F418431

General Info

Members Datasets Scaffolds Average Seq Length
350 257 700 267

Family's Representative Sequence

Representative Sequence 3300053155|Ga0500620_000691|Ga0500620_000691_886_1785
Length 299
Sequence VETCRPANAYLTQRIAVIAQGYDVTFVILFIGVGICLSLVMSIAWAIAISSGKSGWVDAIWSFAVGAAGVAVALVPLPSWQQAEARPMIVALLAAIWSIRLGLHIVIRTLHGGDDPRYAQLRSEWGEAFPRRLFGFLQIQAAAALLLALSIFTAARNPEPQLQTSDWLGIAILVIAIFGEGVADRQLARFRDDPGNKGKVCDVGLWGLSRHPNYFFEWLGWLAYVAIALDLTGAYPWGWVAGTGPVFMYWLLVHVSGIPPLEAHMLASRGEKFRAYQARVNAFWPGPPRQPRTSKGKAS

Samples

Sample ID Description Type Environment
1 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
44 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
45 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
46 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
81 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
141 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
142 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
143 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
167 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
170 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
171 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
179 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
180 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
181 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
182 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
183 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
184 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
187 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
188 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
189 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
195 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
196 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
199 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
200 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
204 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
205 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
206 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
207 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
208 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
209 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
210 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
211 2512875024
212 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
213 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
214 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
215 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
216 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
217 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
218 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
219 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
220 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
221 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
222 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
223 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
224 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
225 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
226 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
227 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
228 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
229 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
230 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
231 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
232 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
233 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
234 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
235 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
236 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
237 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
238 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
239 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
240 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
241 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
242 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
243 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
244 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
245 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
246 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
247 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
248 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
249 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
250 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
251 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
252 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
253 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
254 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
255 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
256 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
257 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.71
Metatranscriptomes 0
Isolates 14.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28
Nodule 7.71
Rhizoplane 2
Rhizosphere 45.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500620_000691 3300053155 Bacteria 5782
2 JGI25153J46596_10000404 3300003215 Bacteria 28752
3 JGI25153J46596_10000505 3300003215 Bacteria 24803
4 JGI25153J46596_10008458 3300003215 Bacteria 4916
5 JGI25153J46596_10011004 3300003215 Bacteria 4034
6 rootH2_10001850 3300003320 Bacteria 20964
7 rootL2_10072181 3300003322 Bacteria 1111
8 rootH1_10042113 3300003323 Bacteria 1499
9 JGI25160J50197_1000939 3300003354 Bacteria 15302
10 JGI25160J50197_1004311 3300003354 Bacteria 6166
11 Ga0065165_1001608 3300005262 Bacteria 23076
12 Ga0065165_1003972 3300005262 Bacteria 9688
13 Ga0065165_1019673 3300005262 Bacteria 2400
14 Ga0070658_10024477 3300005327 Bacteria 4843
15 Ga0070680_100263877 3300005336 Bacteria 1457
16 Ga0070660_100137530 3300005339 Bacteria 1958
17 Ga0070709_10079045 3300005434 Bacteria 2141
18 Ga0070714_100182113 3300005435 Bacteria 1912
19 Ga0070714_100267382 3300005435 Bacteria 1585
20 Ga0070713_100118775 3300005436 Bacteria 2315
21 Ga0070708_100440449 3300005445 Bacteria 1229
22 Ga0070663_100024049 3300005455 Bacteria 4092
23 Ga0070663_100090747 3300005455 Bacteria 2263
24 Ga0070681_10072256 3300005458 Bacteria 3413
25 Ga0068867_100177531 3300005459 Bacteria 1691
26 Ga0068853_100102599 3300005539 Bacteria 2531
27 Ga0070665_100019114 3300005548 Bacteria 6873
28 Ga0070665_100080824 3300005548 Bacteria 3256
29 Ga0070665_100535423 3300005548 Bacteria 1183
30 Ga0068856_100204381 3300005614 Bacteria 1990
31 Ga0068856_100367498 3300005614 Bacteria 1457
32 Ga0068852_100013221 3300005616 Bacteria 6309
33 Ga0068859_100043812 3300005617 Bacteria 4497
34 Ga0068863_100015702 3300005841 Bacteria 7270
35 Ga0068860_100033243 3300005843 Bacteria 4950
36 Ga0068862_100000095 3300005844 Bacteria 105957
37 Ga0070717_10212820 3300006028 Bacteria 1697
38 Ga0075365_10013350 3300006038 Bacteria 4908
39 Ga0075368_10012717 3300006042 Bacteria 3083
40 Ga0075363_100022164 3300006048 Bacteria 3209
41 Ga0075363_100072817 3300006048 Bacteria 1869
42 Ga0075363_100279010 3300006048 Bacteria 966
43 Ga0075364_10011737 3300006051 Bacteria 5332
44 Ga0075364_10035980 3300006051 Bacteria 3201
45 Ga0070712_100016419 3300006175 Bacteria 4782
46 Ga0075367_10001654 3300006178 Bacteria 9712
47 Ga0075367_10006878 3300006178 Bacteria 5788
48 Ga0075367_10028003 3300006178 Bacteria 3210
49 Ga0075369_10059239 3300006186 Bacteria 1668
50 Ga0075370_10017439 3300006353 Bacteria 3880
51 Ga0097620_100043811 3300006931 Bacteria 4497
52 Ga0105240_10013649 3300009093 Bacteria 11142
53 Ga0105240_10091832 3300009093 Bacteria 3708
54 Ga0105247_10045086 3300009101 Bacteria 2706
55 Ga0105241_10028079 3300009174 Bacteria 4191
56 Ga0105241_10072471 3300009174 Bacteria 2677
57 Ga0105241_10125970 3300009174 Bacteria 2068
58 Ga0105241_10226598 3300009174 Bacteria 1574
59 Ga0105237_10051090 3300009545 Bacteria 4154
60 Ga0105237_10234825 3300009545 Bacteria 1835
61 Ga0105238_10016131 3300009551 Bacteria 7557
62 Ga0105238_10370028 3300009551 Bacteria 1423
63 Ga0105249_10000205 3300009553 Bacteria 67490
64 Ga0105239_10018236 3300010375 Bacteria 7758
65 Ga0105239_10141551 3300010375 Bacteria 2681
66 Ga0105239_10231085 3300010375 Bacteria 2075
67 Ga0105239_10234783 3300010375 Bacteria 2058
68 Ga0214544_1000007 3300021320 Bacteria 379989
69 Ga0214544_1031152 3300021320 Bacteria 1783
70 Ga0214542_1000007 3300021321 Bacteria 291816
71 Ga0214545_1000006 3300021324 Bacteria 291693
72 Ga0214543_1000009 3300021327 Bacteria 384302
73 Ga0213875_10000773 3300021388 Bacteria 23904
74 Ga0213875_10034430 3300021388 Bacteria 2391
75 Ga0209563_102505 3300025230 Bacteria 4130
76 Ga0207425_1009237 3300025245 Bacteria 2465
77 Ga0209677_109714 3300025253 Bacteria 1689
78 Ga0209148_1001992 3300025254 Bacteria 8061
79 Ga0209233_1020340 3300025261 Bacteria 1743
80 Ga0209455_1002997 3300025272 Bacteria 6203
81 Ga0209758_1000015 3300025297 Bacteria 851943
82 Ga0209758_1000161 3300025297 Bacteria 154278
83 Ga0209758_1000673 3300025297 Bacteria 51032
84 Ga0209758_1005308 3300025297 Bacteria 10057
85 Ga0209758_1030456 3300025297 Bacteria 2234
86 Ga0209758_1033359 3300025297 Bacteria 2069
87 Ga0209256_1002321 3300025299 Bacteria 15930
88 Ga0207426_1000577 3300025302 Bacteria 49128
89 Ga0207426_1001352 3300025302 Bacteria 20790
90 Ga0207426_1006097 3300025302 Bacteria 5316
91 Ga0209257_1000762 3300025304 Bacteria 48195
92 Ga0207710_10037545 3300025900 Bacteria 2139
93 Ga0207699_10025863 3300025906 Bacteria 3228
94 Ga0207654_10036563 3300025911 Bacteria 2744
95 Ga0207654_10154756 3300025911 Bacteria 1475
96 Ga0207707_10024129 3300025912 Bacteria 5319
97 Ga0207695_10000006 3300025913 Bacteria 1135309
98 Ga0207695_10083586 3300025913 Bacteria 3225
99 Ga0207671_10281892 3300025914 Bacteria 1311
100 Ga0207693_10023695 3300025915 Bacteria 4871
101 Ga0207657_10053321 3300025919 Bacteria 3504
102 Ga0207657_10143749 3300025919 Bacteria 1947
103 Ga0207664_10159372 3300025929 Bacteria 1924
104 Ga0207712_10000030 3300025961 Bacteria 216514
105 Ga0207640_10231276 3300025981 Bacteria 1422
106 Ga0207639_10109394 3300026041 Bacteria 2249
107 Ga0207678_10023699 3300026067 Bacteria 5368
108 Ga0207678_10104394 3300026067 Bacteria 2419
109 Ga0207641_10032420 3300026088 Bacteria 4337
110 Ga0207674_10372413 3300026116 Bacteria 1380
111 Ga0207698_10118644 3300026142 Bacteria 2235
112 Ga0209813_10062460 3300027866 Bacteria 1192
113 Ga0268266_10000360 3300028379 Bacteria 70734
114 Ga0268266_10006634 3300028379 Bacteria 10560
115 Ga0268266_10038678 3300028379 Bacteria 4061
116 Ga0268265_10000132 3300028380 Bacteria 95410
117 Ga0268264_10000783 3300028381 Bacteria 34834
118 Ga0265338_10154209 3300028800 Bacteria 1781
119 Ga0307513_10020850 3300031456 Bacteria 7757
120 Ga0307509_10388534 3300031507 Bacteria 1106
121 Ga0307510_10006633 3300033180 Bacteria 13810
122 Ga0307510_10095572 3300033180 Bacteria 2791
123 Ga0395900_0001627 3300037418 Bacteria 26397
124 Ga0395898_0002504 3300037466 Bacteria 21600
125 Ga0395905_0518933 3300037471 Bacteria 1092
126 Ga0436364_0017273 3300037853 Bacteria 44478
127 Ga0436364_1200653 3300037853 Bacteria 55826
128 Ga0395901_0047905 3300038443 Bacteria 4438
129 Ga0436365_1800892 3300039437 Bacteria 3053
130 Ga0436363_1663439 3300039450 Bacteria 2523
131 Ga0451833_0522871 3300041491 Bacteria 1778
132 Ga0466969_0043941 3300044656 Bacteria 2225
133 Ga0466966_0001143 3300044684 Bacteria 17046
134 Ga0466961_0000018 3300044693 Bacteria 109837
135 Ga0466961_0075352 3300044693 Bacteria 2139
136 Ga0466963_0082034 3300044694 Bacteria 2185
137 Ga0466964_0088490 3300044706 Bacteria 1343
138 Ga0466959_0008322 3300045049 Bacteria 7326
139 Ga0466958_0197314 3300045836 Bacteria 1280
140 Ga0466967_0141086 3300045976 Bacteria 2244
141 Ga0495592_0115177 3300046454 Bacteria 1898
142 Ga0495603_0019604 3300046455 Bacteria 4094
143 Ga0495629_0076110 3300046459 Bacteria 2343
144 Ga0495638_0001594 3300046460 Bacteria 20261
145 Ga0495651_0014115 3300046462 Bacteria 6176
146 Ga0495651_0123017 3300046462 Bacteria 1903
147 Ga0495607_0176332 3300046501 Bacteria 1075
148 Ga0495608_0048258 3300046511 Bacteria 2830
149 Ga0495610_0011720 3300046512 Bacteria 5332
150 Ga0495616_0005512 3300046513 Bacteria 7775
151 Ga0495618_0043909 3300046514 Bacteria 2820
152 Ga0495631_0008714 3300046518 Bacteria 5100
153 Ga0495643_0023340 3300046522 Bacteria 3518
154 Ga0495648_0084493 3300046524 Bacteria 1796
155 Ga0495652_0054796 3300046529 Bacteria 3394
156 Ga0495654_0009799 3300046530 Bacteria 5236
157 Ga0495622_0024634 3300046557 Bacteria 2810
158 Ga0495668_0137920 3300046616 Bacteria 1335
159 Ga0495625_0016400 3300046660 Bacteria 5832
160 Ga0495635_0005707 3300046663 Bacteria 8672
161 Ga0495661_0009853 3300046665 Bacteria 6534
162 Ga0495657_0010355 3300046675 Bacteria 7017
163 Ga0495624_0033854 3300046690 Bacteria 3308
164 Ga0495600_0010346 3300046809 Bacteria 5789
165 Ga0495660_0073369 3300046810 Bacteria 1810
166 Ga0495604_0017908 3300047317 Bacteria 5667
167 Ga0495676_0058128 3300047321 Bacteria 3045
168 Ga0495686_0011184 3300047472 Bacteria 6332
169 Ga0495686_0032734 3300047472 Bacteria 3363
170 Ga0495686_0177303 3300047472 Bacteria 1236
171 Ga0495593_0031673 3300047673 Bacteria 2887
172 Ga0495602_0128988 3300048088 Bacteria 2020
173 Ga0496101_0273685 3300048904 Bacteria 1319
174 Ga0496102_0031358 3300048905 Bacteria 4768
175 Ga0496104_0084905 3300048907 Bacteria 3021
176 Ga0496105_0068749 3300048908 Bacteria 2926
177 Ga0496113_0010200 3300048916 Bacteria 6202
178 Ga0496114_0226116 3300048917 Bacteria 1643
179 Ga0496115_0030263 3300048918 Bacteria 4258
180 Ga0496116_0197993 3300048919 Bacteria 1055
181 Ga0496117_0031143 3300048920 Bacteria 4078
182 Ga0496117_0234704 3300048920 Bacteria 1011
183 Ga0496118_0025994 3300048921 Bacteria 5001
184 Ga0496118_0092143 3300048921 Bacteria 2081
185 Ga0496118_0191020 3300048921 Bacteria 1225
186 Ga0496119_0008698 3300048922 Bacteria 8870
187 Ga0496120_0010635 3300048923 Bacteria 6397
188 Ga0496120_0039310 3300048923 Bacteria 2792
189 Ga0496121_0019156 3300048924 Bacteria 6858
190 Ga0496121_0030597 3300048924 Bacteria 4941
191 Ga0496121_0399867 3300048924 Bacteria 900
192 Ga0496123_0074326 3300048926 Bacteria 2104
193 Ga0496124_0020611 3300048927 Bacteria 6086
194 Ga0496124_0193130 3300048927 Bacteria 1556
195 Ga0496125_0006575 3300048928 Bacteria 12525
196 Ga0496125_0077651 3300048928 Bacteria 2558
197 Ga0496125_0083349 3300048928 Bacteria 2433
198 Ga0496126_0025012 3300048929 Bacteria 5754
199 Ga0496126_0174407 3300048929 Bacteria 1830
200 Ga0495682_0020272 3300049460 Bacteria 2496
201 Ga0501031_0000464 3300049568 Bacteria 23491
202 Ga0501031_0178489 3300049568 Bacteria 1387
203 Ga0501032_0040954 3300049569 Bacteria 3147
204 Ga0501032_0133386 3300049569 Bacteria 1637
205 Ga0501033_0001441 3300049570 Bacteria 21121
206 Ga0501033_0004576 3300049570 Bacteria 11077
207 Ga0501034_0002660 3300049571 Bacteria 21135
208 Ga0501036_0001020 3300049572 Bacteria 21136
209 Ga0501036_0194032 3300049572 Bacteria 1708
210 Ga0501036_0258117 3300049572 Bacteria 1460
211 Ga0501037_0000203 3300049573 Bacteria 53647
212 Ga0501038_0022151 3300049574 Bacteria 5694
213 Ga0501038_0063281 3300049574 Bacteria 3158
214 Ga0501038_0066021 3300049574 Bacteria 3082
215 Ga0501039_0000945 3300049575 Bacteria 21135
216 Ga0501039_0097867 3300049575 Bacteria 2288
217 Ga0501043_0016742 3300049579 Bacteria 5746
218 Ga0501043_0049631 3300049579 Bacteria 3299
219 Ga0501046_0090489 3300049580 Bacteria 2355
220 Ga0501047_0033807 3300049581 Bacteria 4935
221 Ga0501047_0037150 3300049581 Bacteria 4709
222 Ga0501047_0046964 3300049581 Bacteria 4172
223 Ga0501047_0100016 3300049581 Bacteria 2779
224 Ga0501048_0407156 3300049582 Bacteria 973
225 Ga0501069_0085382 3300049585 Bacteria 1781
226 Ga0501069_0099248 3300049585 Bacteria 1652
227 Ga0501070_0001254 3300049586 Bacteria 22740
228 Ga0501070_0002591 3300049586 Bacteria 15804
229 Ga0501070_0024017 3300049586 Bacteria 5112
230 Ga0501071_0019645 3300049587 Bacteria 4688
231 Ga0501073_0021222 3300049589 Bacteria 4682
232 Ga0501074_0049046 3300049590 Bacteria 3049
233 Ga0501080_0030820 3300049742 Bacteria 4997
234 Ga0501083_0142722 3300049744 Bacteria 1568
235 Ga0501035_0000398 3300049822 Bacteria 49830
236 Ga0501035_0001283 3300049822 Bacteria 25941
237 Ga0501035_0001667 3300049822 Bacteria 22461
238 Ga0501044_0002456 3300049823 Bacteria 21135
239 Ga0501044_0002573 3300049823 Bacteria 20664
240 Ga0501044_0011278 3300049823 Bacteria 9685
241 Ga0501044_0084597 3300049823 Bacteria 3206
242 nmdc:mga03n38_18720_c1 3300050490 Bacteria 2738
243 nmdc:mga03n38_53653_c1 3300050490 Bacteria 1809
244 nmdc:mga00v17_2618_c1 3300050491 Bacteria 9233
245 nmdc:mga0yw44_103959_c1 3300050492 Bacteria 1812
246 nmdc:mga0yw44_2226_c1 3300050492 Bacteria 8174
247 nmdc:mga0k408_52769_c1 3300050493 Bacteria 2356
248 nmdc:mga06z11_19461_c1 3300050494 Bacteria 3122
249 nmdc:mga06z11_19831_c1 3300050494 Bacteria 3099
250 nmdc:mga06z11_92251_c1 3300050494 Bacteria 1646
251 nmdc:mga04h51_50768_c1 3300050495 Bacteria 1391
252 nmdc:mga07m45_8310_c1 3300050496 Bacteria 5329
253 nmdc:mga0sz30_33200_c1 3300050516 Bacteria 2144
254 Ga0495619_0022675 3300053085 Bacteria 4021
255 Ga0500644_0012673 3300053088 Bacteria 2337
256 Ga0500647_0059185 3300053091 Bacteria 1842
257 Ga0500651_0160487 3300053093 Bacteria 1345
258 Ga0500566_0001043 3300053094 Bacteria 16047
259 Ga0500566_0058313 3300053094 Bacteria 2192
260 Ga0500641_0000939 3300053096 Bacteria 10411
261 Ga0500650_0000499 3300053098 Bacteria 9925
262 Ga0500554_001433 3300053102 Bacteria 4611
263 Ga0500554_050556 3300053102 Bacteria 1307
264 Ga0500557_000165 3300053105 Bacteria 14520
265 Ga0500562_000689 3300053108 Bacteria 8248
266 Ga0500569_058067 3300053109 Bacteria 1187
267 Ga0500595_015161 3300053119 Bacteria 2898
268 Ga0500607_032613 3300053121 Bacteria 2858
269 Ga0500608_010470 3300053122 Bacteria 3982
270 Ga0500642_0000088 3300053130 Bacteria 47518
271 Ga0500652_000196 3300053131 Bacteria 23488
272 Ga0500658_0004137 3300053134 Bacteria 5451
273 Ga0500559_0000067 3300053136 Bacteria 83330
274 Ga0500559_0014734 3300053136 Bacteria 3303
275 Ga0500559_0035734 3300053136 Bacteria 2147
276 Ga0500568_0000268 3300053139 Bacteria 44102
277 Ga0500568_0001649 3300053139 Bacteria 14000
278 Ga0500573_0000214 3300053140 Bacteria 23741
279 Ga0500590_024907 3300053148 Bacteria 3107
280 Ga0500590_044852 3300053148 Bacteria 2265
281 Ga0500590_086600 3300053148 Bacteria 1528
282 Ga0500603_002492 3300053150 Bacteria 4025
283 Ga0500604_0000069 3300053151 Bacteria 37014
284 Ga0500604_0012474 3300053151 Bacteria 2294
285 Ga0500616_0000036 3300053153 Bacteria 390769
286 Ga0500620_000131 3300053155 Bacteria 14935
287 Ga0500627_0004098 3300053158 Bacteria 4623
288 Ga0500634_0024348 3300053161 Bacteria 3292
289 Ga0500638_125696 3300053162 Bacteria 1168
290 Ga0500638_125904 3300053162 Bacteria 1167
291 Ga0500636_0000440 3300053177 Bacteria 22952
292 Ga0500636_0014644 3300053177 Bacteria 4611
293 Ga0500636_0185757 3300053177 Bacteria 1112
294 Ga0500637_0093040 3300053178 Bacteria 1746
295 Ga0500649_061964 3300053722 Bacteria 1558
296 Ga0500570_058127 3300053724 Bacteria 1891
297 Ga0500611_014505 3300053727 Bacteria 1376
298 Ga0500611_019342 3300053727 Bacteria 1269
299 Ga0500601_000146 3300053737 Bacteria 14602
300 Ga0500661_006538 3300055283 Bacteria 2168
301 2508545981 2508501009 Bacteria 7784016
302 2510315179 2510065059 Bacteria 6847884
303 2511397382 2511231028 Bacteria 8046582
304 2512960548 2512875024 Bacteria 7195110
305 2514036362 2513237164 Bacteria 7563725
306 2588518079 2588253730 Bacteria 6881675
307 2643777022 2643221551 Bacteria 3750538
308 2643795470 2643221555 Bacteria 3749717
309 2793063603 2791355196 Bacteria 7323613
310 2824606383 2824600985 Bacteria 8488197
311 2824616201 2824609381 Bacteria 8672835
312 2824619508 2824617872 Bacteria 8814715
313 2824627963 2824626560 Bacteria 8813858
314 2824635993 2824635225 Bacteria 8785348
315 2824646255 2824644064 Bacteria 8743947
316 2824658499 2824653114 Bacteria 8493680
317 2824720553 2824714736 Bacteria 8717648
318 2824727565 2824723954 Bacteria 8758240
319 2824747629 2824746037 Bacteria 7911610
320 2842044206 2842038055 Bacteria 8002051
321 2842051805 2842045827 Bacteria 8006841
322 2844316366 2844315083 Bacteria 8138177
323 2849082365 2849076700 Bacteria 7039503
324 2857529660 2857524615 Bacteria 6615449
325 2881369773 2881364244 Bacteria 7710352
326 2888394549 2888388044 Bacteria 7304136
327 2888427126 2888419890 Bacteria 7857137
328 2893066898 2893066018 Bacteria 6158120
329 2903728299 2903727486 Bacteria 8281579
330 2906606440 2906602504 Bacteria 8295279
331 2908782865 2908775508 Bacteria 8092255
332 2919451701 2919450847 Bacteria 5631160
333 2935614291 2935608549 Bacteria 8203142
334 2935826509 2935819856 Bacteria 8261050
335 2935851197 2935847175 Bacteria 8228321
336 2935913246 2935908558 Bacteria 8568796
337 2935922668 2935916978 Bacteria 9113783
338 2935930829 2935926038 Bacteria 8601059
339 2935939837 2935934488 Bacteria 8602579
340 2935946786 2935942939 Bacteria 8599779
341 2935956013 2935951376 Bacteria 8602333
342 2935972806 2935967501 Bacteria 8603075
343 2941534479 2941531003 Bacteria 7653939
344 3005510735 3005506211 Bacteria 6943378
345 3005711926 3005710791 Bacteria 7622528
346 3005719170 3005718088 Bacteria 8283608
347 637079740 637000159 Bacteria 7596297
348 8001846508 8001845381 Bacteria 5804942
349 8019693357 8019687851 Bacteria 8712826
350 8056974042 8056967851 Bacteria 9038162
351 Ga0500620_000691
352 JGI25153J46596_10000404
353 JGI25153J46596_10000505
354 JGI25153J46596_10008458
355 JGI25153J46596_10011004
356 rootH2_10001850
357 rootL2_10072181
358 rootH1_10042113
359 JGI25160J50197_1000939
360 JGI25160J50197_1004311
361 Ga0065165_1001608
362 Ga0065165_1003972
363 Ga0065165_1019673
364 Ga0070658_10024477
365 Ga0070680_100263877
366 Ga0070660_100137530
367 Ga0070709_10079045
368 Ga0070714_100182113
369 Ga0070714_100267382
370 Ga0070713_100118775
371 Ga0070708_100440449
372 Ga0070663_100024049
373 Ga0070663_100090747
374 Ga0070681_10072256
375 Ga0068867_100177531
376 Ga0068853_100102599
377 Ga0070665_100019114
378 Ga0070665_100080824
379 Ga0070665_100535423
380 Ga0068856_100204381
381 Ga0068856_100367498
382 Ga0068852_100013221
383 Ga0068859_100043812
384 Ga0068863_100015702
385 Ga0068860_100033243
386 Ga0068862_100000095
387 Ga0070717_10212820
388 Ga0075365_10013350
389 Ga0075368_10012717
390 Ga0075363_100022164
391 Ga0075363_100072817
392 Ga0075363_100279010
393 Ga0075364_10011737
394 Ga0075364_10035980
395 Ga0070712_100016419
396 Ga0075367_10001654
397 Ga0075367_10006878
398 Ga0075367_10028003
399 Ga0075369_10059239
400 Ga0075370_10017439
401 Ga0097620_100043811
402 Ga0105240_10013649
403 Ga0105240_10091832
404 Ga0105247_10045086
405 Ga0105241_10028079
406 Ga0105241_10072471
407 Ga0105241_10125970
408 Ga0105241_10226598
409 Ga0105237_10051090
410 Ga0105237_10234825
411 Ga0105238_10016131
412 Ga0105238_10370028
413 Ga0105249_10000205
414 Ga0105239_10018236
415 Ga0105239_10141551
416 Ga0105239_10231085
417 Ga0105239_10234783
418 Ga0214544_1000007
419 Ga0214544_1031152
420 Ga0214542_1000007
421 Ga0214545_1000006
422 Ga0214543_1000009
423 Ga0213875_10000773
424 Ga0213875_10034430
425 Ga0209563_102505
426 Ga0207425_1009237
427 Ga0209677_109714
428 Ga0209148_1001992
429 Ga0209233_1020340
430 Ga0209455_1002997
431 Ga0209758_1000015
432 Ga0209758_1000161
433 Ga0209758_1000673
434 Ga0209758_1005308
435 Ga0209758_1030456
436 Ga0209758_1033359
437 Ga0209256_1002321
438 Ga0207426_1000577
439 Ga0207426_1001352
440 Ga0207426_1006097
441 Ga0209257_1000762
442 Ga0207710_10037545
443 Ga0207699_10025863
444 Ga0207654_10036563
445 Ga0207654_10154756
446 Ga0207707_10024129
447 Ga0207695_10000006
448 Ga0207695_10083586
449 Ga0207671_10281892
450 Ga0207693_10023695
451 Ga0207657_10053321
452 Ga0207657_10143749
453 Ga0207664_10159372
454 Ga0207712_10000030
455 Ga0207640_10231276
456 Ga0207639_10109394
457 Ga0207678_10023699
458 Ga0207678_10104394
459 Ga0207641_10032420
460 Ga0207674_10372413
461 Ga0207698_10118644
462 Ga0209813_10062460
463 Ga0268266_10000360
464 Ga0268266_10006634
465 Ga0268266_10038678
466 Ga0268265_10000132
467 Ga0268264_10000783
468 Ga0265338_10154209
469 Ga0307513_10020850
470 Ga0307509_10388534
471 Ga0307510_10006633
472 Ga0307510_10095572
473 Ga0395900_0001627
474 Ga0395898_0002504
475 Ga0395905_0518933
476 Ga0436364_0017273
477 Ga0436364_1200653
478 Ga0395901_0047905
479 Ga0436365_1800892
480 Ga0436363_1663439
481 Ga0451833_0522871
482 Ga0466969_0043941
483 Ga0466966_0001143
484 Ga0466961_0000018
485 Ga0466961_0075352
486 Ga0466963_0082034
487 Ga0466964_0088490
488 Ga0466959_0008322
489 Ga0466958_0197314
490 Ga0466967_0141086
491 Ga0495592_0115177
492 Ga0495603_0019604
493 Ga0495629_0076110
494 Ga0495638_0001594
495 Ga0495651_0014115
496 Ga0495651_0123017
497 Ga0495607_0176332
498 Ga0495608_0048258
499 Ga0495610_0011720
500 Ga0495616_0005512
501 Ga0495618_0043909
502 Ga0495631_0008714
503 Ga0495643_0023340
504 Ga0495648_0084493
505 Ga0495652_0054796
506 Ga0495654_0009799
507 Ga0495622_0024634
508 Ga0495668_0137920
509 Ga0495625_0016400
510 Ga0495635_0005707
511 Ga0495661_0009853
512 Ga0495657_0010355
513 Ga0495624_0033854
514 Ga0495600_0010346
515 Ga0495660_0073369
516 Ga0495604_0017908
517 Ga0495676_0058128
518 Ga0495686_0011184
519 Ga0495686_0032734
520 Ga0495686_0177303
521 Ga0495593_0031673
522 Ga0495602_0128988
523 Ga0496101_0273685
524 Ga0496102_0031358
525 Ga0496104_0084905
526 Ga0496105_0068749
527 Ga0496113_0010200
528 Ga0496114_0226116
529 Ga0496115_0030263
530 Ga0496116_0197993
531 Ga0496117_0031143
532 Ga0496117_0234704
533 Ga0496118_0025994
534 Ga0496118_0092143
535 Ga0496118_0191020
536 Ga0496119_0008698
537 Ga0496120_0010635
538 Ga0496120_0039310
539 Ga0496121_0019156
540 Ga0496121_0030597
541 Ga0496121_0399867
542 Ga0496123_0074326
543 Ga0496124_0020611
544 Ga0496124_0193130
545 Ga0496125_0006575
546 Ga0496125_0077651
547 Ga0496125_0083349
548 Ga0496126_0025012
549 Ga0496126_0174407
550 Ga0495682_0020272
551 Ga0501031_0000464
552 Ga0501031_0178489
553 Ga0501032_0040954
554 Ga0501032_0133386
555 Ga0501033_0001441
556 Ga0501033_0004576
557 Ga0501034_0002660
558 Ga0501036_0001020
559 Ga0501036_0194032
560 Ga0501036_0258117
561 Ga0501037_0000203
562 Ga0501038_0022151
563 Ga0501038_0063281
564 Ga0501038_0066021
565 Ga0501039_0000945
566 Ga0501039_0097867
567 Ga0501043_0016742
568 Ga0501043_0049631
569 Ga0501046_0090489
570 Ga0501047_0033807
571 Ga0501047_0037150
572 Ga0501047_0046964
573 Ga0501047_0100016
574 Ga0501048_0407156
575 Ga0501069_0085382
576 Ga0501069_0099248
577 Ga0501070_0001254
578 Ga0501070_0002591
579 Ga0501070_0024017
580 Ga0501071_0019645
581 Ga0501073_0021222
582 Ga0501074_0049046
583 Ga0501080_0030820
584 Ga0501083_0142722
585 Ga0501035_0000398
586 Ga0501035_0001283
587 Ga0501035_0001667
588 Ga0501044_0002456
589 Ga0501044_0002573
590 Ga0501044_0011278
591 Ga0501044_0084597
592 nmdc:mga03n38_18720_c1
593 nmdc:mga03n38_53653_c1
594 nmdc:mga00v17_2618_c1
595 nmdc:mga0yw44_103959_c1
596 nmdc:mga0yw44_2226_c1
597 nmdc:mga0k408_52769_c1
598 nmdc:mga06z11_19461_c1
599 nmdc:mga06z11_19831_c1
600 nmdc:mga06z11_92251_c1
601 nmdc:mga04h51_50768_c1
602 nmdc:mga07m45_8310_c1
603 nmdc:mga0sz30_33200_c1
604 Ga0495619_0022675
605 Ga0500644_0012673
606 Ga0500647_0059185
607 Ga0500651_0160487
608 Ga0500566_0001043
609 Ga0500566_0058313
610 Ga0500641_0000939
611 Ga0500650_0000499
612 Ga0500554_001433
613 Ga0500554_050556
614 Ga0500557_000165
615 Ga0500562_000689
616 Ga0500569_058067
617 Ga0500595_015161
618 Ga0500607_032613
619 Ga0500608_010470
620 Ga0500642_0000088
621 Ga0500652_000196
622 Ga0500658_0004137
623 Ga0500559_0000067
624 Ga0500559_0014734
625 Ga0500559_0035734
626 Ga0500568_0000268
627 Ga0500568_0001649
628 Ga0500573_0000214
629 Ga0500590_024907
630 Ga0500590_044852
631 Ga0500590_086600
632 Ga0500603_002492
633 Ga0500604_0000069
634 Ga0500604_0012474
635 Ga0500616_0000036
636 Ga0500620_000131
637 Ga0500627_0004098
638 Ga0500634_0024348
639 Ga0500638_125696
640 Ga0500638_125904
641 Ga0500636_0000440
642 Ga0500636_0014644
643 Ga0500636_0185757
644 Ga0500637_0093040
645 Ga0500649_061964
646 Ga0500570_058127
647 Ga0500611_014505
648 Ga0500611_019342
649 Ga0500601_000146
650 Ga0500661_006538
651 2508545981
652 2510315179
653 2511397382
654 2512960548
655 2514036362
656 2588518079
657 2643777022
658 2643795470
659 2793063603
660 2824606383
661 2824616201
662 2824619508
663 2824627963
664 2824635993
665 2824646255
666 2824658499
667 2824720553
668 2824727565
669 2824747629
670 2842044206
671 2842051805
672 2844316366
673 2849082365
674 2857529660
675 2881369773
676 2888394549
677 2888427126
678 2893066898
679 2903728299
680 2906606440
681 2908782865
682 2919451701
683 2935614291
684 2935826509
685 2935851197
686 2935913246
687 2935922668
688 2935930829
689 2935939837
690 2935946786
691 2935956013
692 2935972806
693 2941534479
694 3005510735
695 3005711926
696 3005719170
697 637079740
698 8001846508
699 8019693357
700 8056974042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06966

DUF1295

Protein of unknown function (DUF1295)

44

280

0.94

PF02544

Steroid_dh

3-oxo-5-alpha-steroid 4-dehydrogenase

141

236

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5251 7 260
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5183 5 261
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5127 7 260
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5011 5 261
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.4499 5 260
ID Description Score Start End Superfamily
af_C6TD75_105_305_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8621 63 261 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8552 62 261 1.20.120.1630
af_C6TD75_105_305_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8502 63 261 1.20.120.1630
af_O53731_51_249_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8474 60 264 1.20.120.1630
af_F1QW92_73_271_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8473 62 261 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A1T4ZVG0-F1-model_v4 Steroid 5-alpha reductase family enzyme 0.9781 5 266 GO:0016020
AF-A0A0N1FAS7-F1-model_v4 Uncharacterized protein 0.9771 17 265 GO:0016020
AF-A0A4Q3HVY5-F1-model_v4 deleted 0.9769 1 220
AF-A0A6I1JAD5-F1-model_v4 Uncharacterized protein 0.9746 5 264 GO:0016020
AF-A0A4Q3H130-F1-model_v4 DUF1295 domain-containing protein 0.9704 136 264 GO:0016020

Map