F419055

General Info

Members Datasets Scaffolds Average Seq Length
352 210 350 249

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10400152|Ga0207703_104001521
Length 304
Sequence MASPSEGGRREARQRGRLQPEQRAAAEQGLQVSERGRVLPDLAGAKLYAFESERLHRLDVSVGNFEAAHLANMAGKLLLQVRAANVFADKALGKAGDATANQFLVHALREARPNDGLLSEEQKDDGERLKQKRVWIVDPVDGTREYGEGRTDWAVHVALAIDGVAQIGAVALPGLDLVLRTDKVAPLPQAGKPLRMVVSRTRPAKEAVEVAQKLGADLVPMGSSGAKAMAIVRGEADIYLHSGGQYEWDSAAPVAVAAAHGLHCSRIDGSPLIYNNQDVYMPDLLIARKDHAQTVLGLLREMKA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
3 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
102 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
108 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
169 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
170 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
171 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
183 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
189 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
190 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
191 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
192 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
193 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
194 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
197 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
205 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
206 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
207 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
208 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
209 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
210 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.02
Nodule 0.57
Rhizoplane 4.26
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_878255 2162886007 Bacteria 33750
2 JGI24752J21851_1001621 3300001976 Bacteria 3024
3 JGI24739J22299_10005597 3300001989 Bacteria 4763
4 JGI24751J29686_10000131 3300002459 Bacteria 37771
5 rootL2_10031824 3300003322 Bacteria 2376
6 Ga0055530_10010861 3300003791 Bacteria 3319
7 Ga0065704_10002974 3300005289 Bacteria 6660
8 Ga0065704_10070144 3300005289 Bacteria 333223
9 Ga0065707_10082203 3300005295 Bacteria 19236
10 Ga0065707_10084119 3300005295 Bacteria 7673
11 Ga0065707_10124879 3300005295 Bacteria 2003
12 Ga0070658_10000244 3300005327 Bacteria 48413
13 Ga0070690_100024533 3300005330 Bacteria 3708
14 Ga0070670_100198119 3300005331 Bacteria 1745
15 Ga0070666_10118585 3300005335 Bacteria 1834
16 Ga0070668_100000120 3300005347 Bacteria 48270
17 Ga0070668_100190550 3300005347 Bacteria 1679
18 Ga0070669_100001269 3300005353 Bacteria 18316
19 Ga0070671_100000074 3300005355 Bacteria 64319
20 Ga0070667_100000089 3300005367 Bacteria 113661
21 Ga0070667_100002913 3300005367 Bacteria 14703
22 Ga0070662_100069458 3300005457 Bacteria 2592
23 Ga0068853_100003587 3300005539 Bacteria 11881
24 Ga0068853_100144376 3300005539 Bacteria 2138
25 Ga0070672_100224527 3300005543 Bacteria 1576
26 Ga0070665_100000198 3300005548 Bacteria 105999
27 Ga0070665_100127125 3300005548 Bacteria 2551
28 Ga0068855_100034901 3300005563 Bacteria 5994
29 Ga0068855_100120646 3300005563 Bacteria 3001
30 Ga0068857_100005934 3300005577 Bacteria 10429
31 Ga0068854_100000680 3300005578 Bacteria 20260
32 Ga0068854_100025768 3300005578 Bacteria 4035
33 Ga0068856_100001412 3300005614 Bacteria 25192
34 Ga0068852_100000388 3300005616 Bacteria 29451
35 Ga0068852_100038704 3300005616 Bacteria 4009
36 Ga0068852_100151204 3300005616 Bacteria 2159
37 Ga0068852_100709832 3300005616 Bacteria 1016
38 Ga0068859_100000378 3300005617 Bacteria 44379
39 Ga0068859_100047131 3300005617 Bacteria 4330
40 Ga0068859_100051368 3300005617 Bacteria 4144
41 Ga0068859_100274433 3300005617 Bacteria 1778
42 Ga0068864_100000241 3300005618 Bacteria 48827
43 Ga0068864_100016381 3300005618 Bacteria 6170
44 Ga0068864_100121482 3300005618 Bacteria 2336
45 Ga0068861_100000060 3300005719 Bacteria 51677
46 Ga0068861_100039862 3300005719 Bacteria 3509
47 Ga0068863_100000097 3300005841 Bacteria 95374
48 Ga0068863_100002215 3300005841 Bacteria 19306
49 Ga0068863_100003849 3300005841 Bacteria 14841
50 Ga0068863_100038945 3300005841 Bacteria 4524
51 Ga0068863_100103877 3300005841 Bacteria 2703
52 Ga0068863_100184090 3300005841 Bacteria 2006
53 Ga0068858_100000092 3300005842 Bacteria 93550
54 Ga0068858_100110504 3300005842 Bacteria 2567
55 Ga0068860_100000148 3300005843 Bacteria 113661
56 Ga0068860_100033386 3300005843 Bacteria 4938
57 Ga0068860_100033692 3300005843 Bacteria 4914
58 Ga0068860_100038848 3300005843 Bacteria 4554
59 Ga0068860_100330555 3300005843 Bacteria 1497
60 Ga0068862_100000287 3300005844 Bacteria 55746
61 Ga0068862_100003545 3300005844 Bacteria 13378
62 Ga0068862_100270820 3300005844 Bacteria 1553
63 Ga0068862_100406179 3300005844 Bacteria 1275
64 Ga0068862_100601160 3300005844 Bacteria 1056
65 Ga0081539_10131445 3300005985 Bacteria 1229
66 Ga0070717_10175358 3300006028 Bacteria 1866
67 Ga0075368_10005990 3300006042 Bacteria 4217
68 Ga0075364_10041418 3300006051 Bacteria 2991
69 Ga0075364_10161937 3300006051 Bacteria 1510
70 Ga0075362_10000134 3300006177 Bacteria 20244
71 Ga0075362_10013827 3300006177 Bacteria 3241
72 Ga0075367_10086346 3300006178 Bacteria 1904
73 Ga0075369_10000824 3300006186 Bacteria 10210
74 Ga0075369_10073232 3300006186 Bacteria 1510
75 Ga0075366_10024418 3300006195 Bacteria 3526
76 Ga0075430_100098830 3300006846 Bacteria 2438
77 Ga0068865_100597415 3300006881 Bacteria 932
78 Ga0097620_100000378 3300006931 Bacteria 44379
79 Ga0097620_100047129 3300006931 Bacteria 4330
80 Ga0097620_100051367 3300006931 Bacteria 4144
81 Ga0097620_100274440 3300006931 Bacteria 1778
82 Ga0079104_1013006 3300006946 Bacteria 2587
83 Ga0105251_10024704 3300009011 Bacteria 3083
84 Ga0105250_10000144 3300009092 Bacteria 62436
85 Ga0105240_10014886 3300009093 Bacteria 10598
86 Ga0111539_10248343 3300009094 Bacteria 2072
87 Ga0105243_10366896 3300009148 Bacteria 1327
88 Ga0105241_10169510 3300009174 Bacteria 1802
89 Ga0105248_10134619 3300009177 Bacteria 2788
90 Ga0105248_10357153 3300009177 Bacteria 1645
91 Ga0105248_10548774 3300009177 Bacteria 1304
92 Ga0105238_10120426 3300009551 Bacteria 2604
93 Ga0105249_10000065 3300009553 Bacteria 151159
94 Ga0105249_10454798 3300009553 Bacteria 1319
95 Ga0105249_10961351 3300009553 Bacteria 922
96 Ga0105239_10751190 3300010375 Bacteria 1116
97 Ga0157378_10068976 3300013297 Bacteria 3171
98 Ga0163162_10096638 3300013306 Bacteria 3042
99 Ga0157380_10001288 3300014326 Bacteria 16319
100 Ga0157379_10000239 3300014968 Bacteria 43063
101 Ga0157379_10023557 3300014968 Bacteria 5464
102 Ga0157379_10052721 3300014968 Bacteria 3633
103 Ga0163161_10017775 3300017792 Bacteria 4983
104 Ga0163161_10343114 3300017792 Bacteria 1185
105 Ga0209676_1064737 3300025292 Bacteria 893
106 Ga0209050_1000370 3300025298 Bacteria 85916
107 Ga0209050_1000504 3300025298 Bacteria 66436
108 Ga0209050_1002809 3300025298 Bacteria 13908
109 Ga0207697_10032667 3300025315 Bacteria 2130
110 Ga0207696_1000945 3300025711 Bacteria 17759
111 Ga0207710_10044323 3300025900 Bacteria 1980
112 Ga0207680_10189721 3300025903 Bacteria 1394
113 Ga0207705_10000224 3300025909 Bacteria 56164
114 Ga0207681_10000137 3300025923 Bacteria 60426
115 Ga0207681_10034038 3300025923 Bacteria 3347
116 Ga0207681_10070655 3300025923 Bacteria 2432
117 Ga0207694_10012528 3300025924 Bacteria 6392
118 Ga0207694_10372096 3300025924 Bacteria 1185
119 Ga0207644_10000053 3300025931 Bacteria 90831
120 Ga0207644_10049688 3300025931 Bacteria 3004
121 Ga0207644_10334950 3300025931 Bacteria 1226
122 Ga0207706_10002232 3300025933 Bacteria 18917
123 Ga0207704_10507610 3300025938 Bacteria 973
124 Ga0207711_10001008 3300025941 Bacteria 27013
125 Ga0207711_10001300 3300025941 Bacteria 23651
126 Ga0207711_10054662 3300025941 Bacteria 3427
127 Ga0207711_10224686 3300025941 Bacteria 1718
128 Ga0207667_10007883 3300025949 Bacteria 12714
129 Ga0207667_10070142 3300025949 Bacteria 3648
130 Ga0207667_10358359 3300025949 Bacteria 1487
131 Ga0207712_10000002 3300025961 Bacteria 706628
132 Ga0207640_10000640 3300025981 Bacteria 20535
133 Ga0207640_10108550 3300025981 Bacteria 1962
134 Ga0207658_10000069 3300025986 Bacteria 113687
135 Ga0207658_10001231 3300025986 Bacteria 20256
136 Ga0207658_10218372 3300025986 Bacteria 1602
137 Ga0207703_10000737 3300026035 Bacteria 32201
138 Ga0207703_10013057 3300026035 Bacteria 6472
139 Ga0207703_10400152 3300026035 Bacteria 1274
140 Ga0207702_10001835 3300026078 Bacteria 20908
141 Ga0207641_10000128 3300026088 Bacteria 111308
142 Ga0207641_10001897 3300026088 Bacteria 20070
143 Ga0207641_10008192 3300026088 Bacteria 8642
144 Ga0207641_10023084 3300026088 Bacteria 5125
145 Ga0207641_10027462 3300026088 Bacteria 4700
146 Ga0207676_10000235 3300026095 Bacteria 48499
147 Ga0207676_10020565 3300026095 Bacteria 4831
148 Ga0207676_10067501 3300026095 Bacteria 2857
149 Ga0207674_10010429 3300026116 Bacteria 10526
150 Ga0207674_10016362 3300026116 Bacteria 8122
151 Ga0207675_100000062 3300026118 Bacteria 80665
152 Ga0207675_100008808 3300026118 Bacteria 9471
153 Ga0207683_10119335 3300026121 Bacteria 2366
154 Ga0207698_10000005 3300026142 Bacteria 295687
155 Ga0207698_10009777 3300026142 Bacteria 6126
156 Ga0207698_10128671 3300026142 Bacteria 2159
157 Ga0209281_1009258 3300027111 Bacteria 2323
158 Ga0209813_10000109 3300027866 Bacteria 30480
159 Ga0207428_10013619 3300027907 Bacteria 7094
160 Ga0268266_10183553 3300028379 Bacteria 1906
161 Ga0268265_10000141 3300028380 Bacteria 91426
162 Ga0268264_10000217 3300028381 Bacteria 113674
163 Ga0268264_10000303 3300028381 Bacteria 79730
164 Ga0268264_10000788 3300028381 Bacteria 34588
165 Ga0268264_10046788 3300028381 Bacteria 3595
166 Ga0268264_10290620 3300028381 Bacteria 1535
167 Ga0307515_10128031 3300028794 Bacteria 2820
168 Ga0265331_10058271 3300031250 Bacteria 1829
169 Ga0307513_10081799 3300031456 Bacteria 3327
170 Ga0307513_10109366 3300031456 Bacteria 2762
171 Ga0307513_10170220 3300031456 Bacteria 2057
172 Ga0307513_10360430 3300031456 Bacteria 1199
173 Ga0307513_10559251 3300031456 Bacteria 856
174 Ga0307516_10249952 3300031730 Bacteria 1468
175 Ga0307405_10051078 3300031731 Bacteria 2564
176 Ga0307406_10137341 3300031901 Bacteria 1725
177 Ga0307406_10327519 3300031901 Bacteria 1188
178 Ga0307412_10338436 3300031911 Bacteria 1203
179 Ga0307414_10224951 3300032004 Bacteria 1543
180 Ga0307510_10001966 3300033180 Bacteria 23139
181 Ga0373951_0029352 3300035091 Bacteria 1292
182 Ga0373923_0217585 3300035111 Bacteria 887
183 Ga0373960_0034832 3300035121 Bacteria 1426
184 Ga0373962_0075244 3300035242 Bacteria 1016
185 Ga0373931_0278401 3300035691 Bacteria 1026
186 Ga0451845_0944516 3300041501 Bacteria 1271
187 Ga0451851_0484716 3300041507 Bacteria 2042
188 Ga0495629_0043185 3300046459 Bacteria 3166
189 Ga0495629_0247707 3300046459 Bacteria 1226
190 Ga0495638_0005402 3300046460 Bacteria 9516
191 Ga0495638_0007997 3300046460 Bacteria 7539
192 Ga0495638_0217611 3300046460 Bacteria 1069
193 Ga0495650_0000163 3300046471 Bacteria 148569
194 Ga0495650_0001568 3300046471 Bacteria 21502
195 Ga0495584_0193063 3300046491 Bacteria 1035
196 Ga0495607_0038742 3300046501 Bacteria 2853
197 Ga0495583_0000333 3300046506 Bacteria 74698
198 Ga0495583_0033040 3300046506 Bacteria 2491
199 Ga0495583_0061405 3300046506 Bacteria 1677
200 Ga0495606_0095175 3300046507 Bacteria 1824
201 Ga0495606_0175824 3300046507 Bacteria 1238
202 Ga0495610_0000018 3300046512 Bacteria 355044
203 Ga0495610_0000689 3300046512 Bacteria 32617
204 Ga0495610_0014728 3300046512 Bacteria 4580
205 Ga0495616_0104947 3300046513 Bacteria 1320
206 Ga0495620_0005115 3300046515 Bacteria 7344
207 Ga0495631_0139262 3300046518 Bacteria 1042
208 Ga0495637_0140861 3300046520 Bacteria 915
209 Ga0495643_0000039 3300046522 Bacteria 235175
210 Ga0495643_0004473 3300046522 Bacteria 9766
211 Ga0495643_0018682 3300046522 Bacteria 4020
212 Ga0495644_0158255 3300046523 Bacteria 868
213 Ga0495663_0044325 3300046525 Bacteria 1361
214 Ga0495663_0114024 3300046525 Bacteria 900
215 Ga0495654_0002327 3300046530 Bacteria 12278
216 Ga0495654_0030372 3300046530 Bacteria 2750
217 Ga0495654_0061753 3300046530 Bacteria 1798
218 Ga0495587_0022258 3300046536 Bacteria 3903
219 Ga0495609_0002903 3300046538 Bacteria 10218
220 Ga0495597_0001810 3300046542 Bacteria 14647
221 Ga0495622_0030281 3300046557 Bacteria 2529
222 Ga0495668_0003835 3300046616 Bacteria 11002
223 Ga0495668_0024936 3300046616 Bacteria 3399
224 Ga0495668_0048784 3300046616 Bacteria 2348
225 Ga0495668_0071937 3300046616 Bacteria 1900
226 Ga0495668_0167972 3300046616 Bacteria 1202
227 Ga0495668_0274839 3300046616 Bacteria 923
228 Ga0495625_0003760 3300046660 Bacteria 14741
229 Ga0495625_0005577 3300046660 Bacteria 11413
230 Ga0495625_0021291 3300046660 Bacteria 4995
231 Ga0495625_0030200 3300046660 Bacteria 4046
232 Ga0495625_0044711 3300046660 Bacteria 3204
233 Ga0495589_0265824 3300046794 Bacteria 799
234 Ga0495600_0000847 3300046809 Bacteria 16322
235 Ga0495680_0112104 3300047322 Bacteria 2021
236 Ga0495687_019781 3300047443 Bacteria 3294
237 Ga0495677_0029477 3300047445 Bacteria 1995
238 Ga0495681_0000020 3300047470 Bacteria 170007
239 Ga0495686_0000671 3300047472 Bacteria 46344
240 Ga0495686_0035786 3300047472 Bacteria 3189
241 Ga0495593_0053020 3300047673 Bacteria 2141
242 Ga0495615_0000036 3300048090 Bacteria 44577
243 Ga0495626_0017339 3300048091 Bacteria 3638
244 Ga0496100_0017273 3300048903 Bacteria 4256
245 Ga0496101_0017210 3300048904 Bacteria 4898
246 Ga0496101_0499888 3300048904 Bacteria 961
247 Ga0496102_0064671 3300048905 Bacteria 3351
248 Ga0496103_0044624 3300048906 Bacteria 2732
249 Ga0496104_0008539 3300048907 Bacteria 9104
250 Ga0496105_0059138 3300048908 Bacteria 3162
251 Ga0496106_0004323 3300048909 Bacteria 10551
252 Ga0496109_0218968 3300048912 Bacteria 1790
253 Ga0496109_0275518 3300048912 Bacteria 1585
254 Ga0496110_0555278 3300048913 Bacteria 1043
255 Ga0496111_0026650 3300048914 Bacteria 4082
256 Ga0496112_0271111 3300048915 Bacteria 1645
257 Ga0496113_0019278 3300048916 Bacteria 4768
258 Ga0496114_0276004 3300048917 Bacteria 1481
259 Ga0496116_0000028 3300048919 Bacteria 424086
260 Ga0496118_0012653 3300048921 Bacteria 8073
261 Ga0496119_0030306 3300048922 Bacteria 3651
262 Ga0496121_0000042 3300048924 Bacteria 342304
263 Ga0496122_0000927 3300048925 Bacteria 53530
264 Ga0496122_0003325 3300048925 Bacteria 21235
265 Ga0496122_0016966 3300048925 Bacteria 6841
266 Ga0496123_0000278 3300048926 Bacteria 100746
267 Ga0496123_0001326 3300048926 Bacteria 34955
268 Ga0496123_0006412 3300048926 Bacteria 11406
269 Ga0496124_0001859 3300048927 Bacteria 29158
270 Ga0496124_0015904 3300048927 Bacteria 7184
271 Ga0496124_0022745 3300048927 Bacteria 5739
272 Ga0496124_0043592 3300048927 Bacteria 3856
273 Ga0496124_0083599 3300048927 Bacteria 2618
274 Ga0496125_0030974 3300048928 Bacteria 4776
275 Ga0496125_0140536 3300048928 Bacteria 1680
276 Ga0496126_0000079 3300048929 Bacteria 222463
277 Ga0496126_0009489 3300048929 Bacteria 10323
278 Ga0496126_0018647 3300048929 Bacteria 6869
279 Ga0496126_0465943 3300048929 Bacteria 1015
280 Ga0501300_003516 3300049523 Bacteria 2338
281 Ga0501034_0032699 3300049571 Bacteria 5283
282 Ga0501034_0058985 3300049571 Bacteria 3855
283 Ga0501043_0230117 3300049579 Bacteria 1432
284 Ga0501047_0061054 3300049581 Bacteria 3637
285 Ga0501047_0538272 3300049581 Bacteria 993
286 Ga0501223_018316 3300049663 Bacteria 1379
287 Ga0501249_015770 3300049679 Bacteria 1618
288 Ga0501257_000008 3300049686 Bacteria 54624
289 Ga0501263_000751 3300049760 Bacteria 2700
290 Ga0501280_015268 3300049776 Bacteria 1099
291 nmdc:mga03683_685_c1 3300050489 Bacteria 9723
292 nmdc:mga03683_6_c1 3300050489 Bacteria 141493
293 nmdc:mga03n38_217528_c1 3300050490 Bacteria 996
294 nmdc:mga03n38_74882_c1 3300050490 Bacteria 1576
295 nmdc:mga00v17_114701_c1 3300050491 Bacteria 1711
296 nmdc:mga00v17_34012_c1 3300050491 Bacteria 3024
297 nmdc:mga00v17_54731_c1 3300050491 Bacteria 2435
298 nmdc:mga0k408_161812_c1 3300050493 Bacteria 1334
299 nmdc:mga0k408_6_c1 3300050493 Bacteria 200443
300 nmdc:mga06z11_353_c1 3300050494 Bacteria 17337
301 nmdc:mga04h51_1343_c1 3300050495 Bacteria 5661
302 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
303 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
304 nmdc:mga0qj67_237659_c1 3300050509 Bacteria 1478
305 nmdc:mga0sz30_172_c1 3300050516 Bacteria 24162
306 nmdc:mga0sz30_580_c1 3300050516 Bacteria 13772
307 Ga0500635_0000203 3300053080 Bacteria 29410
308 Ga0500643_004592 3300053087 Bacteria 6175
309 Ga0500647_0097759 3300053091 Bacteria 1403
310 Ga0500583_0068224 3300053092 Bacteria 1695
311 Ga0500583_0202891 3300053092 Bacteria 985
312 Ga0500651_0338059 3300053093 Bacteria 856
313 Ga0500641_0134380 3300053096 Bacteria 1068
314 Ga0500556_0016976 3300053104 Bacteria 2274
315 Ga0500556_0055680 3300053104 Bacteria 1443
316 Ga0500572_097003 3300053111 Bacteria 939
317 Ga0500592_001152 3300053116 Bacteria 4305
318 Ga0500592_002809 3300053116 Bacteria 2800
319 Ga0500592_027598 3300053116 Bacteria 916
320 Ga0500595_000774 3300053119 Bacteria 18727
321 Ga0500597_019655 3300053120 Bacteria 2639
322 Ga0500607_000048 3300053121 Bacteria 82363
323 Ga0500607_023828 3300053121 Bacteria 3425
324 Ga0500607_100349 3300053121 Bacteria 1438
325 Ga0500608_003951 3300053122 Bacteria 5661
326 Ga0500608_012192 3300053122 Bacteria 3759
327 Ga0500608_025633 3300053122 Bacteria 2761
328 Ga0500618_029333 3300053125 Bacteria 1299
329 Ga0500642_0007338 3300053130 Bacteria 3699
330 Ga0500559_0010566 3300053136 Bacteria 3960
331 Ga0500559_0047447 3300053136 Bacteria 1886
332 Ga0500564_002961 3300053138 Bacteria 6448
333 Ga0500564_110916 3300053138 Bacteria 1204
334 Ga0500568_0001201 3300053139 Bacteria 17287
335 Ga0500590_004827 3300053148 Bacteria 6429
336 Ga0500619_027690 3300053154 Bacteria 1699
337 Ga0500619_043915 3300053154 Bacteria 1423
338 Ga0500620_031471 3300053155 Bacteria 1682
339 Ga0500622_0015016 3300053156 Bacteria 4152
340 Ga0500624_000003 3300053157 Bacteria 253364
341 Ga0500624_000061 3300053157 Bacteria 66422
342 Ga0500624_008557 3300053157 Bacteria 1435
343 Ga0500627_0000624 3300053158 Bacteria 9436
344 Ga0500638_071915 3300053162 Bacteria 1652
345 Ga0500636_0000812 3300053177 Bacteria 16865
346 Ga0500637_0000876 3300053178 Bacteria 12099
347 Ga0500567_000199 3300053723 Bacteria 17563
348 Ga0500625_000030 3300053729 Bacteria 51482
349 Ga0500625_126154 3300053729 Bacteria 1017
350 Ga0500645_027434 3300053730 Bacteria 1727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0465943 Ga0496126_0465943_28_774 241
2 3300053154 Ga0500619_043915 Ga0500619_043915_509_1327 241
3 3300005543 Ga0070672_100224527 Ga0070672_1002245272 242
4 3300009094 Ga0111539_10248343 Ga0111539_102483432 242
5 3300013297 Ga0157378_10068976 Ga0157378_100689762 242
6 3300053157 Ga0500624_000061 Ga0500624_000061_34294_35058 242
7 3300053177 Ga0500636_0000812 Ga0500636_0000812_2056_2820 242
8 3300001989 JGI24739J22299_10005597 JGI24739J22299_100055974 243
9 3300003791 Ga0055530_10010861 Ga0055530_100108613 243
10 3300005295 Ga0065707_10082203 Ga0065707_100822032 243
11 3300005367 Ga0070667_100000089 Ga0070667_100000089104 243
12 3300005457 Ga0070662_100069458 Ga0070662_1000694582 243
13 3300005539 Ga0068853_100003587 Ga0068853_1000035876 243
14 3300005578 Ga0068854_100025768 Ga0068854_1000257682 243
15 3300005616 Ga0068852_100151204 Ga0068852_1001512042 243
16 3300005617 Ga0068859_100051368 Ga0068859_1000513684 243
17 3300005841 Ga0068863_100002215 Ga0068863_10000221512 243
18 3300005841 Ga0068863_100003849 Ga0068863_10000384912 243
19 3300005843 Ga0068860_100000148 Ga0068860_10000014826 243
20 3300005843 Ga0068860_100033692 Ga0068860_1000336922 243
21 3300005844 Ga0068862_100000287 Ga0068862_10000028745 243
22 3300005844 Ga0068862_100601160 Ga0068862_1006011602 243
23 3300006028 Ga0070717_10175358 Ga0070717_101753582 243
24 3300006846 Ga0075430_100098830 Ga0075430_1000988302 243
25 3300006931 Ga0097620_100051367 Ga0097620_1000513674 243
26 3300009093 Ga0105240_10014886 Ga0105240_1001488610 243
27 3300009174 Ga0105241_10169510 Ga0105241_101695102 243
28 3300009551 Ga0105238_10120426 Ga0105238_101204262 243
29 3300009553 Ga0105249_10000065 Ga0105249_10000065122 243
30 3300014326 Ga0157380_10001288 Ga0157380_100012889 243
31 3300025298 Ga0209050_1000504 Ga0209050_100050436 243
32 3300025923 Ga0207681_10070655 Ga0207681_100706552 243
33 3300025924 Ga0207694_10372096 Ga0207694_103720962 243
34 3300025933 Ga0207706_10002232 Ga0207706_100022329 243
35 3300025941 Ga0207711_10054662 Ga0207711_100546623 243
36 3300025949 Ga0207667_10358359 Ga0207667_103583592 243
37 3300025961 Ga0207712_10000002 Ga0207712_10000002251 243
38 3300025981 Ga0207640_10108550 Ga0207640_101085502 243
39 3300025986 Ga0207658_10000069 Ga0207658_1000006925 243
40 3300026088 Ga0207641_10001897 Ga0207641_1000189712 243
41 3300026088 Ga0207641_10023084 Ga0207641_100230845 243
42 3300026116 Ga0207674_10016362 Ga0207674_100163623 243
43 3300028380 Ga0268265_10000141 Ga0268265_1000014158 243
44 3300028381 Ga0268264_10000217 Ga0268264_1000021725 243
45 3300028381 Ga0268264_10000788 Ga0268264_1000078825 243
46 3300031456 Ga0307513_10360430 Ga0307513_103604302 243
47 3300031456 Ga0307513_10559251 Ga0307513_105592511 243
48 3300031901 Ga0307406_10137341 Ga0307406_101373411 243
49 3300031911 Ga0307412_10338436 Ga0307412_103384362 243
50 3300035111 Ga0373923_0217585 Ga0373923_0217585_123_872 243
51 3300046525 Ga0495663_0044325 Ga0495663_0044325_163_903 243
52 3300046530 Ga0495654_0002327 Ga0495654_0002327_8819_9559 243
53 3300046616 Ga0495668_0003835 Ga0495668_0003835_5996_6736 243
54 3300046616 Ga0495668_0024936 Ga0495668_0024936_181_915 243
55 3300046616 Ga0495668_0071937 Ga0495668_0071937_644_1384 243
56 3300046794 Ga0495589_0265824 Ga0495589_0265824_22_762 243
57 3300048927 Ga0496124_0022745 Ga0496124_0022745_1787_2590 243
58 3300049571 Ga0501034_0058985 Ga0501034_0058985_484_1221 243
59 3300050509 nmdc:mga0qj67_237659_c1 nmdc:mga0qj67_237659_c1_413_1162 243
60 3300053091 Ga0500647_0097759 Ga0500647_0097759_174_908 243
61 3300053116 Ga0500592_001152 Ga0500592_001152_1735_2475 243
62 3300053116 Ga0500592_027598 Ga0500592_027598_114_848 243
63 3300053120 Ga0500597_019655 Ga0500597_019655_410_1144 243
64 3300053122 Ga0500608_012192 Ga0500608_012192_55_789 243
65 3300053122 Ga0500608_025633 Ga0500608_025633_1729_2463 243
66 3300053136 Ga0500559_0047447 Ga0500559_0047447_262_1005 243
67 3300053138 Ga0500564_002961 Ga0500564_002961_4906_5640 243
68 3300053139 Ga0500568_0001201 Ga0500568_0001201_13629_14372 243
69 3300053157 Ga0500624_000003 Ga0500624_000003_242946_243680 243
70 3300053158 Ga0500627_0000624 Ga0500627_0000624_3316_4056 243
71 3300053178 Ga0500637_0000876 Ga0500637_0000876_9664_10398 243
72 3300053723 Ga0500567_000199 Ga0500567_000199_16034_16768 243
73 3300053729 Ga0500625_000030 Ga0500625_000030_47690_48424 243
74 3300053730 Ga0500645_027434 Ga0500645_027434_501_1244 243
75 iso_pu_bacteria 2946787523 2946789148 243
76 3300006051 Ga0075364_10041418 Ga0075364_100414183 244
77 3300006177 Ga0075362_10000134 Ga0075362_1000013417 244
78 3300006186 Ga0075369_10000824 Ga0075369_100008244 244
79 3300006195 Ga0075366_10024418 Ga0075366_100244182 244
80 3300006946 Ga0079104_1013006 Ga0079104_10130062 244
81 3300031456 Ga0307513_10170220 Ga0307513_101702202 244
82 3300035091 Ga0373951_0029352 Ga0373951_0029352_318_1055 244
83 3300035121 Ga0373960_0034832 Ga0373960_0034832_88_825 244
84 3300035242 Ga0373962_0075244 Ga0373962_0075244_102_839 244
85 3300035691 Ga0373931_0278401 Ga0373931_0278401_129_866 244
86 3300049571 Ga0501034_0032699 Ga0501034_0032699_3176_3916 244
87 3300049581 Ga0501047_0538272 Ga0501047_0538272_223_957 244
88 3300049760 Ga0501263_000751 Ga0501263_000751_1797_2531 244
89 3300050489 nmdc:mga03683_6_c1 nmdc:mga03683_6_c1_10349_11086 244
90 3300050490 nmdc:mga03n38_217528_c1 nmdc:mga03n38_217528_c1_155_892 244
91 3300050491 nmdc:mga00v17_114701_c1 nmdc:mga00v17_114701_c1_666_1403 244
92 3300050491 nmdc:mga00v17_34012_c1 nmdc:mga00v17_34012_c1_1001_1738 244
93 3300050493 nmdc:mga0k408_161812_c1 nmdc:mga0k408_161812_c1_156_893 244
94 3300050493 nmdc:mga0k408_6_c1 nmdc:mga0k408_6_c1_189348_190085 244
95 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_211426_212163 244
96 3300050516 nmdc:mga0sz30_172_c1 nmdc:mga0sz30_172_c1_774_1511 244
97 3300053080 Ga0500635_0000203 Ga0500635_0000203_26199_26945 244
98 3300053111 Ga0500572_097003 Ga0500572_097003_72_818 244
99 3300053121 Ga0500607_100349 Ga0500607_100349_122_868 244
100 3300053157 Ga0500624_008557 Ga0500624_008557_251_997 244
101 3300053162 Ga0500638_071915 Ga0500638_071915_513_1259 244
102 iso_pu_bacteria 2879163058 2879163889 244
103 3300002459 JGI24751J29686_10000131 JGI24751J29686_1000013135 245
104 3300003322 rootL2_10031824 rootL2_100318242 245
105 3300005289 Ga0065704_10002974 Ga0065704_100029741 245
106 3300005289 Ga0065704_10070144 Ga0065704_10070144182 245
107 3300005295 Ga0065707_10084119 Ga0065707_100841194 245
108 3300005295 Ga0065707_10124879 Ga0065707_101248792 245
109 3300005327 Ga0070658_10000244 Ga0070658_1000024445 245
110 3300005330 Ga0070690_100024533 Ga0070690_1000245332 245
111 3300005331 Ga0070670_100198119 Ga0070670_1001981192 245
112 3300005335 Ga0070666_10118585 Ga0070666_101185851 245
113 3300005347 Ga0070668_100000120 Ga0070668_10000012028 245
114 3300005347 Ga0070668_100190550 Ga0070668_1001905501 245
115 3300005353 Ga0070669_100001269 Ga0070669_10000126910 245
116 3300005355 Ga0070671_100000074 Ga0070671_10000007444 245
117 3300005367 Ga0070667_100002913 Ga0070667_10000291320 245
118 3300005539 Ga0068853_100144376 Ga0068853_1001443762 245
119 3300005548 Ga0070665_100000198 Ga0070665_10000019897 245
120 3300005548 Ga0070665_100127125 Ga0070665_1001271252 245
121 3300005563 Ga0068855_100034901 Ga0068855_1000349015 245
122 3300005563 Ga0068855_100120646 Ga0068855_1001206464 245
123 3300005577 Ga0068857_100005934 Ga0068857_10000593411 245
124 3300005578 Ga0068854_100000680 Ga0068854_1000006805 245
125 3300005614 Ga0068856_100001412 Ga0068856_10000141225 245
126 3300005616 Ga0068852_100000388 Ga0068852_10000038822 245
127 3300005616 Ga0068852_100038704 Ga0068852_1000387043 245
128 3300005616 Ga0068852_100709832 Ga0068852_1007098321 245
129 3300005617 Ga0068859_100000378 Ga0068859_10000037813 245
130 3300005617 Ga0068859_100047131 Ga0068859_1000471313 245
131 3300005617 Ga0068859_100274433 Ga0068859_1002744332 245
132 3300005618 Ga0068864_100000241 Ga0068864_10000024117 245
133 3300005618 Ga0068864_100016381 Ga0068864_1000163811 245
134 3300005618 Ga0068864_100121482 Ga0068864_1001214822 245
135 3300005719 Ga0068861_100000060 Ga0068861_1000000602 245
136 3300005719 Ga0068861_100039862 Ga0068861_1000398622 245
137 3300005841 Ga0068863_100000097 Ga0068863_10000009755 245
138 3300005841 Ga0068863_100038945 Ga0068863_1000389455 245
139 3300005841 Ga0068863_100184090 Ga0068863_1001840902 245
140 3300005842 Ga0068858_100000092 Ga0068858_10000009254 245
141 3300005842 Ga0068858_100110504 Ga0068858_1001105043 245
142 3300005843 Ga0068860_100033386 Ga0068860_1000333862 245
143 3300005843 Ga0068860_100038848 Ga0068860_1000388484 245
144 3300005843 Ga0068860_100330555 Ga0068860_1003305552 245
145 3300005844 Ga0068862_100003545 Ga0068862_10000354517 245
146 3300005844 Ga0068862_100270820 Ga0068862_1002708202 245
147 3300005844 Ga0068862_100406179 Ga0068862_1004061792 245
148 3300005985 Ga0081539_10131445 Ga0081539_101314451 245
149 3300006042 Ga0075368_10005990 Ga0075368_100059902 245
150 3300006051 Ga0075364_10161937 Ga0075364_101619373 245
151 3300006177 Ga0075362_10013827 Ga0075362_100138272 245
152 3300006178 Ga0075367_10086346 Ga0075367_100863462 245
153 3300006186 Ga0075369_10073232 Ga0075369_100732323 245
154 3300006881 Ga0068865_100597415 Ga0068865_1005974152 245
155 3300006931 Ga0097620_100000378 Ga0097620_10000037837 245
156 3300006931 Ga0097620_100047129 Ga0097620_1000471293 245
157 3300006931 Ga0097620_100274440 Ga0097620_1002744402 245
158 3300009011 Ga0105251_10024704 Ga0105251_100247044 245
159 3300009092 Ga0105250_10000144 Ga0105250_1000014451 245
160 3300009148 Ga0105243_10366896 Ga0105243_103668962 245
161 3300009177 Ga0105248_10134619 Ga0105248_101346192 245
162 3300009177 Ga0105248_10357153 Ga0105248_103571532 245
163 3300009177 Ga0105248_10548774 Ga0105248_105487742 245
164 3300009553 Ga0105249_10454798 Ga0105249_104547981 245
165 3300009553 Ga0105249_10961351 Ga0105249_109613512 245
166 3300010375 Ga0105239_10751190 Ga0105239_107511902 245
167 3300013306 Ga0163162_10096638 Ga0163162_100966382 245
168 3300014968 Ga0157379_10000239 Ga0157379_1000023928 245
169 3300014968 Ga0157379_10052721 Ga0157379_100527212 245
170 3300017792 Ga0163161_10017775 Ga0163161_100177754 245
171 3300017792 Ga0163161_10343114 Ga0163161_103431142 245
172 3300025292 Ga0209676_1064737 Ga0209676_10647372 245
173 3300025298 Ga0209050_1000370 Ga0209050_100037055 245
174 3300025298 Ga0209050_1002809 Ga0209050_10028099 245
175 3300025315 Ga0207697_10032667 Ga0207697_100326672 245
176 3300025711 Ga0207696_1000945 Ga0207696_10009457 245
177 3300025900 Ga0207710_10044323 Ga0207710_100443232 245
178 3300025903 Ga0207680_10189721 Ga0207680_101897212 245
179 3300025909 Ga0207705_10000224 Ga0207705_1000022410 245
180 3300025923 Ga0207681_10000137 Ga0207681_100001377 245
181 3300025923 Ga0207681_10034038 Ga0207681_100340384 245
182 3300025924 Ga0207694_10012528 Ga0207694_100125282 245
183 3300025931 Ga0207644_10000053 Ga0207644_1000005323 245
184 3300025931 Ga0207644_10049688 Ga0207644_100496881 245
185 3300025931 Ga0207644_10334950 Ga0207644_103349502 245
186 3300025938 Ga0207704_10507610 Ga0207704_105076102 245
187 3300025941 Ga0207711_10001008 Ga0207711_1000100812 245
188 3300025941 Ga0207711_10001300 Ga0207711_1000130017 245
189 3300025941 Ga0207711_10224686 Ga0207711_102246861 245
190 3300025949 Ga0207667_10007883 Ga0207667_1000788314 245
191 3300025949 Ga0207667_10070142 Ga0207667_100701422 245
192 3300025981 Ga0207640_10000640 Ga0207640_100006406 245
193 3300025986 Ga0207658_10001231 Ga0207658_1000123118 245
194 3300025986 Ga0207658_10218372 Ga0207658_102183722 245
195 3300026035 Ga0207703_10000737 Ga0207703_1000073723 245
196 3300026035 Ga0207703_10013057 Ga0207703_100130576 245
197 3300026035 Ga0207703_10400152 Ga0207703_104001521 245
198 3300026078 Ga0207702_10001835 Ga0207702_1000183521 245
199 3300026088 Ga0207641_10000128 Ga0207641_1000012854 245
200 3300026088 Ga0207641_10027462 Ga0207641_100274622 245
201 3300026095 Ga0207676_10000235 Ga0207676_1000023533 245
202 3300026095 Ga0207676_10020565 Ga0207676_100205652 245
203 3300026095 Ga0207676_10067501 Ga0207676_100675012 245
204 3300026116 Ga0207674_10010429 Ga0207674_1001042911 245
205 3300026118 Ga0207675_100000062 Ga0207675_10000006278 245
206 3300026118 Ga0207675_100008808 Ga0207675_1000088085 245
207 3300026121 Ga0207683_10119335 Ga0207683_101193353 245
208 3300026142 Ga0207698_10000005 Ga0207698_10000005118 245
209 3300026142 Ga0207698_10009777 Ga0207698_100097773 245
210 3300026142 Ga0207698_10128671 Ga0207698_101286712 245
211 3300027111 Ga0209281_1009258 Ga0209281_10092581 245
212 3300027866 Ga0209813_10000109 Ga0209813_1000010914 245
213 3300027907 Ga0207428_10013619 Ga0207428_100136192 245
214 3300028379 Ga0268266_10183553 Ga0268266_101835532 245
215 3300028381 Ga0268264_10000303 Ga0268264_1000030322 245
216 3300028381 Ga0268264_10046788 Ga0268264_100467882 245
217 3300028381 Ga0268264_10290620 Ga0268264_102906202 245
218 3300028794 Ga0307515_10128031 Ga0307515_101280312 245
219 3300031250 Ga0265331_10058271 Ga0265331_100582712 245
220 3300031456 Ga0307513_10081799 Ga0307513_100817992 245
221 3300031456 Ga0307513_10109366 Ga0307513_101093662 245
222 3300031731 Ga0307405_10051078 Ga0307405_100510781 245
223 3300031901 Ga0307406_10327519 Ga0307406_103275192 245
224 3300032004 Ga0307414_10224951 Ga0307414_102249512 245
225 3300033180 Ga0307510_10001966 Ga0307510_1000196617 245
226 3300041501 Ga0451845_0944516 Ga0451845_0944516_440_1189 245
227 3300041507 Ga0451851_0484716 Ga0451851_0484716_1243_1992 245
228 3300046459 Ga0495629_0043185 Ga0495629_0043185_2126_2890 245
229 3300046459 Ga0495629_0247707 Ga0495629_0247707_154_906 245
230 3300046460 Ga0495638_0005402 Ga0495638_0005402_3450_4205 245
231 3300046460 Ga0495638_0007997 Ga0495638_0007997_1849_2598 245
232 3300046460 Ga0495638_0217611 Ga0495638_0217611_117_860 245
233 3300046471 Ga0495650_0000163 Ga0495650_0000163_98218_98970 245
234 3300046471 Ga0495650_0001568 Ga0495650_0001568_16670_17407 245
235 3300046491 Ga0495584_0193063 Ga0495584_0193063_169_924 245
236 3300046501 Ga0495607_0038742 Ga0495607_0038742_283_1020 245
237 3300046506 Ga0495583_0000333 Ga0495583_0000333_55563_56315 245
238 3300046506 Ga0495583_0033040 Ga0495583_0033040_93_848 245
239 3300046506 Ga0495583_0061405 Ga0495583_0061405_111_848 245
240 3300046507 Ga0495606_0095175 Ga0495606_0095175_344_1108 245
241 3300046507 Ga0495606_0175824 Ga0495606_0175824_306_1055 245
242 3300046512 Ga0495610_0000018 Ga0495610_0000018_133057_133794 245
243 3300046512 Ga0495610_0000689 Ga0495610_0000689_18472_19209 245
244 3300046512 Ga0495610_0014728 Ga0495610_0014728_1801_2550 245
245 3300046513 Ga0495616_0104947 Ga0495616_0104947_256_993 245
246 3300046515 Ga0495620_0005115 Ga0495620_0005115_394_1131 245
247 3300046518 Ga0495631_0139262 Ga0495631_0139262_160_924 245
248 3300046520 Ga0495637_0140861 Ga0495637_0140861_41_805 245
249 3300046522 Ga0495643_0000039 Ga0495643_0000039_17457_18194 245
250 3300046522 Ga0495643_0004473 Ga0495643_0004473_265_1002 245
251 3300046522 Ga0495643_0018682 Ga0495643_0018682_2803_3567 245
252 3300046523 Ga0495644_0158255 Ga0495644_0158255_28_777 245
253 3300046525 Ga0495663_0114024 Ga0495663_0114024_52_801 245
254 3300046530 Ga0495654_0030372 Ga0495654_0030372_879_1616 245
255 3300046536 Ga0495587_0022258 Ga0495587_0022258_2524_3276 245
256 3300046538 Ga0495609_0002903 Ga0495609_0002903_8632_9369 245
257 3300046542 Ga0495597_0001810 Ga0495597_0001810_13150_13914 245
258 3300046557 Ga0495622_0030281 Ga0495622_0030281_952_1704 245
259 3300046616 Ga0495668_0048784 Ga0495668_0048784_805_1557 245
260 3300046616 Ga0495668_0167972 Ga0495668_0167972_144_890 245
261 3300046660 Ga0495625_0003760 Ga0495625_0003760_2071_2826 245
262 3300046660 Ga0495625_0005577 Ga0495625_0005577_9633_10382 245
263 3300046660 Ga0495625_0021291 Ga0495625_0021291_331_1068 245
264 3300046660 Ga0495625_0030200 Ga0495625_0030200_1697_2455 245
265 3300046809 Ga0495600_0000847 Ga0495600_0000847_7502_8254 245
266 3300047322 Ga0495680_0112104 Ga0495680_0112104_1168_1917 245
267 3300047443 Ga0495687_019781 Ga0495687_019781_274_1038 245
268 3300047445 Ga0495677_0029477 Ga0495677_0029477_450_1205 245
269 3300047470 Ga0495681_0000020 Ga0495681_0000020_143557_144294 245
270 3300047472 Ga0495686_0000671 Ga0495686_0000671_43717_44478 245
271 3300047472 Ga0495686_0035786 Ga0495686_0035786_150_893 245
272 3300047673 Ga0495593_0053020 Ga0495593_0053020_990_1754 245
273 3300048090 Ga0495615_0000036 Ga0495615_0000036_39727_40464 245
274 3300048091 Ga0495626_0017339 Ga0495626_0017339_566_1315 245
275 3300048903 Ga0496100_0017273 Ga0496100_0017273_124_879 245
276 3300048904 Ga0496101_0017210 Ga0496101_0017210_426_1181 245
277 3300048904 Ga0496101_0499888 Ga0496101_0499888_129_884 245
278 3300048905 Ga0496102_0064671 Ga0496102_0064671_397_1152 245
279 3300048906 Ga0496103_0044624 Ga0496103_0044624_801_1556 245
280 3300048907 Ga0496104_0008539 Ga0496104_0008539_2339_3094 245
281 3300048908 Ga0496105_0059138 Ga0496105_0059138_50_805 245
282 3300048909 Ga0496106_0004323 Ga0496106_0004323_3388_4143 245
283 3300048912 Ga0496109_0218968 Ga0496109_0218968_807_1562 245
284 3300048912 Ga0496109_0275518 Ga0496109_0275518_395_1150 245
285 3300048913 Ga0496110_0555278 Ga0496110_0555278_90_845 245
286 3300048914 Ga0496111_0026650 Ga0496111_0026650_788_1543 245
287 3300048915 Ga0496112_0271111 Ga0496112_0271111_838_1593 245
288 3300048916 Ga0496113_0019278 Ga0496113_0019278_3302_4057 245
289 3300048917 Ga0496114_0276004 Ga0496114_0276004_381_1136 245
290 3300048919 Ga0496116_0000028 Ga0496116_0000028_167628_168365 245
291 3300048921 Ga0496118_0012653 Ga0496118_0012653_820_1587 245
292 3300048922 Ga0496119_0030306 Ga0496119_0030306_137_907 245
293 3300048924 Ga0496121_0000042 Ga0496121_0000042_75018_75785 245
294 3300048925 Ga0496122_0000927 Ga0496122_0000927_48685_49440 245
295 3300048925 Ga0496122_0003325 Ga0496122_0003325_11651_12388 245
296 3300048925 Ga0496122_0016966 Ga0496122_0016966_1039_1776 245
297 3300048926 Ga0496123_0000278 Ga0496123_0000278_51160_51915 245
298 3300048926 Ga0496123_0001326 Ga0496123_0001326_29534_30271 245
299 3300048926 Ga0496123_0006412 Ga0496123_0006412_9127_9864 245
300 3300048927 Ga0496124_0001859 Ga0496124_0001859_25929_26666 245
301 3300048927 Ga0496124_0015904 Ga0496124_0015904_5058_5795 245
302 3300048927 Ga0496124_0043592 Ga0496124_0043592_2517_3254 245
303 3300048927 Ga0496124_0083599 Ga0496124_0083599_1389_2126 245
304 3300048928 Ga0496125_0030974 Ga0496125_0030974_826_1563 245
305 3300048928 Ga0496125_0140536 Ga0496125_0140536_68_805 245
306 3300048929 Ga0496126_0000079 Ga0496126_0000079_74454_75191 245
307 3300048929 Ga0496126_0009489 Ga0496126_0009489_9258_10061 245
308 3300048929 Ga0496126_0018647 Ga0496126_0018647_2884_3624 245
309 3300049523 Ga0501300_003516 Ga0501300_003516_307_1047 245
310 3300049579 Ga0501043_0230117 Ga0501043_0230117_494_1258 245
311 3300049581 Ga0501047_0061054 Ga0501047_0061054_924_1688 245
312 3300049663 Ga0501223_018316 Ga0501223_018316_550_1290 245
313 3300049679 Ga0501249_015770 Ga0501249_015770_61_816 245
314 3300049686 Ga0501257_000008 Ga0501257_000008_24586_25326 245
315 3300049776 Ga0501280_015268 Ga0501280_015268_118_858 245
316 3300050489 nmdc:mga03683_685_c1 nmdc:mga03683_685_c1_1501_2238 245
317 3300050490 nmdc:mga03n38_74882_c1 nmdc:mga03n38_74882_c1_105_842 245
318 3300050491 nmdc:mga00v17_54731_c1 nmdc:mga00v17_54731_c1_141_878 245
319 3300050494 nmdc:mga06z11_353_c1 nmdc:mga06z11_353_c1_13360_14097 245
320 3300050495 nmdc:mga04h51_1343_c1 nmdc:mga04h51_1343_c1_1466_2203 245
321 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_172917_173654 245
322 3300050516 nmdc:mga0sz30_580_c1 nmdc:mga0sz30_580_c1_953_1690 245
323 3300053087 Ga0500643_004592 Ga0500643_004592_1523_2278 245
324 3300053092 Ga0500583_0068224 Ga0500583_0068224_247_990 245
325 3300053092 Ga0500583_0202891 Ga0500583_0202891_74_838 245
326 3300053093 Ga0500651_0338059 Ga0500651_0338059_49_813 245
327 3300053096 Ga0500641_0134380 Ga0500641_0134380_59_802 245
328 3300053104 Ga0500556_0016976 Ga0500556_0016976_185_937 245
329 3300053104 Ga0500556_0055680 Ga0500556_0055680_493_1236 245
330 3300053116 Ga0500592_002809 Ga0500592_002809_381_1133 245
331 3300053119 Ga0500595_000774 Ga0500595_000774_3016_3768 245
332 3300053121 Ga0500607_000048 Ga0500607_000048_24192_24929 245
333 3300053121 Ga0500607_023828 Ga0500607_023828_1064_1801 245
334 3300053122 Ga0500608_003951 Ga0500608_003951_358_1122 245
335 3300053125 Ga0500618_029333 Ga0500618_029333_464_1210 245
336 3300053130 Ga0500642_0007338 Ga0500642_0007338_423_1175 245
337 3300053136 Ga0500559_0010566 Ga0500559_0010566_2777_3514 245
338 3300053138 Ga0500564_110916 Ga0500564_110916_97_861 245
339 3300053148 Ga0500590_004827 Ga0500590_004827_1705_2457 245
340 3300053154 Ga0500619_027690 Ga0500619_027690_124_876 245
341 3300053155 Ga0500620_031471 Ga0500620_031471_114_878 245
342 3300053156 Ga0500622_0015016 Ga0500622_0015016_1196_1942 245
343 3300053729 Ga0500625_126154 Ga0500625_126154_152_916 245
344 2162886007 SwRhRL2b_contig_878255 SwRhRL2b_0823.00003020 246
345 3300001976 JGI24752J21851_1001621 JGI24752J21851_10016213 246
346 3300005841 Ga0068863_100103877 Ga0068863_1001038772 246
347 3300014968 Ga0157379_10023557 Ga0157379_100235575 246
348 3300026088 Ga0207641_10008192 Ga0207641_100081923 246
349 3300031730 Ga0307516_10249952 Ga0307516_102499521 246
350 3300046530 Ga0495654_0061753 Ga0495654_0061753_750_1505 246
351 3300046616 Ga0495668_0274839 Ga0495668_0274839_88_843 246
352 3300046660 Ga0495625_0044711 Ga0495625_0044711_454_1209 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

64

303

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5djk-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with po4 and 2ca bound 0.9491 4 244
5djg-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with pap, mg, and li bound 0.9467 4 244
5djh-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with amp, po4, and 3mg bound 0.9447 4 244
5djf-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase - ligand-free structure 0.934 4 244
5djk-assembly1.cif.gz_A structure of m. tuberculosis cysq, a pap phosphatase with po4 and 2ca bound 0.9267 4 244
ID Description Score Start End Superfamily
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9551 134 233 3.40.190.80
af_P9WKJ1_12_146_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.941 4 129 3.30.540.10
2q74C01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.931 7 123 3.30.540.10
af_P9WKJ1_154_255_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9282 134 233 3.40.190.80
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.917 7 123 3.30.540.10
ID Description Score Start End GO Terms
AF-A0A2D4XZT0-F1-model_v4 deleted 1.002 4 100
AF-A0A165PIH6-F1-model_v4 deleted 0.999 4 244
AF-A0A2Z6ALE3-F1-model_v4 3'(2'), 5'-bisphosphate nucleotidase 0.9989 2 245 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-A0A1M3P914-F1-model_v4 3'(2'),5'-bisphosphate nucleotidase CysQ 0.9978 4 245 GO:0000103
GO:0008441
GO:0046872
GO:0050427
AF-J2DL66-F1-model_v4 deleted 0.9975 4 229

Feature Viewer

pLDDT pTM Quality
96.03 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map