F419066

General Info

Members Datasets Scaffolds Average Seq Length
352 237 704 440

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10057200|Ga0265331_100572002
Length 486
Sequence VLSCLAGSGGPPCVAQVQADWSVCVSDTFMWNEKCERMSRPELEILQLGRLKNLIERLYEKVPFYKKQMDERGVSARSLNTLADLKNFPFTKKSDLRDHYPFGLFSEPLTNVTRLHASSGTKGKPTVVGYTKNDLDMWSEVCARSLGAAGARPGDILHNSYGYGLFTGGLGMHFGAEKFGATVVPASGGRTQQQILLLQDFGSRILCSTPSYALNIAYTMEEHGIKRQSIKLERGIFGAEPWTEELRNQIEEKLKIEALDIYGLSEIVGPGVSMECAQGRNGLHIWEDHFIPEIIDPKTGAVLPIGEEGELVFTTLTKEAIPVLRYRTGDISRLALDTCCCGRTMARMQRVRARLDDMLIIRGVNVYPSEIEKVLLALEELSPHYQLVIDRKKALDSLEVRVEVTEELIKAWGHFDDGRIEFSNLSGQIQMLLKDNLGITADVQLMKPKDVPRSEGKAVRVIDNRKEEKSEVENPAPKTAVSSKGK

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
140 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
169 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
234 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
235 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
236 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
237 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 0.28
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 1.99
Rhizosphere 94.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10057200 3300031250 Bacteria 1850
2 JGI24744J21845_10010375 3300002077 Bacteria 1908
3 Ga0055538_1000275 3300003751 Bacteria 26490
4 Ga0055541_1001199 3300003841 Bacteria 5772
5 Ga0065707_10008304 3300005295 Bacteria 2564
6 Ga0070676_10002754 3300005328 Bacteria 9076
7 Ga0070683_100003262 3300005329 Bacteria 13111
8 Ga0070683_100031613 3300005329 Bacteria 4815
9 Ga0070670_100009072 3300005331 Bacteria 8499
10 Ga0070670_100014135 3300005331 Bacteria 6847
11 Ga0068868_100022515 3300005338 Bacteria 4757
12 Ga0070660_100015964 3300005339 Bacteria 5438
13 Ga0070660_100095379 3300005339 Bacteria 2351
14 Ga0070689_100189014 3300005340 Bacteria 1676
15 Ga0070691_10047252 3300005341 Bacteria 2046
16 Ga0070687_100017683 3300005343 Bacteria 3284
17 Ga0070661_100000852 3300005344 Bacteria 21878
18 Ga0070661_100004623 3300005344 Bacteria 9473
19 Ga0070661_100031168 3300005344 Bacteria 3855
20 Ga0070661_100116239 3300005344 Bacteria 2001
21 Ga0070692_10062312 3300005345 Bacteria 1968
22 Ga0070668_100003216 3300005347 Bacteria 12032
23 Ga0070669_100004725 3300005353 Bacteria 9818
24 Ga0070669_100049837 3300005353 Bacteria 3058
25 Ga0070675_100044251 3300005354 Bacteria 3640
26 Ga0070675_100067921 3300005354 Bacteria 2950
27 Ga0070671_100000608 3300005355 Bacteria 25561
28 Ga0070674_100002886 3300005356 Bacteria 9512
29 Ga0070673_100015046 3300005364 Bacteria 5415
30 Ga0070673_100100072 3300005364 Bacteria 2386
31 Ga0070688_100093538 3300005365 Bacteria 1969
32 Ga0070659_100002542 3300005366 Bacteria 12972
33 Ga0070659_100002934 3300005366 Bacteria 12150
34 Ga0070659_100030865 3300005366 Bacteria 4148
35 Ga0070667_100017438 3300005367 Bacteria 5951
36 Ga0070710_10000103 3300005437 Bacteria 39384
37 Ga0070701_10002246 3300005438 Bacteria 7389
38 Ga0070701_10041834 3300005438 Bacteria 2336
39 Ga0070711_100132423 3300005439 Bacteria 1859
40 Ga0070700_100003021 3300005441 Bacteria 8627
41 Ga0070694_100101483 3300005444 Bacteria 2036
42 Ga0070708_100021089 3300005445 Bacteria 5503
43 Ga0070663_100019660 3300005455 Bacteria 4459
44 Ga0070663_100156819 3300005455 Bacteria 1750
45 Ga0070678_100121704 3300005456 Bacteria 2059
46 Ga0070662_100002973 3300005457 Bacteria 10530
47 Ga0070662_100003302 3300005457 Bacteria 10050
48 Ga0070681_10002141 3300005458 Bacteria 17952
49 Ga0068867_100014567 3300005459 Bacteria 5572
50 Ga0068867_100028984 3300005459 Bacteria 3987
51 Ga0070685_10016186 3300005466 Bacteria 3970
52 Ga0070706_100019737 3300005467 Bacteria 6217
53 Ga0070698_100006706 3300005471 Bacteria 12489
54 Ga0070698_100199145 3300005471 Bacteria 1939
55 Ga0070684_100006611 3300005535 Bacteria 8980
56 Ga0070684_100008666 3300005535 Bacteria 7971
57 Ga0070684_100028903 3300005535 Bacteria 4692
58 Ga0070684_100038284 3300005535 Bacteria 4119
59 Ga0068853_100027219 3300005539 Bacteria 4803
60 Ga0068853_100033334 3300005539 Bacteria 4369
61 Ga0068853_100044979 3300005539 Bacteria 3780
62 Ga0070672_100020070 3300005543 Bacteria 4868
63 Ga0070672_100089429 3300005543 Bacteria 2481
64 Ga0070665_100045604 3300005548 Bacteria 4403
65 Ga0070704_100015152 3300005549 Bacteria 4836
66 Ga0068855_100000806 3300005563 Bacteria 38723
67 Ga0068855_100107141 3300005563 Bacteria 3211
68 Ga0068855_100339213 3300005563 Bacteria 1657
69 Ga0070664_100001746 3300005564 Bacteria 17401
70 Ga0068857_100016219 3300005577 Bacteria 6526
71 Ga0068857_100030506 3300005577 Bacteria 4761
72 Ga0068857_100173715 3300005577 Bacteria 1959
73 Ga0068854_100039492 3300005578 Bacteria 3325
74 Ga0068854_100074937 3300005578 Bacteria 2483
75 Ga0068856_100000299 3300005614 Bacteria 54390
76 Ga0068852_100017181 3300005616 Bacteria 5670
77 Ga0068852_100026204 3300005616 Bacteria 4735
78 Ga0068859_100040392 3300005617 Bacteria 4683
79 Ga0068866_10117375 3300005718 Bacteria 1494
80 Ga0068861_100000503 3300005719 Bacteria 22776
81 Ga0068861_100056606 3300005719 Bacteria 2993
82 Ga0068861_100083339 3300005719 Bacteria 2508
83 Ga0068870_10010835 3300005840 Bacteria 4204
84 Ga0068870_10038928 3300005840 Bacteria 2457
85 Ga0068863_100010735 3300005841 Bacteria 8892
86 Ga0068858_100077678 3300005842 Bacteria 3084
87 Ga0068860_100007574 3300005843 Bacteria 10864
88 Ga0068862_100009563 3300005844 Bacteria 8016
89 Ga0081539_10006617 3300005985 Bacteria 11001
90 Ga0075366_10055275 3300006195 Bacteria 2358
91 Ga0075428_100015124 3300006844 Bacteria 8567
92 Ga0075428_100016001 3300006844 Bacteria 8295
93 Ga0075428_100038351 3300006844 Bacteria 5272
94 Ga0075428_100124568 3300006844 Bacteria 2805
95 Ga0075431_100054522 3300006847 Bacteria 4123
96 Ga0075431_100281863 3300006847 Bacteria 1683
97 Ga0075434_100049356 3300006871 Bacteria 4179
98 Ga0075429_100008386 3300006880 Bacteria 8994
99 Ga0075429_100112386 3300006880 Bacteria 2381
100 Ga0075429_100120906 3300006880 Bacteria 2289
101 Ga0068865_100002529 3300006881 Bacteria 10830
102 Ga0068865_100028571 3300006881 Bacteria 3693
103 Ga0097620_100040394 3300006931 Bacteria 4683
104 Ga0075435_100127386 3300007076 Bacteria 2129
105 Ga0105240_10196235 3300009093 Bacteria 2370
106 Ga0111539_10412662 3300009094 Bacteria 1573
107 Ga0105245_10014369 3300009098 Bacteria 6899
108 Ga0114129_10015735 3300009147 Bacteria 10754
109 Ga0114129_10023644 3300009147 Bacteria 8710
110 Ga0114129_10059507 3300009147 Bacteria 5341
111 Ga0105243_10003654 3300009148 Bacteria 12382
112 Ga0105242_10007829 3300009176 Bacteria 8221
113 Ga0105242_10048027 3300009176 Bacteria 3468
114 Ga0105248_10003247 3300009177 Bacteria 18031
115 Ga0105248_10007174 3300009177 Bacteria 12226
116 Ga0105248_10007535 3300009177 Bacteria 11949
117 Ga0105238_10086839 3300009551 Bacteria 3115
118 Ga0105238_10180982 3300009551 Bacteria 2085
119 Ga0105249_10000423 3300009553 Bacteria 40301
120 Ga0105249_10010028 3300009553 Bacteria 8314
121 Ga0105239_10012131 3300010375 Bacteria 9610
122 Ga0105239_10182649 3300010375 Bacteria 2347
123 Ga0157373_10008077 3300013100 Bacteria 7820
124 Ga0157371_10000210 3300013102 Bacteria 84791
125 Ga0157371_10023785 3300013102 Bacteria 4478
126 Ga0157369_10038850 3300013105 Bacteria 5203
127 Ga0157369_10072590 3300013105 Bacteria 3694
128 Ga0157374_10021399 3300013296 Bacteria 5754
129 Ga0163162_10067124 3300013306 Bacteria 3637
130 Ga0157372_10001225 3300013307 Bacteria 27767
131 Ga0157372_10016494 3300013307 Bacteria 7927
132 Ga0157375_10141334 3300013308 Bacteria 2535
133 Ga0163163_10025487 3300014325 Bacteria 5637
134 Ga0157380_10011621 3300014326 Bacteria 6364
135 Ga0157377_10005018 3300014745 Bacteria 6177
136 Ga0157377_10010094 3300014745 Bacteria 4660
137 Ga0157379_10007191 3300014968 Bacteria 9629
138 Ga0206353_11966912 3300020082 Bacteria 2109
139 Ga0213872_10023339 3300021361 Bacteria 2846
140 Ga0209784_100361 3300025224 Bacteria 21944
141 Ga0209566_100049 3300025225 Bacteria 240746
142 Ga0209258_103667 3300025242 Bacteria 3207
143 Ga0209676_1000743 3300025292 Bacteria 44174
144 Ga0207692_10000070 3300025898 Bacteria 29852
145 Ga0207645_10002669 3300025907 Bacteria 13889
146 Ga0207643_10002653 3300025908 Bacteria 9676
147 Ga0207707_10001826 3300025912 Bacteria 19517
148 Ga0207660_10032298 3300025917 Bacteria 3613
149 Ga0207662_10001420 3300025918 Bacteria 11611
150 Ga0207657_10000682 3300025919 Bacteria 36172
151 Ga0207657_10012759 3300025919 Bacteria 8274
152 Ga0207649_10006587 3300025920 Bacteria 6309
153 Ga0207652_10022712 3300025921 Bacteria 5194
154 Ga0207681_10012515 3300025923 Bacteria 5234
155 Ga0207650_10087246 3300025925 Bacteria 2377
156 Ga0207659_10014406 3300025926 Bacteria 5099
157 Ga0207659_10110689 3300025926 Bacteria 2087
158 Ga0207687_10019301 3300025927 Bacteria 4516
159 Ga0207644_10007148 3300025931 Bacteria 7273
160 Ga0207690_10005517 3300025932 Bacteria 7466
161 Ga0207706_10000114 3300025933 Bacteria 86582
162 Ga0207706_10000481 3300025933 Bacteria 42622
163 Ga0207706_10017711 3300025933 Bacteria 6417
164 Ga0207709_10047381 3300025935 Bacteria 2613
165 Ga0207704_10099858 3300025938 Bacteria 1931
166 Ga0207704_10108137 3300025938 Bacteria 1872
167 Ga0207691_10012974 3300025940 Bacteria 7979
168 Ga0207691_10013505 3300025940 Bacteria 7811
169 Ga0207691_10061011 3300025940 Bacteria 3426
170 Ga0207691_10080256 3300025940 Bacteria 2935
171 Ga0207691_10107253 3300025940 Bacteria 2487
172 Ga0207711_10023128 3300025941 Bacteria 5203
173 Ga0207711_10024807 3300025941 Bacteria 5030
174 Ga0207689_10024090 3300025942 Bacteria 5106
175 Ga0207661_10001366 3300025944 Bacteria 16371
176 Ga0207661_10090694 3300025944 Bacteria 2545
177 Ga0207661_10092590 3300025944 Bacteria 2520
178 Ga0207679_10006287 3300025945 Bacteria 7495
179 Ga0207679_10019137 3300025945 Bacteria 4596
180 Ga0207679_10064973 3300025945 Bacteria 2729
181 Ga0207667_10001902 3300025949 Bacteria 26208
182 Ga0207651_10059514 3300025960 Bacteria 2647
183 Ga0207651_10124528 3300025960 Bacteria 1961
184 Ga0207712_10002846 3300025961 Bacteria 11080
185 Ga0207712_10011957 3300025961 Bacteria 5538
186 Ga0207668_10137623 3300025972 Bacteria 1873
187 Ga0207640_10011340 3300025981 Bacteria 5045
188 Ga0207677_10195658 3300026023 Bacteria 1603
189 Ga0207639_10008071 3300026041 Bacteria 7198
190 Ga0207639_10066424 3300026041 Bacteria 2803
191 Ga0207639_10153513 3300026041 Bacteria 1931
192 Ga0207678_10015935 3300026067 Bacteria 6602
193 Ga0207678_10048984 3300026067 Bacteria 3651
194 Ga0207708_10001377 3300026075 Bacteria 18288
195 Ga0207702_10002438 3300026078 Bacteria 17627
196 Ga0207702_10218630 3300026078 Bacteria 1775
197 Ga0207648_10006282 3300026089 Bacteria 11824
198 Ga0207648_10030371 3300026089 Bacteria 4786
199 Ga0207676_10010898 3300026095 Bacteria 6485
200 Ga0207674_10002583 3300026116 Bacteria 22787
201 Ga0207674_10002993 3300026116 Bacteria 20958
202 Ga0207674_10057259 3300026116 Bacteria 3951
203 Ga0207675_100000338 3300026118 Bacteria 44988
204 Ga0207675_100002328 3300026118 Bacteria 18830
205 Ga0207683_10114416 3300026121 Bacteria 2417
206 Ga0207698_10011292 3300026142 Bacteria 5782
207 Ga0207698_10020846 3300026142 Bacteria 4521
208 Ga0209971_1005706 3300027682 Bacteria 2948
209 Ga0209974_10016895 3300027876 Bacteria 2422
210 Ga0268266_10086814 3300028379 Bacteria 2736
211 Ga0268265_10202798 3300028380 Bacteria 1722
212 Ga0268264_10029955 3300028381 Bacteria 4462
213 Ga0265338_10060857 3300028800 Bacteria 3312
214 Ga0316176_1122362 3300030732 Bacteria 4731
215 Ga0314311_1086617 3300030733 Bacteria 16446
216 Ga0265330_10001521 3300031235 Bacteria 13377
217 Ga0265332_10001451 3300031238 Bacteria 13275
218 Ga0265325_10031553 3300031241 Bacteria 2834
219 Ga0265329_10003403 3300031242 Bacteria 6936
220 Ga0265339_10045585 3300031249 Bacteria 2413
221 Ga0265331_10007245 3300031250 Bacteria 6433
222 Ga0265327_10011878 3300031251 Bacteria 5948
223 Ga0265316_10044448 3300031344 Bacteria 3533
224 Ga0307408_100105505 3300031548 Bacteria 2154
225 Ga0265313_10003669 3300031595 Bacteria 12268
226 Ga0265314_10016267 3300031711 Bacteria 5884
227 Ga0265342_10044496 3300031712 Bacteria 2675
228 Ga0307406_10008808 3300031901 Bacteria 5640
229 Ga0373940_0000788 3300035088 Bacteria 5214
230 Ga0373944_0011139 3300035089 Bacteria 2461
231 Ga0373936_0033146 3300035113 Bacteria 2046
232 Ga0373939_0001015 3300035114 Bacteria 6934
233 Ga0373943_0000872 3300035170 Bacteria 13260
234 Ga0373943_0044053 3300035170 Bacteria 2170
235 Ga0373946_0039035 3300035171 Bacteria 1937
236 Ga0373931_0000525 3300035691 Bacteria 15676
237 Ga0373935_0103310 3300035692 Bacteria 1882
238 Ga0373927_0002164 3300035695 Bacteria 14426
239 Ga0373927_0009827 3300035695 Bacteria 6413
240 Ga0373933_0064955 3300035724 Bacteria 2209
241 Ga0373947_0000605 3300035725 Bacteria 21128
242 Ga0373947_0006767 3300035725 Bacteria 6651
243 Ga0373937_0013678 3300036401 Bacteria 7150
244 Ga0373925_0005104 3300037068 Bacteria 9832
245 Ga0373925_0010935 3300037068 Bacteria 6588
246 Ga0373925_0071558 3300037068 Bacteria 2623
247 Ga0373925_0164625 3300037068 Bacteria 1748
248 Ga0395899_0008592 3300037312 Bacteria 7864
249 Ga0395901_0053842 3300038443 Bacteria 4181
250 Ga0400490_33905 3300038726 Bacteria 13565
251 Ga0400489_89971 3300039093 Bacteria 2974
252 Ga0436361_0315601 3300039447 Bacteria 2810
253 Ga0439460_0008790 3300042461 Bacteria 2554
254 Ga0451577_0018316 3300042876 Bacteria 6453
255 Ga0451577_0062168 3300042876 Bacteria 3330
256 Ga0451577_0082919 3300042876 Bacteria 2860
257 Ga0466972_0006139 3300044658 Bacteria 6037
258 Ga0453684_0000031 3300044712 Bacteria 752632
259 Ga0453684_0001451 3300044712 Bacteria 67383
260 Ga0466968_0011787 3300044735 Bacteria 3410
261 Ga0466957_0076681 3300044842 Bacteria 2076
262 Ga0466960_0009611 3300044901 Bacteria 3992
263 Ga0451576_0000982 3300045051 Bacteria 52844
264 Ga0451576_0030217 3300045051 Bacteria 5793
265 Ga0451576_0035468 3300045051 Bacteria 5291
266 Ga0451576_0119659 3300045051 Bacteria 2741
267 Ga0495629_0043839 3300046459 Bacteria 3140
268 Ga0495629_0049882 3300046459 Bacteria 2933
269 Ga0495653_0076967 3300046463 Bacteria 2479
270 Ga0495580_0009187 3300046472 Bacteria 7791
271 Ga0495582_0009897 3300046473 Bacteria 5246
272 Ga0495582_0017482 3300046473 Bacteria 3923
273 Ga0495639_0022377 3300046475 Bacteria 2772
274 Ga0495662_0059855 3300046476 Bacteria 1839
275 Ga0495585_0028930 3300046492 Bacteria 3158
276 Ga0495594_0054488 3300046499 Bacteria 2204
277 Ga0495630_0071987 3300046517 Bacteria 2602
278 Ga0495665_0004528 3300046531 Bacteria 7500
279 Ga0495665_0007324 3300046531 Bacteria 5962
280 Ga0495635_0003923 3300046663 Bacteria 10340
281 Ga0495635_0040505 3300046663 Bacteria 3219
282 Ga0495647_0003013 3300046681 Bacteria 5360
283 Ga0495647_0025662 3300046681 Bacteria 2154
284 Ga0495658_0004232 3300046683 Bacteria 7061
285 Ga0495658_0055450 3300046683 Bacteria 2258
286 Ga0495613_0050300 3300046689 Bacteria 3073
287 Ga0495581_0005527 3300047315 Bacteria 7320
288 Ga0495680_0078030 3300047322 Bacteria 2507
289 Ga0495684_0005197 3300047471 Bacteria 10143
290 Ga0495684_0099024 3300047471 Bacteria 2204
291 Ga0495614_0080114 3300048089 Bacteria 1414
292 Ga0496102_0002226 3300048905 Bacteria 16629
293 Ga0496106_0000517 3300048909 Bacteria 27412
294 Ga0496107_0001947 3300048910 Bacteria 13109
295 Ga0496108_0028940 3300048911 Bacteria 4584
296 Ga0496109_0044332 3300048912 Bacteria 4035
297 Ga0496109_0185656 3300048912 Bacteria 1954
298 Ga0496110_0001507 3300048913 Bacteria 16908
299 Ga0501031_0014459 3300049568 Bacteria 5129
300 Ga0501033_0040959 3300049570 Bacteria 3457
301 Ga0501036_0091741 3300049572 Bacteria 2566
302 Ga0501037_0070594 3300049573 Bacteria 2541
303 Ga0501038_0024143 3300049574 Bacteria 5427
304 Ga0501038_0135927 3300049574 Bacteria 2014
305 Ga0501039_0066083 3300049575 Bacteria 2807
306 Ga0501040_0006948 3300049576 Bacteria 7330
307 Ga0501040_0033021 3300049576 Bacteria 3504
308 Ga0501041_0018492 3300049577 Bacteria 4152
309 Ga0501041_0019969 3300049577 Bacteria 4003
310 Ga0501041_0027174 3300049577 Bacteria 3447
311 Ga0501041_0128731 3300049577 Bacteria 1577
312 Ga0501042_0039820 3300049578 Bacteria 3341
313 Ga0501042_0076340 3300049578 Bacteria 2399
314 Ga0501046_0007847 3300049580 Bacteria 9364
315 Ga0501047_0256873 3300049581 Bacteria 1595
316 Ga0501071_0007389 3300049587 Bacteria 7209
317 Ga0501071_0021430 3300049587 Bacteria 4500
318 Ga0501075_0007037 3300049591 Bacteria 7772
319 Ga0501076_0000158 3300049592 Bacteria 39218
320 Ga0501076_0141339 3300049592 Bacteria 1956
321 Ga0501079_0076225 3300049741 Bacteria 2594
322 Ga0501079_0279074 3300049741 Bacteria 1306
323 Ga0501080_0044741 3300049742 Bacteria 4121
324 Ga0501081_0004338 3300049743 Bacteria 9097
325 Ga0501081_0113294 3300049743 Bacteria 1926
326 Ga0501035_0156225 3300049822 Bacteria 1977
327 Ga0501045_0014930 3300049824 Bacteria 5510
328 Ga0501045_0059645 3300049824 Bacteria 2796
329 nmdc:mga0k408_15786_c2 3300050493 Bacteria 3547
330 nmdc:mga05p37_49725_c1 3300050507 Bacteria 5157
331 nmdc:mga05p37_58062_c1 3300050507 Bacteria 4766
332 nmdc:mga09592_126231_c1 3300050508 Bacteria 2199
333 nmdc:mga09592_15623_c1 3300050508 Bacteria 6202
334 nmdc:mga06r32_7158_c1 3300050510 Bacteria 10051
335 nmdc:mga08y16_222917_c1 3300050511 Bacteria 1951
336 nmdc:mga08y16_81139_c1 3300050511 Bacteria 3382
337 nmdc:mga0n895_21963_c1 3300050512 Bacteria 5978
338 nmdc:mga0n895_27300_c1 3300050512 Bacteria 5421
339 nmdc:mga0a205_16181_c1 3300050515 Bacteria 6984
340 Ga0495619_0023559 3300053085 Bacteria 3948
341 Ga0495619_0063265 3300053085 Bacteria 2465
342 Ga0495619_0105545 3300053085 Bacteria 1921
343 Ga0500643_008912 3300053087 Bacteria 3888
344 Ga0501084_0022494 3300054114 Bacteria 5261
345 Ga0501084_0059306 3300054114 Bacteria 3203
346 Ga0501084_0137471 3300054114 Bacteria 2057
347 Ga0530510_0000070 3300061734 Bacteria 51724
348 2523384327 2523231044 Bacteria 6434991
349 2526211105 2526164512 Bacteria 4025691
350 2919414338 2919414237 Bacteria 5429133
351 3006829098 3006826541 Bacteria 4678913
352 8057736323 8057733483 Bacteria 6578323
353 Ga0265331_10057200
354 JGI24744J21845_10010375
355 Ga0055538_1000275
356 Ga0055541_1001199
357 Ga0065707_10008304
358 Ga0070676_10002754
359 Ga0070683_100003262
360 Ga0070683_100031613
361 Ga0070670_100009072
362 Ga0070670_100014135
363 Ga0068868_100022515
364 Ga0070660_100015964
365 Ga0070660_100095379
366 Ga0070689_100189014
367 Ga0070691_10047252
368 Ga0070687_100017683
369 Ga0070661_100000852
370 Ga0070661_100004623
371 Ga0070661_100031168
372 Ga0070661_100116239
373 Ga0070692_10062312
374 Ga0070668_100003216
375 Ga0070669_100004725
376 Ga0070669_100049837
377 Ga0070675_100044251
378 Ga0070675_100067921
379 Ga0070671_100000608
380 Ga0070674_100002886
381 Ga0070673_100015046
382 Ga0070673_100100072
383 Ga0070688_100093538
384 Ga0070659_100002542
385 Ga0070659_100002934
386 Ga0070659_100030865
387 Ga0070667_100017438
388 Ga0070710_10000103
389 Ga0070701_10002246
390 Ga0070701_10041834
391 Ga0070711_100132423
392 Ga0070700_100003021
393 Ga0070694_100101483
394 Ga0070708_100021089
395 Ga0070663_100019660
396 Ga0070663_100156819
397 Ga0070678_100121704
398 Ga0070662_100002973
399 Ga0070662_100003302
400 Ga0070681_10002141
401 Ga0068867_100014567
402 Ga0068867_100028984
403 Ga0070685_10016186
404 Ga0070706_100019737
405 Ga0070698_100006706
406 Ga0070698_100199145
407 Ga0070684_100006611
408 Ga0070684_100008666
409 Ga0070684_100028903
410 Ga0070684_100038284
411 Ga0068853_100027219
412 Ga0068853_100033334
413 Ga0068853_100044979
414 Ga0070672_100020070
415 Ga0070672_100089429
416 Ga0070665_100045604
417 Ga0070704_100015152
418 Ga0068855_100000806
419 Ga0068855_100107141
420 Ga0068855_100339213
421 Ga0070664_100001746
422 Ga0068857_100016219
423 Ga0068857_100030506
424 Ga0068857_100173715
425 Ga0068854_100039492
426 Ga0068854_100074937
427 Ga0068856_100000299
428 Ga0068852_100017181
429 Ga0068852_100026204
430 Ga0068859_100040392
431 Ga0068866_10117375
432 Ga0068861_100000503
433 Ga0068861_100056606
434 Ga0068861_100083339
435 Ga0068870_10010835
436 Ga0068870_10038928
437 Ga0068863_100010735
438 Ga0068858_100077678
439 Ga0068860_100007574
440 Ga0068862_100009563
441 Ga0081539_10006617
442 Ga0075366_10055275
443 Ga0075428_100015124
444 Ga0075428_100016001
445 Ga0075428_100038351
446 Ga0075428_100124568
447 Ga0075431_100054522
448 Ga0075431_100281863
449 Ga0075434_100049356
450 Ga0075429_100008386
451 Ga0075429_100112386
452 Ga0075429_100120906
453 Ga0068865_100002529
454 Ga0068865_100028571
455 Ga0097620_100040394
456 Ga0075435_100127386
457 Ga0105240_10196235
458 Ga0111539_10412662
459 Ga0105245_10014369
460 Ga0114129_10015735
461 Ga0114129_10023644
462 Ga0114129_10059507
463 Ga0105243_10003654
464 Ga0105242_10007829
465 Ga0105242_10048027
466 Ga0105248_10003247
467 Ga0105248_10007174
468 Ga0105248_10007535
469 Ga0105238_10086839
470 Ga0105238_10180982
471 Ga0105249_10000423
472 Ga0105249_10010028
473 Ga0105239_10012131
474 Ga0105239_10182649
475 Ga0157373_10008077
476 Ga0157371_10000210
477 Ga0157371_10023785
478 Ga0157369_10038850
479 Ga0157369_10072590
480 Ga0157374_10021399
481 Ga0163162_10067124
482 Ga0157372_10001225
483 Ga0157372_10016494
484 Ga0157375_10141334
485 Ga0163163_10025487
486 Ga0157380_10011621
487 Ga0157377_10005018
488 Ga0157377_10010094
489 Ga0157379_10007191
490 Ga0206353_11966912
491 Ga0213872_10023339
492 Ga0209784_100361
493 Ga0209566_100049
494 Ga0209258_103667
495 Ga0209676_1000743
496 Ga0207692_10000070
497 Ga0207645_10002669
498 Ga0207643_10002653
499 Ga0207707_10001826
500 Ga0207660_10032298
501 Ga0207662_10001420
502 Ga0207657_10000682
503 Ga0207657_10012759
504 Ga0207649_10006587
505 Ga0207652_10022712
506 Ga0207681_10012515
507 Ga0207650_10087246
508 Ga0207659_10014406
509 Ga0207659_10110689
510 Ga0207687_10019301
511 Ga0207644_10007148
512 Ga0207690_10005517
513 Ga0207706_10000114
514 Ga0207706_10000481
515 Ga0207706_10017711
516 Ga0207709_10047381
517 Ga0207704_10099858
518 Ga0207704_10108137
519 Ga0207691_10012974
520 Ga0207691_10013505
521 Ga0207691_10061011
522 Ga0207691_10080256
523 Ga0207691_10107253
524 Ga0207711_10023128
525 Ga0207711_10024807
526 Ga0207689_10024090
527 Ga0207661_10001366
528 Ga0207661_10090694
529 Ga0207661_10092590
530 Ga0207679_10006287
531 Ga0207679_10019137
532 Ga0207679_10064973
533 Ga0207667_10001902
534 Ga0207651_10059514
535 Ga0207651_10124528
536 Ga0207712_10002846
537 Ga0207712_10011957
538 Ga0207668_10137623
539 Ga0207640_10011340
540 Ga0207677_10195658
541 Ga0207639_10008071
542 Ga0207639_10066424
543 Ga0207639_10153513
544 Ga0207678_10015935
545 Ga0207678_10048984
546 Ga0207708_10001377
547 Ga0207702_10002438
548 Ga0207702_10218630
549 Ga0207648_10006282
550 Ga0207648_10030371
551 Ga0207676_10010898
552 Ga0207674_10002583
553 Ga0207674_10002993
554 Ga0207674_10057259
555 Ga0207675_100000338
556 Ga0207675_100002328
557 Ga0207683_10114416
558 Ga0207698_10011292
559 Ga0207698_10020846
560 Ga0209971_1005706
561 Ga0209974_10016895
562 Ga0268266_10086814
563 Ga0268265_10202798
564 Ga0268264_10029955
565 Ga0265338_10060857
566 Ga0316176_1122362
567 Ga0314311_1086617
568 Ga0265330_10001521
569 Ga0265332_10001451
570 Ga0265325_10031553
571 Ga0265329_10003403
572 Ga0265339_10045585
573 Ga0265331_10007245
574 Ga0265327_10011878
575 Ga0265316_10044448
576 Ga0307408_100105505
577 Ga0265313_10003669
578 Ga0265314_10016267
579 Ga0265342_10044496
580 Ga0307406_10008808
581 Ga0373940_0000788
582 Ga0373944_0011139
583 Ga0373936_0033146
584 Ga0373939_0001015
585 Ga0373943_0000872
586 Ga0373943_0044053
587 Ga0373946_0039035
588 Ga0373931_0000525
589 Ga0373935_0103310
590 Ga0373927_0002164
591 Ga0373927_0009827
592 Ga0373933_0064955
593 Ga0373947_0000605
594 Ga0373947_0006767
595 Ga0373937_0013678
596 Ga0373925_0005104
597 Ga0373925_0010935
598 Ga0373925_0071558
599 Ga0373925_0164625
600 Ga0395899_0008592
601 Ga0395901_0053842
602 Ga0400490_33905
603 Ga0400489_89971
604 Ga0436361_0315601
605 Ga0439460_0008790
606 Ga0451577_0018316
607 Ga0451577_0062168
608 Ga0451577_0082919
609 Ga0466972_0006139
610 Ga0453684_0000031
611 Ga0453684_0001451
612 Ga0466968_0011787
613 Ga0466957_0076681
614 Ga0466960_0009611
615 Ga0451576_0000982
616 Ga0451576_0030217
617 Ga0451576_0035468
618 Ga0451576_0119659
619 Ga0495629_0043839
620 Ga0495629_0049882
621 Ga0495653_0076967
622 Ga0495580_0009187
623 Ga0495582_0009897
624 Ga0495582_0017482
625 Ga0495639_0022377
626 Ga0495662_0059855
627 Ga0495585_0028930
628 Ga0495594_0054488
629 Ga0495630_0071987
630 Ga0495665_0004528
631 Ga0495665_0007324
632 Ga0495635_0003923
633 Ga0495635_0040505
634 Ga0495647_0003013
635 Ga0495647_0025662
636 Ga0495658_0004232
637 Ga0495658_0055450
638 Ga0495613_0050300
639 Ga0495581_0005527
640 Ga0495680_0078030
641 Ga0495684_0005197
642 Ga0495684_0099024
643 Ga0495614_0080114
644 Ga0496102_0002226
645 Ga0496106_0000517
646 Ga0496107_0001947
647 Ga0496108_0028940
648 Ga0496109_0044332
649 Ga0496109_0185656
650 Ga0496110_0001507
651 Ga0501031_0014459
652 Ga0501033_0040959
653 Ga0501036_0091741
654 Ga0501037_0070594
655 Ga0501038_0024143
656 Ga0501038_0135927
657 Ga0501039_0066083
658 Ga0501040_0006948
659 Ga0501040_0033021
660 Ga0501041_0018492
661 Ga0501041_0019969
662 Ga0501041_0027174
663 Ga0501041_0128731
664 Ga0501042_0039820
665 Ga0501042_0076340
666 Ga0501046_0007847
667 Ga0501047_0256873
668 Ga0501071_0007389
669 Ga0501071_0021430
670 Ga0501075_0007037
671 Ga0501076_0000158
672 Ga0501076_0141339
673 Ga0501079_0076225
674 Ga0501079_0279074
675 Ga0501080_0044741
676 Ga0501081_0004338
677 Ga0501081_0113294
678 Ga0501035_0156225
679 Ga0501045_0014930
680 Ga0501045_0059645
681 nmdc:mga0k408_15786_c2
682 nmdc:mga05p37_49725_c1
683 nmdc:mga05p37_58062_c1
684 nmdc:mga09592_126231_c1
685 nmdc:mga09592_15623_c1
686 nmdc:mga06r32_7158_c1
687 nmdc:mga08y16_222917_c1
688 nmdc:mga08y16_81139_c1
689 nmdc:mga0n895_21963_c1
690 nmdc:mga0n895_27300_c1
691 nmdc:mga0a205_16181_c1
692 Ga0495619_0023559
693 Ga0495619_0063265
694 Ga0495619_0105545
695 Ga0500643_008912
696 Ga0501084_0022494
697 Ga0501084_0059306
698 Ga0501084_0137471
699 Ga0530510_0000070
700 2523384327
701 2526211105
702 2919414338
703 3006829098
704 8057736323

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14535

AMP-binding_C_2

AMP-binding enzyme C-terminal domain

363

465

0.93

PF00501

AMP-binding

AMP-binding enzyme

73

316

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r1m-assembly1.cif.gz_A crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution 0.9551 8 422
4r1m-assembly2.cif.gz_C crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution 0.9483 4 421
2y4o-assembly1.cif.gz_B crystal structure of paak2 in complex with phenylacetyl adenylate 0.9462 12 421
4r1l-assembly1.cif.gz_A crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution 0.9461 8 422
4r1m-assembly1.cif.gz_A crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution 0.9375 8 422
ID Description Score Start End Superfamily
2y4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9788 10 323 3.40.50.12780
3qovC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9581 10 323 3.40.50.12780
af_P76085_328_435_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.949 322 422 3.30.300.30
2y4nA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.943 10 323 3.40.50.12780
3qovC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.917 10 323 3.40.50.12780
ID Description Score Start End GO Terms
AF-A0A7X6EMY5-F1-model_v4 deleted 0.994 166 255
AF-A0A4Q5U6L0-F1-model_v4 deleted 0.9835 14 220
AF-A0A356NV54-F1-model_v4 Phenylacetate--CoA ligase 0.9833 10 289 GO:0010124
GO:0047475
AF-A0A357NBS0-F1-model_v4 Phenylacetate--CoA ligase 0.9811 111 302 GO:0016874
AF-A0A2N6UBQ5-F1-model_v4 deleted 0.9794 112 276

Map