 3300005435 Bacteria 5125
22 Ga0070714_100052161 3300005435 Bacteria 3488
23 Ga0070714_101593168 3300005435 Bacteria 638
24 Ga0070713_100021519 3300005436 Bacteria 4962
25 Ga0070713_100158077 3300005436 Bacteria 2021
26 Ga0070713_100449427 3300005436 Bacteria 1210
27 Ga0070713_100579538 3300005436 Bacteria 1064
28 Ga0070713_102104767 3300005436 Bacteria 547
29 Ga0070710_10461367 3300005437 Bacteria 863
30 Ga0070701_11138758 3300005438 Unclassified 551
31 Ga0070663_100500326 3300005455 Bacteria 1009
32 Ga0070663_100912824 3300005455 Bacteria 759
33 Ga0070678_100247037 3300005456 Bacteria 1495
34 Ga0070662_100325312 3300005457 Unclassified 1254
35 Ga0070662_101486871 3300005457 Bacteria 584
36 Ga0070681_10112115 3300005458 Bacteria 2667
37 Ga0070681_10200448 3300005458 Bacteria 1914
38 Ga0070685_10050088 3300005466 Bacteria 2411
39 Ga0070706_100573673 3300005467 Bacteria 1049
40 Ga0070706_100777215 3300005467 Bacteria 887
41 Ga0070706_100788477 3300005467 Bacteria 880
42 Ga0070706_101047136 3300005467 Bacteria 752
43 Ga0070707_100118706 3300005468 Bacteria 2567
44 Ga0070707_100179539 3300005468 Bacteria 2064
45 Ga0070698_100002445 3300005471 Bacteria 20477
46 Ga0070699_100446938 3300005518 Bacteria 1172
47 Ga0070699_100928567 3300005518 Bacteria 797
48 Ga0070684_100008488 3300005535 Bacteria 8034
49 Ga0070697_100004428 3300005536 Bacteria 10788
50 Ga0070697_101402626 3300005536 Bacteria 624
51 Ga0070697_101830573 3300005536 Bacteria 543
52 Ga0068853_101260317 3300005539 Bacteria 714
53 Ga0070686_100018949 3300005544 Bacteria 4048
54 Ga0070686_100395175 3300005544 Bacteria 1050
55 Ga0070686_100542955 3300005544 Bacteria 908
56 Ga0070696_100601153 3300005546 Bacteria 887
57 Ga0070665_100222007 3300005548 Bacteria 1890
58 Ga0070665_100266285 3300005548 Bacteria 1715
59 Ga0070704_100344948 3300005549 Bacteria 1255
60 Ga0070664_100011038 3300005564 Bacteria 7325
61 Ga0068857_100036864 3300005577 Bacteria 4332
62 Ga0068856_100163415 3300005614 Bacteria 2238
63 Ga0068859_100017965 3300005617 Bacteria 7107
64 Ga0068864_100082902 3300005618 Bacteria 2815
65 Ga0068863_100359970 3300005841 Bacteria 1418
66 Ga0068858_100019101 3300005842 Bacteria 6411
67 Ga0068858_100368087 3300005842 Bacteria 1378
68 Ga0068860_100550440 3300005843 Bacteria 1156
69 Ga0081455_10099504 3300005937 Bacteria 2338
70 Ga0081455_10264720 3300005937 Bacteria 1250
71 Ga0081538_10000507 3300005981 Bacteria 43544
72 Ga0081540_1011579 3300005983 Bacteria 5888
73 Ga0081539_10012311 3300005985 Bacteria 6616
74 Ga0081539_10305195 3300005985 Bacteria 683
75 Ga0070717_10017083 3300006028 Bacteria 5637
76 Ga0070717_10053818 3300006028 Bacteria 3318
77 Ga0070717_10061317 3300006028 Bacteria 3116
78 Ga0070717_10168850 3300006028 Bacteria 1902
79 Ga0070717_10304513 3300006028 Bacteria 1417
80 Ga0070717_10731758 3300006028 Bacteria 899
81 Ga0070716_100129121 3300006173 Bacteria 1595
82 Ga0070716_100687208 3300006173 Bacteria 780
83 Ga0070712_100026524 3300006175 Bacteria 3861
84 Ga0075366_10042742 3300006195 Bacteria 2684
85 Ga0068871_101975162 3300006358 Bacteria 555
86 Ga0075428_100016335 3300006844 Bacteria 8202
87 Ga0075430_100193516 3300006846 Bacteria 1690
88 Ga0075430_100612314 3300006846 Bacteria 898
89 Ga0075431_100025921 3300006847 Bacteria 6009
90 Ga0075431_100951600 3300006847 Bacteria 827
91 Ga0075433_10659158 3300006852 Bacteria 917
92 Ga0075429_100207885 3300006880 Bacteria 1715
93 Ga0075429_100391795 3300006880 Bacteria 1216
94 Ga0075429_100790801 3300006880 Bacteria 831
95 Ga0075436_100659780 3300006914 Bacteria 773
96 Ga0097620_100017965 3300006931 Bacteria 7107
97 Ga0111539_10285418 3300009094 Bacteria 1921
98 Ga0105247_10994178 3300009101 Unclassified 655
99 Ga0114129_10027107 3300009147 Bacteria 8112
100 Ga0114129_10435768 3300009147 Bacteria 1721
101 Ga0114129_10513692 3300009147 Bacteria 1563
102 Ga0105248_10047655 3300009177 Bacteria 4807
103 Ga0105248_10165866 3300009177 Bacteria 2490
104 Ga0105248_10350489 3300009177 Bacteria 1662
105 Ga0105249_10263627 3300009553 Bacteria 1713
106 Ga0105249_11057172 3300009553 Bacteria 881
107 Ga0105246_11179661 3300011119 Bacteria 704
108 Ga0157370_11570446 3300013104 Bacteria 591
109 Ga0157374_10199966 3300013296 Bacteria 1956
110 Ga0157372_10168383 3300013307 Bacteria 2534
111 Ga0163163_10080237 3300014325 Bacteria 3262
112 Ga0163163_10266702 3300014325 Bacteria 1763
113 Ga0157376_10534962 3300014969 Bacteria 1157
114 Ga0197907_11006349 3300020069 Bacteria 4612
115 Ga0206356_11101155 3300020070 Bacteria 3073
116 Ga0206354_10803581 3300020081 Bacteria 5780
117 Ga0206353_10121515 3300020082 Bacteria 2719
118 Ga0213875_10132207 3300021388 Bacteria 1167
119 Ga0209677_100284 3300025253 Bacteria 33586
120 Ga0207692_10641777 3300025898 Bacteria 685
121 Ga0207699_10181828 3300025906 Bacteria 1414
122 Ga0207699_10302837 3300025906 Bacteria 1117
123 Ga0207707_10139484 3300025912 Bacteria 2120
124 Ga0207707_10472320 3300025912 Bacteria 1072
125 Ga0207671_10659874 3300025914 Bacteria 833
126 Ga0207693_10065757 3300025915 Bacteria 2839
127 Ga0207649_10786765 3300025920 Bacteria 742
128 Ga0207646_10166870 3300025922 Bacteria 1988
129 Ga0207646_10281753 3300025922 Bacteria 1502
130 Ga0207659_10328443 3300025926 Bacteria 1264
131 Ga0207659_10461416 3300025926 Bacteria 1071
132 Ga0207700_10058996 3300025928 Bacteria 2901
133 Ga0207700_10221843 3300025928 Bacteria 1603
134 Ga0207700_10364545 3300025928 Bacteria 1260
135 Ga0207700_10638635 3300025928 Bacteria 949
136 Ga0207700_11761341 3300025928 Bacteria 545
137 Ga0207664_10027561 3300025929 Bacteria 4308
138 Ga0207664_10035923 3300025929 Bacteria 3827
139 Ga0207664_10152935 3300025929 Bacteria 1961
140 Ga0207664_11171440 3300025929 Bacteria 686
141 Ga0207690_10070306 3300025932 Bacteria 2411
142 Ga0207665_10191690 3300025939 Bacteria 1485
143 Ga0207665_10830213 3300025939 Bacteria 731
144 Ga0207711_10952206 3300025941 Bacteria 797
145 Ga0207661_10000561 3300025944 Bacteria 23743
146 Ga0207679_10068955 3300025945 Bacteria 2659
147 Ga0207679_11631620 3300025945 Bacteria 591
148 Ga0207712_10160969 3300025961 Bacteria 1744
149 Ga0207658_10941171 3300025986 Unclassified 787
150 Ga0207703_10016656 3300026035 Bacteria 5733
151 Ga0207703_10318315 3300026035 Bacteria 1424
152 Ga0207639_10933828 3300026041 Bacteria 811
153 Ga0207678_10433552 3300026067 Bacteria 1141
154 Ga0207702_11030718 3300026078 Bacteria 816
155 Ga0207641_10437367 3300026088 Bacteria 1262
156 Ga0207676_10075369 3300026095 Bacteria 2721
157 Ga0207674_10143702 3300026116 Bacteria 2345
158 Ga0207675_101252738 3300026118 Bacteria 762
159 Ga0207683_10303087 3300026121 Bacteria 1462
160 Ga0268266_10164325 3300028379 Bacteria 2010
161 Ga0268266_11259149 3300028379 Bacteria 715
162 Ga0268265_10314740 3300028380 Bacteria 1415
163 Ga0268265_10522018 3300028380 Bacteria 1123
164 Ga0268264_10571690 3300028381 Bacteria 1111
165 Ga0307515_10082552 3300028794 Bacteria 4154
166 Ga0265338_10453434 3300028800 Bacteria 908
167 Ga0307513_10672101 3300031456 Bacteria 742
168 Ga0307408_100012345 3300031548 Bacteria 5658
169 Ga0307408_100218064 3300031548 Bacteria 1555
170 Ga0307408_101846986 3300031548 Bacteria 578
171 Ga0307516_10708408 3300031730 Bacteria 664
172 Ga0307405_10080932 3300031731 Bacteria 2122
173 Ga0307405_10082998 3300031731 Bacteria 2099
174 Ga0307405_10201423 3300031731 Bacteria 1446
175 Ga0307405_10373205 3300031731 Bacteria 1108
176 Ga0307405_11304224 3300031731 Bacteria 632
177 Ga0307405_11917186 3300031731 Bacteria 529
178 Ga0307413_10263839 3300031824 Bacteria 1285
179 Ga0307413_11240125 3300031824 Bacteria 650
180 Ga0307410_10014878 3300031852 Bacteria 4595
181 Ga0307410_10110274 3300031852 Bacteria 1990
182 Ga0307410_10303182 3300031852 Bacteria 1261
183 Ga0307410_10413538 3300031852 Bacteria 1092
184 Ga0307410_11303949 3300031852 Bacteria 635
185 Ga0307406_10040016 3300031901 Bacteria 2912
186 Ga0307406_10118670 3300031901 Bacteria 1835
187 Ga0307406_10208294 3300031901 Bacteria 1445
188 Ga0307406_11320429 3300031901 Bacteria 630
189 Ga0307407_10075163 3300031903 Bacteria 2024
190 Ga0307407_10201078 3300031903 Bacteria 1335
191 Ga0307407_10309829 3300031903 Bacteria 1104
192 Ga0307407_10390902 3300031903 Bacteria 995
193 Ga0307407_10945551 3300031903 Bacteria 663
194 Ga0307412_10155108 3300031911 Bacteria 1694
195 Ga0307412_10618414 3300031911 Bacteria 920
196 Ga0307412_11806378 3300031911 Bacteria 562
197 Ga0307409_100005016 3300031995 Bacteria 7542
198 Ga0307409_100103590 3300031995 Bacteria 2367
199 Ga0307409_100181269 3300031995 Bacteria 1865
200 Ga0307409_100265129 3300031995 Bacteria 1579
201 Ga0307409_100736506 3300031995 Bacteria 988
202 Ga0307409_101347274 3300031995 Bacteria 739
203 Ga0307409_102338069 3300031995 Bacteria 564
204 Ga0307409_102746248 3300031995 Bacteria 520
205 Ga0307416_100002689 3300032002 Bacteria 10295
206 Ga0307416_100057986 3300032002 Bacteria 3136
207 Ga0307416_100085353 3300032002 Bacteria 2687
208 Ga0307416_100180984 3300032002 Bacteria 1976
209 Ga0307416_100983457 3300032002 Bacteria 946
210 Ga0307416_101324333 3300032002 Bacteria 826
211 Ga0307414_10047107 3300032004 Bacteria 2965
212 Ga0307414_10135543 3300032004 Bacteria 1919
213 Ga0307414_10766400 3300032004 Bacteria 878
214 Ga0307411_10127374 3300032005 Bacteria 1854
215 Ga0307411_10271611 3300032005 Bacteria 1345
216 Ga0307411_10609092 3300032005 Bacteria 940
217 Ga0307411_10762770 3300032005 Bacteria 848
218 Ga0307415_100015837 3300032126 Bacteria 4476
219 Ga0307415_100238072 3300032126 Bacteria 1470
220 Ga0307415_100391400 3300032126 Bacteria 1183
221 Ga0307415_100483072 3300032126 Bacteria 1079
222 Ga0307415_100798291 3300032126 Bacteria 861
223 Ga0373930_0039583 3300034816 Bacteria 1000
224 Ga0373932_0088726 3300035112 Bacteria 989
225 Ga0373941_0070000 3300035115 Bacteria 1162
226 Ga0373942_0004163 3300035207 Bacteria 3368
227 Ga0373937_1573574 3300036401 Bacteria 605
228 Ga0395899_0042313 3300037312 Bacteria 3401
229 Ga0395898_0451654 3300037466 Bacteria 1224
230 Ga0395898_0753602 3300037466 Bacteria 915
231 Ga0436364_1322392 3300037853 Bacteria 1985
232 Ga0395901_1895847 3300038443 Bacteria 544
233 Ga0436365_0467216 3300039437 Bacteria 32491
234 Ga0436363_0397961 3300039450 Bacteria 575
235 Ga0436363_0398135 3300039450 Bacteria 776
236 Ga0436363_1443414 3300039450 Bacteria 615
237 Ga0436362_1196713 3300039453 Bacteria 1686
238 Ga0451837_0229536 3300041494 Bacteria 551
239 Ga0439443_074092 3300042003 Bacteria 625
240 Ga0439448_0032353 3300042005 Bacteria 1664
241 Ga0439450_036093 3300042008 Bacteria 1130
242 Ga0439463_031875 3300042016 Bacteria 1331
243 Ga0450923_016948 3300042125 Bacteria 1378
244 Ga0450894_003275 3300042131 Bacteria 2124
245 Ga0450895_001299 3300042132 Bacteria 1711
246 Ga0450896_000302 3300042133 Bacteria 4662
247 Ga0450898_014244 3300042134 Bacteria 1335
248 Ga0450899_051277 3300042135 Bacteria 527
249 Ga0450906_037586 3300042145 Bacteria 854
250 Ga0439464_0008259 3300042439 Bacteria 2729
251 Ga0439464_0015306 3300042439 Bacteria 2069
252 Ga0439464_0101864 3300042439 Bacteria 873
253 Ga0439460_0091134 3300042461 Bacteria 969
254 Ga0439460_0123811 3300042461 Bacteria 848
255 Ga0450918_115696 3300042531 Bacteria 533
256 Ga0439440_0031704 3300042993 Bacteria 1251
257 Ga0466972_0078387 3300044658 Bacteria 1574
258 Ga0466965_0682450 3300044683 Bacteria 588
259 Ga0466966_0085886 3300044684 Bacteria 1956
260 Ga0466966_0205062 3300044684 Bacteria 1192
261 Ga0466966_0211834 3300044684 Bacteria 1171
262 Ga0466966_0604267 3300044684 Bacteria 660
263 Ga0466966_0802265 3300044684 Bacteria 568
264 Ga0466961_0053206 3300044693 Bacteria 2584
265 Ga0466961_0435501 3300044693 Bacteria 794
266 Ga0466963_0029490 3300044694 Bacteria 3533
267 Ga0466963_0293922 3300044694 Bacteria 1142
268 Ga0466971_0056407 3300044719 Bacteria 1772
269 Ga0466971_0131435 3300044719 Bacteria 1162
270 Ga0466970_0042744 3300044765 Bacteria 2410
271 Ga0466970_0102451 3300044765 Bacteria 1559
272 Ga0466970_0387902 3300044765 Unclassified 796
273 Ga0466957_0061299 3300044842 Bacteria 2308
274 Ga0466957_0367901 3300044842 Bacteria 978
275 Ga0466957_0526371 3300044842 Bacteria 822
276 Ga0466957_1286971 3300044842 Bacteria 530
277 Ga0466960_0048730 3300044901 Bacteria 2037
278 Ga0466959_0026159 3300045049 Bacteria 4326
279 Ga0466959_0116173 3300045049 Bacteria 1905
280 Ga0451576_0331138 3300045051 Bacteria 1594
281 Ga0466958_0020479 3300045836 Bacteria 3857
282 Ga0466958_0030522 3300045836 Bacteria 3202
283 Ga0466958_0271643 3300045836 Bacteria 1086
284 Ga0466958_0885769 3300045836 Bacteria 582
285 Ga0466958_1112080 3300045836 Bacteria 516
286 Ga0466967_0018400 3300045976 Bacteria 5581
287 Ga0466967_0965631 3300045976 Bacteria 848
288 Ga0466967_1096845 3300045976 Bacteria 793
289 Ga0466967_1259190 3300045976 Unclassified 737
290 Ga0495651_0019093 3300046462 Bacteria 5312
291 Ga0495662_0553860 3300046476 Bacteria 563
292 Ga0495664_0478269 3300046477 Bacteria 745
293 Ga0495628_0562357 3300046516 Bacteria 818
294 Ga0495631_0152714 3300046518 Bacteria 991
295 Ga0495652_0287227 3300046529 Bacteria 1202
296 Ga0495611_0486876 3300046648 Bacteria 561
297 Ga0495658_0670721 3300046683 Bacteria 664
298 Ga0495671_0378149 3300046692 Bacteria 679
299 Ga0495600_0585469 3300046809 Bacteria 679
300 Ga0496102_0173673 3300048905 Bacteria 2029
301 Ga0496104_0076054 3300048907 Bacteria 3197
302 Ga0496105_0007508 3300048908 Bacteria 8446
303 Ga0496105_1298364 3300048908 Bacteria 531
304 Ga0496108_0661630 3300048911 Bacteria 907
305 Ga0496110_0026661 3300048913 Bacteria 4948
306 Ga0496111_0062166 3300048914 Bacteria 2707
307 Ga0496112_0580546 3300048915 Bacteria 1053
308 Ga0496113_0937967 3300048916 Bacteria 683
309 Ga0496114_1585988 3300048917 Bacteria 543
310 Ga0501031_0132590 3300049568 Bacteria 1628
311 Ga0501032_0245821 3300049569 Bacteria 1162
312 Ga0501033_0482738 3300049570 Bacteria 858
313 Ga0501036_0056246 3300049572 Bacteria 3333
314 Ga0501037_0543881 3300049573 Bacteria 784
315 Ga0501038_0163368 3300049574 Bacteria 1808
316 Ga0501040_0179064 3300049576 Bacteria 1502
317 Ga0501041_0066722 3300049577 Bacteria 2205
318 Ga0501042_0020964 3300049578 Bacteria 4551
319 Ga0501043_0030173 3300049579 Bacteria 4260
320 Ga0501046_0037268 3300049580 Bacteria 3908
321 Ga0501048_0288919 3300049582 Bacteria 1166
322 Ga0501068_0930355 3300049584 Bacteria 572
323 Ga0501071_0016923 3300049587 Bacteria 5018
324 Ga0501072_0017622 3300049588 Bacteria 5492
325 Ga0501075_0300805 3300049591 Bacteria 1222
326 Ga0501077_0002109 3300049593 Bacteria 11994
327 Ga0501079_0028083 3300049741 Bacteria 4316
328 Ga0501081_0004983 3300049743 Bacteria 8550
329 Ga0501083_1031742 3300049744 Bacteria 535
330 Ga0501280_078214 3300049776 Bacteria 604
331 Ga0501035_0102330 3300049822 Bacteria 2513
332 Ga0501045_0013428 3300049824 Bacteria 5786
333 nmdc:mga03683_441273_c1 3300050489 Bacteria 625
334 nmdc:mga0k408_21647_c1 3300050493 Bacteria 3613
335 nmdc:mga05p37_1067732_c1 3300050507 Bacteria 850
336 nmdc:mga05p37_466205_c1 3300050507 Bacteria 1458
337 nmdc:mga05p37_562578_c1 3300050507 Bacteria 1295
338 nmdc:mga05p37_762931_c1 3300050507 Bacteria 1064
339 nmdc:mga09592_165525_c1 3300050508 Bacteria 1911
340 nmdc:mga0qj67_116356_c1 3300050509 Bacteria 2160
341 nmdc:mga0qj67_314623_c1 3300050509 Bacteria 1268
342 nmdc:mga06r32_565910_c1 3300050510 Bacteria 1109
343 nmdc:mga08y16_284471_c1 3300050511 Bacteria 1705
344 nmdc:mga0n895_368776_c1 3300050512 Bacteria 1454
345 nmdc:mga0a205_82250_c1 3300050515 Bacteria 3110
346 Ga0495595_0584110 3300053084 Unclassified 571
347 Ga0501084_0052023 3300054114 Bacteria 3427
348 Ga0501084_1143385 3300054114 Bacteria 653
349 Ga0501082_0487686 3300060353 Bacteria 1077
350 Ga0466962_0045009 3300061719 Bacteria 2110
351 Ga0466962_0545178 3300061719 Bacteria 589
352 Ga0530510_0005469 3300061734 Bacteria 8793
353 Ga0436364_0287846
354 JGI25406J46586_10042011
355 JGI25405J52794_10115434
356 Ga0065715_10148405
357 Ga0065707_10158986
358 Ga0070683_100002858
359 Ga0070690_100230833
360 Ga0070670_100257328
361 Ga0070677_10277457
362 Ga0070666_10141284
363 Ga0070682_101231687
364 Ga0070682_101800733
365 Ga0070689_101918536
366 Ga0070661_100463067
367 Ga0070675_100393470
368 Ga0070675_100697064
369 Ga0070688_101220291
370 Ga0070659_100019851
371 Ga0070667_101142464
372 Ga0070709_10012142
373 Ga0070714_100022901
374 Ga0070714_100052161
375 Ga0070714_101593168
376 Ga0070713_100021519
377 Ga0070713_100158077
378 Ga0070713_100449427
379 Ga0070713_100579538
380 Ga0070713_102104767
381 Ga0070710_10461367
382 Ga0070701_11138758
383 Ga0070663_100500326
384 Ga0070663_100912824
385 Ga0070678_100247037
386 Ga0070662_100325312
387 Ga0070662_101486871
388 Ga0070681_10112115
389 Ga0070681_10200448
390 Ga0070685_10050088
391 Ga0070706_100573673
392 Ga0070706_100777215
393 Ga0070706_100788477
394 Ga0070706_101047136
395 Ga0070707_100118706
396 Ga0070707_100179539
397 Ga0070698_100002445
398 Ga0070699_100446938
399 Ga0070699_100928567
400 Ga0070684_100008488
401 Ga0070697_100004428
402 Ga0070697_101402626
403 Ga0070697_101830573
404 Ga0068853_101260317
405 Ga0070686_100018949
406 Ga0070686_100395175
407 Ga0070686_100542955
408 Ga0070696_100601153
409 Ga0070665_100222007
410 Ga0070665_100266285
411 Ga0070704_100344948
412 Ga0070664_100011038
413 Ga0068857_100036864
414 Ga0068856_100163415
415 Ga0068859_100017965
416 Ga0068864_100082902
417 Ga0068863_100359970
418 Ga0068858_100019101
419 Ga0068858_100368087
420 Ga0068860_100550440
421 Ga0081455_10099504
422 Ga0081455_10264720
423 Ga0081538_10000507
424 Ga0081540_1011579
425 Ga0081539_10012311
426 Ga0081539_10305195
427 Ga0070717_10017083
428 Ga0070717_10053818
429 Ga0070717_10061317
430 Ga0070717_10168850
431 Ga0070717_10304513
432 Ga0070717_10731758
433 Ga0070716_100129121
434 Ga0070716_100687208
435 Ga0070712_100026524
436 Ga0075366_10042742
437 Ga0068871_101975162
438 Ga0075428_100016335
439 Ga0075430_100193516
440 Ga0075430_100612314
441 Ga0075431_100025921
442 Ga0075431_100951600
443 Ga0075433_10659158
444 Ga0075429_100207885
445 Ga0075429_100391795
446 Ga0075429_100790801
447 Ga0075436_100659780
448 Ga0097620_100017965
449 Ga0111539_10285418
450 Ga0105247_10994178
451 Ga0114129_10027107
452 Ga0114129_10435768
453 Ga0114129_10513692
454 Ga0105248_10047655
455 Ga0105248_10165866
456 Ga0105248_10350489
457 Ga0105249_10263627
458 Ga0105249_11057172
459 Ga0105246_11179661
460 Ga0157370_11570446
461 Ga0157374_10199966
462 Ga0157372_10168383
463 Ga0163163_10080237
464 Ga0163163_10266702
465 Ga0157376_10534962
466 Ga0197907_11006349
467 Ga0206356_11101155
468 Ga0206354_10803581
469 Ga0206353_10121515
470 Ga0213875_10132207
471 Ga0209677_100284
472 Ga0207692_10641777
473 Ga0207699_10181828
474 Ga0207699_10302837
475 Ga0207707_10139484
476 Ga0207707_10472320
477 Ga0207671_10659874
478 Ga0207693_10065757
479 Ga0207649_10786765
480 Ga0207646_10166870
481 Ga0207646_10281753
482 Ga0207659_10328443
483 Ga0207659_10461416
484 Ga0207700_10058996
485 Ga0207700_10221843
486 Ga0207700_10364545
487 Ga0207700_10638635
488 Ga0207700_11761341
489 Ga0207664_10027561
490 Ga0207664_10035923
491 Ga0207664_10152935
492 Ga0207664_11171440
493 Ga0207690_10070306
494 Ga0207665_10191690
495 Ga0207665_10830213
496 Ga0207711_10952206
497 Ga0207661_10000561
498 Ga0207679_10068955
499 Ga0207679_11631620
500 Ga0207712_10160969
501 Ga0207658_10941171
502 Ga0207703_10016656
503 Ga0207703_10318315
504 Ga0207639_10933828
505 Ga0207678_10433552
506 Ga0207702_11030718
507 Ga0207641_10437367
508 Ga0207676_10075369
509 Ga0207674_10143702
510 Ga0207675_101252738
511 Ga0207683_10303087
512 Ga0268266_10164325
513 Ga0268266_11259149
514 Ga0268265_10314740
515 Ga0268265_10522018
516 Ga0268264_10571690
517 Ga0307515_10082552
518 Ga0265338_10453434
519 Ga0307513_10672101
520 Ga0307408_100012345
521 Ga0307408_100218064
522 Ga0307408_101846986
523 Ga0307516_10708408
524 Ga0307405_10080932
525 Ga0307405_10082998
526 Ga0307405_10201423
527 Ga0307405_10373205
528 Ga0307405_11304224
529 Ga0307405_11917186
530 Ga0307413_10263839
531 Ga0307413_11240125
532 Ga0307410_10014878
533 Ga0307410_10110274
534 Ga0307410_10303182
535 Ga0307410_10413538
536 Ga0307410_11303949
537 Ga0307406_10040016
538 Ga0307406_10118670
539 Ga0307406_10208294
540 Ga0307406_11320429
541 Ga0307407_10075163
542 Ga0307407_10201078
543 Ga0307407_10309829
544 Ga0307407_10390902
545 Ga0307407_10945551
546 Ga0307412_10155108
547 Ga0307412_10618414
548 Ga0307412_11806378
549 Ga0307409_100005016
550 Ga0307409_100103590
551 Ga0307409_100181269
552 Ga0307409_100265129
553 Ga0307409_100736506
554 Ga0307409_101347274
555 Ga0307409_102338069
556 Ga0307409_102746248
557 Ga0307416_100002689
558 Ga0307416_100057986
559 Ga0307416_100085353
560 Ga0307416_100180984
561 Ga0307416_100983457
562 Ga0307416_101324333
563 Ga0307414_10047107
564 Ga0307414_10135543
565 Ga0307414_10766400
566 Ga0307411_10127374
567 Ga0307411_10271611
568 Ga0307411_10609092
569 Ga0307411_10762770
570 Ga0307415_100015837
571 Ga0307415_100238072
572 Ga0307415_100391400
573 Ga0307415_100483072
574 Ga0307415_100798291
575 Ga0373930_0039583
576 Ga0373932_0088726
577 Ga0373941_0070000
578 Ga0373942_0004163
579 Ga0373937_1573574
580 Ga0395899_0042313
581 Ga0395898_0451654
582 Ga0395898_0753602
583 Ga0436364_1322392
584 Ga0395901_1895847
585 Ga0436365_0467216
586 Ga0436363_0397961
587 Ga0436363_0398135
588 Ga0436363_1443414
589 Ga0436362_1196713
590 Ga0451837_0229536
591 Ga0439443_074092
592 Ga0439448_0032353
593 Ga0439450_036093
594 Ga0439463_031875
595 Ga0450923_016948
596 Ga0450894_003275
597 Ga0450895_001299
598 Ga0450896_000302
599 Ga0450898_014244
600 Ga0450899_051277
601 Ga0450906_037586
602 Ga0439464_0008259
603 Ga0439464_0015306
604 Ga0439464_0101864
605 Ga0439460_0091134
606 Ga0439460_0123811
607 Ga0450918_115696
608 Ga0439440_0031704
609 Ga0466972_0078387
610 Ga0466965_0682450
611 Ga0466966_0085886
612 Ga0466966_0205062
613 Ga0466966_0211834
614 Ga0466966_0604267
615 Ga0466966_0802265
616 Ga0466961_0053206
617 Ga0466961_0435501
618 Ga0466963_0029490
619 Ga0466963_0293922
620 Ga0466971_0056407
621 Ga0466971_0131435
622 Ga0466970_0042744
623 Ga0466970_0102451
624 Ga0466970_0387902
625 Ga0466957_0061299
626 Ga0466957_0367901
627 Ga0466957_0526371
628 Ga0466957_1286971
629 Ga0466960_0048730
630 Ga0466959_0026159
631 Ga0466959_0116173
632 Ga0451576_0331138
633 Ga0466958_0020479
634 Ga0466958_0030522
635 Ga0466958_0271643
636 Ga0466958_0885769
637 Ga0466958_1112080
638 Ga0466967_0018400
639 Ga0466967_0965631
640 Ga0466967_1096845
641 Ga0466967_1259190
642 Ga0495651_0019093
643 Ga0495662_0553860
644 Ga0495664_0478269
645 Ga0495628_0562357
646 Ga0495631_0152714
647 Ga0495652_0287227
648 Ga0495611_0486876
649 Ga0495658_0670721
650 Ga0495671_0378149
651 Ga0495600_0585469
652 Ga0496102_0173673
653 Ga0496104_0076054
654 Ga0496105_0007508
655 Ga0496105_1298364
656 Ga0496108_0661630
657 Ga0496110_0026661
658 Ga0496111_0062166
659 Ga0496112_0580546
660 Ga0496113_0937967
661 Ga0496114_1585988
662 Ga0501031_0132590
663 Ga0501032_0245821
664 Ga0501033_0482738
665 Ga0501036_0056246
666 Ga0501037_0543881
667 Ga0501038_0163368
668 Ga0501040_0179064
669 Ga0501041_0066722
670 Ga0501042_0020964
671 Ga0501043_0030173
672 Ga0501046_0037268
673 Ga0501048_0288919
674 Ga0501068_0930355
675 Ga0501071_0016923
676 Ga0501072_0017622
677 Ga0501075_0300805
678 Ga0501077_0002109
679 Ga0501079_0028083
680 Ga0501081_0004983
681 Ga0501083_1031742
682 Ga0501280_078214
683 Ga0501035_0102330
684 Ga0501045_0013428
685 nmdc:mga03683_441273_c1
686 nmdc:mga0k408_21647_c1
687 nmdc:mga05p37_1067732_c1
688 nmdc:mga05p37_466205_c1
689 nmdc:mga05p37_562578_c1
690 nmdc:mga05p37_762931_c1
691 nmdc:mga09592_165525_c1
692 nmdc:mga0qj67_116356_c1
693 nmdc:mga0qj67_314623_c1
694 nmdc:mga06r32_565910_c1
695 nmdc:mga08y16_284471_c1
696 nmdc:mga0n895_368776_c1
697 nmdc:mga0a205_82250_c1
698 Ga0495595_0584110
699 Ga0501084_0052023
700 Ga0501084_1143385
701 Ga0501082_0487686
702 Ga0466962_0045009
703 Ga0466962_0545178
704 Ga0530510_0005469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

3

109

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.908 2 112
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8563 2 112
2qz8-assembly1.cif.gz_B-2 crystal structure of mycobacterium tuberculosis leucine response regulatory protein (lrpa) 0.6855 3 117
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.6793 3 117
2w25-assembly1.cif.gz_B crystal structure of glu104ala mutant 0.6708 2 117
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.908 2 112 3.30.70.1060
4f3nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8753 14 42 3.40.50.12710
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8563 2 112 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7281 3 117 3.30.70.1060
af_P71888_58_138_3.30.70.920 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.7128 2 111 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A399VG70-F1-model_v4 deleted 0.9795 1 111
AF-A0A512DDB6-F1-model_v4 YCII-related domain-containing protein 0.9673 1 111
AF-A0A0K8QD08-F1-model_v4 Uncharacterized protein R00369 0.965 25 115
AF-R1I1H2-F1-model_v4 YCII-related domain-containing protein 0.9636 2 113
AF-A0A543I5X8-F1-model_v4 YCII-related domain-containing protein 0.962 1 113

Map