F418332

General Info

Members Datasets Scaffolds Average Seq Length
350 167 349 200

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_10388|Ga0400485_10388_7567_8256
Length 229
Sequence MRSHIVSFTEHQFKLTANALRLLEAKEEDFMSVLITKEAPDFTAPAVMPDGTIEEAFKLSDLKGRYVVLFFYPLDFTFVCPTEIIAHDRRVEEFKQRQVEVVGVSIDSQFTHHAWRNTDINDGGIGPVQFPLVADVNHQITQAYGIEHPAGIALRASFLIDREGVVQHQVVNNLPLGRNVDEMLRLVDALQYTEEHGEVCPAGWQKGDDGMTPTAKGVSDYLSAKSDKL

Samples

Sample ID Description Type Environment
1 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
87 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
88 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
98 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
101 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
102 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
103 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
104 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
105 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
106 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
107 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
116 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
160 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 69.14
Metatranscriptomes 30.57
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0.29
Rhizoplane 2.86
Rhizosphere 87.43
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006765J45826_105711 3300003161 Bacteria 701
2 rootH2_10216387 3300003320 Bacteria 2121
3 rootH1_10068586 3300003323 Bacteria 15418
4 Ga0007416J51690_1020935 3300003577 Bacteria 678
5 Ga0058859_11486287 3300004798 Unclassified 706
6 Ga0058863_11749218 3300004799 Bacteria 1426
7 Ga0058861_12054889 3300004800 Bacteria 1534
8 Ga0058862_10287046 3300004803 Bacteria 736
9 Ga0070670_100000054 3300005331 Bacteria 127396
10 Ga0070666_10007111 3300005335 Bacteria 6902
11 Ga0070660_100222795 3300005339 Unclassified 1533
12 Ga0070671_100000037 3300005355 Bacteria 95248
13 Ga0070659_100044039 3300005366 Bacteria 3492
14 Ga0070659_101012940 3300005366 Unclassified 729
15 Ga0070667_100000002 3300005367 Bacteria 504831
16 Ga0070663_100350351 3300005455 Bacteria 1195
17 Ga0070662_100011738 3300005457 Bacteria 5784
18 Ga0070685_10000014 3300005466 Bacteria 120530
19 Ga0070697_100127195 3300005536 Bacteria 2135
20 Ga0068853_100311556 3300005539 Bacteria 1457
21 Ga0068853_100490173 3300005539 Bacteria 1159
22 Ga0068853_100692919 3300005539 Bacteria 971
23 Ga0068853_100844484 3300005539 Bacteria 878
24 Ga0070665_100083984 3300005548 Bacteria 3189
25 Ga0068855_100054524 3300005563 Bacteria 4699
26 Ga0068855_100263496 3300005563 Bacteria 1919
27 Ga0068855_101266846 3300005563 Bacteria 764
28 Ga0068856_100553392 3300005614 Bacteria 1172
29 Ga0068859_100312761 3300005617 Bacteria 1664
30 Ga0068859_100414387 3300005617 Bacteria 1443
31 Ga0068864_100000002 3300005618 Bacteria 658857
32 Ga0068858_100020409 3300005842 Bacteria 6196
33 Ga0068858_100048969 3300005842 Bacteria 3914
34 Ga0068860_100003644 3300005843 Bacteria 15849
35 Ga0068862_100001634 3300005844 Bacteria 20402
36 Ga0075365_10043363 3300006038 Bacteria 2945
37 Ga0075370_10311887 3300006353 Bacteria 936
38 Ga0097620_100312778 3300006931 Bacteria 1664
39 Ga0097620_100414381 3300006931 Bacteria 1443
40 Ga0079104_1007462 3300006946 Bacteria 3961
41 Ga0105251_10134134 3300009011 Bacteria 1121
42 Ga0105250_10000366 3300009092 Bacteria 33900
43 Ga0105240_10707310 3300009093 Bacteria 1099
44 Ga0111539_10011868 3300009094 Bacteria 10921
45 Ga0111539_10069969 3300009094 Unclassified 4143
46 Ga0105247_10029681 3300009101 Bacteria 3315
47 Ga0105241_10943109 3300009174 Bacteria 804
48 Ga0105248_10078878 3300009177 Bacteria 3701
49 Ga0105239_10006575 3300010375 Bacteria 13464
50 Ga0105246_10183471 3300011119 Bacteria 1613
51 Ga0157373_10657254 3300013100 Bacteria 766
52 Ga0157370_10007849 3300013104 Bacteria 11565
53 Ga0157369_10749542 3300013105 Bacteria 1005
54 Ga0157374_10148358 3300013296 Unclassified 2279
55 Ga0157372_10576581 3300013307 Bacteria 1311
56 Ga0157375_11139869 3300013308 Bacteria 914
57 Ga0163163_10000687 3300014325 Bacteria 28756
58 Ga0182008_10020496 3300014497 Bacteria 3404
59 Ga0157376_10116552 3300014969 Bacteria 2360
60 Ga0206356_10861666 3300020070 Bacteria 667
61 Ga0206350_11281916 3300020080 Bacteria 1392
62 Ga0213872_10010730 3300021361 Bacteria 4352
63 Ga0209256_1018088 3300025299 Bacteria 2310
64 Ga0207696_1000138 3300025711 Bacteria 127572
65 Ga0207713_1000080 3300025735 Bacteria 168403
66 Ga0207710_10107903 3300025900 Bacteria 1320
67 Ga0207680_10020739 3300025903 Bacteria 3545
68 Ga0207654_10637256 3300025911 Bacteria 762
69 Ga0207650_10000002 3300025925 Bacteria 1439222
70 Ga0207644_10000114 3300025931 Bacteria 59996
71 Ga0207690_10092185 3300025932 Bacteria 2143
72 Ga0207706_10057230 3300025933 Bacteria 3436
73 Ga0207711_10000540 3300025941 Bacteria 38701
74 Ga0207667_10673351 3300025949 Bacteria 1039
75 Ga0207658_10000001 3300025986 Bacteria 1439333
76 Ga0207703_10015908 3300026035 Bacteria 5868
77 Ga0207639_10332124 3300026041 Bacteria 1353
78 Ga0207639_10628665 3300026041 Bacteria 992
79 Ga0207639_10694082 3300026041 Bacteria 944
80 Ga0207678_10085703 3300026067 Bacteria 2693
81 Ga0207641_10274328 3300026088 Bacteria 1583
82 Ga0207676_10000001 3300026095 Bacteria 1439222
83 Ga0207683_10487011 3300026121 Bacteria 1139
84 Ga0209974_10028776 3300027876 Bacteria 1840
85 Ga0207428_10074424 3300027907 Bacteria 2663
86 Ga0207428_10185163 3300027907 Unclassified 1571
87 Ga0268266_10006302 3300028379 Bacteria 10869
88 Ga0268265_10001809 3300028380 Bacteria 17100
89 Ga0268264_10000004 3300028381 Bacteria 1116842
90 Ga0265327_10001210 3300031251 Bacteria 34803
91 Ga0307408_100000249 3300031548 Bacteria 56039
92 Ga0307408_100001646 3300031548 Bacteria 16479
93 Ga0316575_10000158 3300031665 Bacteria 17085
94 Ga0316575_10008091 3300031665 Bacteria 3822
95 Ga0316575_10036253 3300031665 Bacteria 1939
96 Ga0316575_10069633 3300031665 Bacteria 1412
97 Ga0316575_10104981 3300031665 Bacteria 1150
98 Ga0316579_10011152 3300031691 Bacteria 3815
99 Ga0316579_10146898 3300031691 Bacteria 1137
100 Ga0316576_10015565 3300031727 Bacteria 5108
101 Ga0316576_10076833 3300031727 Bacteria 2471
102 Ga0316576_10084184 3300031727 Bacteria 2363
103 Ga0316576_10171309 3300031727 Bacteria 1638
104 Ga0316576_10258267 3300031727 Bacteria 1307
105 Ga0316576_10282213 3300031727 Bacteria 1243
106 Ga0316578_10000169 3300031728 Bacteria 17713
107 Ga0316578_10000642 3300031728 Bacteria 12377
108 Ga0316578_10022371 3300031728 Bacteria 3523
109 Ga0316578_10068499 3300031728 Bacteria 2098
110 Ga0316578_10269885 3300031728 Bacteria 1019
111 Ga0316577_10003912 3300031733 Bacteria 7602
112 Ga0316577_10004013 3300031733 Bacteria 7535
113 Ga0316577_10032116 3300031733 Bacteria 2933
114 Ga0316577_10036785 3300031733 Bacteria 2738
115 Ga0316577_10192263 3300031733 Bacteria 1153
116 Ga0316577_10434955 3300031733 Bacteria 745
117 Ga0307406_10007017 3300031901 Bacteria 6235
118 Ga0307406_10164375 3300031901 Bacteria 1599
119 Ga0316583_10000694 3300032133 Bacteria 10382
120 Ga0316583_10003212 3300032133 Bacteria 5749
121 Ga0316583_10013893 3300032133 Bacteria 2905
122 Ga0316583_10014972 3300032133 Bacteria 2791
123 Ga0316583_10029747 3300032133 Bacteria 1947
124 Ga0316583_10056282 3300032133 Bacteria 1382
125 Ga0316583_10088512 3300032133 Bacteria 1080
126 Ga0316585_10002594 3300032137 Bacteria 4890
127 Ga0316585_10006923 3300032137 Bacteria 3254
128 Ga0316585_10010488 3300032137 Bacteria 2719
129 Ga0316585_10034620 3300032137 Bacteria 1597
130 Ga0316585_10038554 3300032137 Bacteria 1519
131 Ga0316585_10120804 3300032137 Bacteria 862
132 Ga0316580_10001207 3300032139 Bacteria 6603
133 Ga0316580_10034632 3300032139 Bacteria 1562
134 Ga0316580_10072218 3300032139 Bacteria 1056
135 Ga0316593_10003738 3300032168 Bacteria 3822
136 Ga0316593_10017944 3300032168 Bacteria 2166
137 Ga0316593_10034453 3300032168 Bacteria 1661
138 Ga0316593_10036011 3300032168 Bacteria 1630
139 Ga0316593_10036151 3300032168 Bacteria 1627
140 Ga0316593_10040909 3300032168 Bacteria 1541
141 Ga0316593_10079259 3300032168 Bacteria 1144
142 Ga0316593_10092536 3300032168 Bacteria 1066
143 Ga0316593_10153477 3300032168 Bacteria 838
144 Ga0316593_10170156 3300032168 Bacteria 798
145 Ga0316593_10182700 3300032168 Bacteria 771
146 Ga0316593_10182715 3300032168 Bacteria 771
147 Ga0316593_10183093 3300032168 Bacteria 771
148 Ga0316593_10185516 3300032168 Bacteria 766
149 Ga0316593_10187854 3300032168 Bacteria 761
150 Ga0316593_10189202 3300032168 Bacteria 758
151 Ga0316593_10223453 3300032168 Bacteria 700
152 Ga0316593_10239661 3300032168 Bacteria 677
153 Ga0316593_10244667 3300032168 Bacteria 670
154 Ga0316593_10265980 3300032168 Bacteria 644
155 Ga0316592_1005394 3300033524 Bacteria 2426
156 Ga0316592_1019756 3300033524 Bacteria 1427
157 Ga0316592_1025755 3300033524 Bacteria 1268
158 Ga0316592_1029722 3300033524 Bacteria 1186
159 Ga0316592_1030791 3300033524 Bacteria 1167
160 Ga0316592_1063216 3300033524 Bacteria 832
161 Ga0316592_1067643 3300033524 Bacteria 806
162 Ga0316592_1072335 3300033524 Bacteria 780
163 Ga0316592_1091738 3300033524 Bacteria 695
164 Ga0316592_1104816 3300033524 Bacteria 652
165 Ga0316586_1016425 3300033527 Bacteria 1186
166 Ga0316586_1020214 3300033527 Bacteria 1093
167 Ga0316586_1022584 3300033527 Bacteria 1046
168 Ga0316586_1026882 3300033527 Bacteria 973
169 Ga0316586_1028044 3300033527 Bacteria 956
170 Ga0316586_1032356 3300033527 Bacteria 900
171 Ga0316586_1033195 3300033527 Bacteria 890
172 Ga0316586_1035330 3300033527 Bacteria 866
173 Ga0316586_1036362 3300033527 Bacteria 856
174 Ga0316586_1041615 3300033527 Bacteria 809
175 Ga0316586_1044005 3300033527 Bacteria 790
176 Ga0316588_1013017 3300033528 Bacteria 1799
177 Ga0316588_1025247 3300033528 Bacteria 1372
178 Ga0316588_1028955 3300033528 Bacteria 1294
179 Ga0316588_1029744 3300033528 Bacteria 1279
180 Ga0316588_1032944 3300033528 Bacteria 1221
181 Ga0316588_1037051 3300033528 Bacteria 1159
182 Ga0316588_1040516 3300033528 Bacteria 1113
183 Ga0316588_1047586 3300033528 Bacteria 1036
184 Ga0316588_1057837 3300033528 Bacteria 944
185 Ga0316588_1064851 3300033528 Bacteria 894
186 Ga0316588_1090269 3300033528 Bacteria 763
187 Ga0316588_1104088 3300033528 Bacteria 712
188 Ga0316588_1104459 3300033528 Bacteria 710
189 Ga0316588_1113783 3300033528 Bacteria 682
190 Ga0316587_1017464 3300033529 Bacteria 1202
191 Ga0316587_1019972 3300033529 Bacteria 1136
192 Ga0316587_1022193 3300033529 Bacteria 1087
193 Ga0316587_1026567 3300033529 Bacteria 1009
194 Ga0316587_1030010 3300033529 Bacteria 958
195 Ga0316587_1032448 3300033529 Bacteria 926
196 Ga0316587_1041025 3300033529 Unclassified 836
197 Ga0316587_1044648 3300033529 Bacteria 805
198 Ga0316587_1048310 3300033529 Bacteria 777
199 Ga0316587_1048639 3300033529 Bacteria 774
200 Ga0316587_1051148 3300033529 Bacteria 757
201 Ga0316587_1054376 3300033529 Bacteria 736
202 Ga0316587_1059248 3300033529 Bacteria 708
203 Ga0316587_1070147 3300033529 Bacteria 655
204 Ga0316596_1006806 3300033541 Bacteria 2674
205 Ga0316596_1016016 3300033541 Bacteria 1876
206 Ga0316596_1022294 3300033541 Bacteria 1618
207 Ga0316596_1024029 3300033541 Bacteria 1564
208 Ga0316596_1024341 3300033541 Bacteria 1555
209 Ga0316596_1028052 3300033541 Bacteria 1454
210 Ga0316596_1039798 3300033541 Bacteria 1234
211 Ga0316596_1050034 3300033541 Bacteria 1105
212 Ga0316596_1052470 3300033541 Bacteria 1081
213 Ga0316596_1056534 3300033541 Bacteria 1043
214 Ga0316596_1056547 3300033541 Bacteria 1043
215 Ga0316596_1060664 3300033541 Bacteria 1009
216 Ga0316596_1063927 3300033541 Bacteria 983
217 Ga0316596_1078463 3300033541 Bacteria 887
218 Ga0316596_1078866 3300033541 Bacteria 885
219 Ga0316596_1091051 3300033541 Bacteria 822
220 Ga0316596_1095741 3300033541 Bacteria 801
221 Ga0316596_1105827 3300033541 Unclassified 762
222 Ga0316596_1106622 3300033541 Bacteria 759
223 Ga0316596_1121434 3300033541 Bacteria 711
224 Ga0316596_1124675 3300033541 Bacteria 702
225 Ga0316596_1133702 3300033541 Bacteria 678
226 Ga0316574_0004346 3300035398 Bacteria 7405
227 Ga0316574_0028855 3300035398 Bacteria 3349
228 Ga0316574_0054684 3300035398 Bacteria 2493
229 Ga0316574_0135372 3300035398 Bacteria 1586
230 Ga0316574_0203742 3300035398 Bacteria 1270
231 Ga0316574_0214325 3300035398 Bacteria 1235
232 Ga0316574_0388323 3300035398 Bacteria 880
233 Ga0373935_0519569 3300035692 Unclassified 866
234 Ga0373927_0017732 3300035695 Bacteria 4684
235 Ga0316582_0007783 3300036647 Bacteria 5726
236 Ga0316582_0064263 3300036647 Bacteria 2360
237 Ga0316582_0268749 3300036647 Bacteria 1170
238 Ga0316582_0331584 3300036647 Bacteria 1046
239 Ga0316582_0651529 3300036647 Bacteria 724
240 Ga0316584_0001090 3300036712 Bacteria 15885
241 Ga0316584_0001589 3300036712 Bacteria 13795
242 Ga0316584_0008496 3300036712 Bacteria 7075
243 Ga0316584_0021595 3300036712 Bacteria 4681
244 Ga0316584_0064901 3300036712 Bacteria 2734
245 Ga0316584_0294133 3300036712 Bacteria 1177
246 Ga0316584_0822320 3300036712 Unclassified 630
247 Ga0395900_0140409 3300037418 Bacteria 2474
248 Ga0316581_0008931 3300037588 Unclassified 2742
249 Ga0400484_21458 3300038725 Bacteria 6442
250 Ga0400484_38013 3300038725 Bacteria 2598
251 Ga0400484_44737 3300038725 Bacteria 3223
252 Ga0400490_06663 3300038726 Bacteria 42094
253 Ga0400490_14128 3300038726 Bacteria 1213
254 Ga0400491_28268 3300038727 Bacteria 6828
255 Ga0400485_09016 3300038735 Bacteria 2262
256 Ga0400485_10388 3300038735 Bacteria 9671
257 Ga0400485_14999 3300038735 Bacteria 12334
258 Ga0400488_31421 3300038741 Bacteria 13433
259 Ga0400488_57649 3300038741 Bacteria 3322
260 Ga0400486_08492 3300038742 Bacteria 14004
261 Ga0400486_08727 3300038742 Bacteria 1775
262 Ga0400486_10354 3300038742 Bacteria 21885
263 Ga0400486_20766 3300038742 Bacteria 91783
264 Ga0400489_72819 3300039093 Bacteria 45511
265 Ga0400487_05468 3300039110 Bacteria 18445
266 Ga0400487_31141 3300039110 Bacteria 6380
267 Ga0400487_38817 3300039110 Bacteria 3156
268 Ga0400487_40435 3300039110 Bacteria 1395
269 Ga0439438_014637 3300041405 Bacteria 2330
270 Ga0451807_1858697 3300041486 Bacteria 1202
271 Ga0450891_003174 3300042129 Bacteria 1602
272 Ga0451577_0000009 3300042876 Bacteria 646744
273 Ga0451577_0118250 3300042876 Bacteria 2374
274 Ga0451576_0011513 3300045051 Bacteria 10042
275 Ga0495627_000215 3300046453 Bacteria 62761
276 Ga0495650_0018782 3300046471 Bacteria 3427
277 Ga0495631_0001498 3300046518 Bacteria 14088
278 Ga0495632_0004196 3300046519 Bacteria 9851
279 Ga0495654_0000423 3300046530 Bacteria 35841
280 Ga0495645_0234354 3300046543 Bacteria 1228
281 Ga0495671_0000049 3300046692 Bacteria 146041
282 Ga0495671_0024200 3300046692 Bacteria 3165
283 Ga0495672_0003804 3300047320 Bacteria 12705
284 Ga0495673_0004094 3300047469 Bacteria 9259
285 Ga0496107_0722072 3300048910 Unclassified 732
286 Ga0496108_0085984 3300048911 Bacteria 2670
287 Ga0496109_0157011 3300048912 Bacteria 2131
288 Ga0496110_0201436 3300048913 Unclassified 1809
289 Ga0496112_0352120 3300048915 Bacteria 1415
290 Ga0496113_0953385 3300048916 Unclassified 677
291 Ga0496114_0025896 3300048917 Bacteria 4798
292 Ga0496114_0199888 3300048917 Unclassified 1750
293 Ga0496114_0450636 3300048917 Bacteria 1140
294 Ga0496116_0000019 3300048919 Bacteria 533227
295 Ga0496121_0000018 3300048924 Bacteria 542045
296 Ga0496124_0374293 3300048927 Bacteria 998
297 Ga0496126_0096961 3300048929 Bacteria 2585
298 Ga0501316_021583 3300049532 Bacteria 815
299 Ga0501031_0002498 3300049568 Bacteria 11718
300 Ga0501032_0000936 3300049569 Bacteria 23616
301 Ga0501032_0010256 3300049569 Bacteria 6759
302 Ga0501032_0038720 3300049569 Bacteria 3245
303 Ga0501033_0005384 3300049570 Bacteria 10139
304 Ga0501033_0007175 3300049570 Bacteria 8695
305 Ga0501034_0003514 3300049571 Bacteria 17785
306 Ga0501034_0239771 3300049571 Bacteria 1760
307 Ga0501036_0000887 3300049572 Bacteria 22368
308 Ga0501036_0009776 3300049572 Bacteria 7898
309 Ga0501036_0010301 3300049572 Bacteria 7712
310 Ga0501036_0464079 3300049572 Bacteria 1054
311 Ga0501037_0002031 3300049573 Bacteria 14661
312 Ga0501038_0015765 3300049574 Bacteria 6868
313 Ga0501039_0006959 3300049575 Bacteria 8609
314 Ga0501039_0062540 3300049575 Bacteria 2884
315 Ga0501039_0809191 3300049575 Bacteria 731
316 Ga0501040_0000774 3300049576 Bacteria 19878
317 Ga0501042_0000850 3300049578 Bacteria 17035
318 Ga0501043_0001224 3300049579 Bacteria 22638
319 Ga0501043_0152138 3300049579 Bacteria 1810
320 Ga0501046_0006333 3300049580 Bacteria 10489
321 Ga0501047_0011672 3300049581 Bacteria 8305
322 Ga0501047_0078863 3300049581 Bacteria 3167
323 Ga0501047_0430769 3300049581 Bacteria 1150
324 Ga0501048_0001029 3300049582 Bacteria 20864
325 Ga0501067_0179588 3300049583 Bacteria 1179
326 Ga0501068_0295519 3300049584 Bacteria 1036
327 Ga0501070_0145128 3300049586 Bacteria 1959
328 Ga0501073_0536768 3300049589 Bacteria 808
329 Ga0501230_017907 3300049667 Bacteria 1204
330 Ga0501035_0000450 3300049822 Bacteria 46029
331 Ga0501035_0007138 3300049822 Bacteria 10446
332 Ga0501035_0223876 3300049822 Bacteria 1605
333 Ga0501035_0275340 3300049822 Bacteria 1423
334 Ga0501044_0000068 3300049823 Bacteria 126642
335 Ga0501044_0001278 3300049823 Bacteria 29733
336 Ga0501044_0013125 3300049823 Bacteria 8968
337 Ga0501044_0022715 3300049823 Bacteria 6679
338 Ga0501045_0008825 3300049824 Bacteria 7042
339 nmdc:mga07m45_197797_c1 3300050496 Bacteria 1169
340 nmdc:mga08y16_14116_c1 3300050511 Bacteria 8410
341 nmdc:mga08y16_89501_c1 3300050511 Bacteria 3208
342 Ga0500650_0000029 3300053098 Bacteria 54937
343 Ga0587070_100693 3300059491 Bacteria 664
344 Ga0587088_058014 3300059508 Bacteria 777
345 Ga0587095_014345 3300059514 Bacteria 708
346 Ga0587101_055615 3300059623 Bacteria 693
347 Ga0587117_035471 3300059627 Bacteria 772
348 Ga0587068_064990 3300059641 Bacteria 709
349 Ga0587118_10765 3300059657 Bacteria 700

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038741 Ga0400488_57649 Ga0400488_57649_1691_2239 181
2 3300039110 Ga0400487_40435 Ga0400487_40435_580_1128 181
3 3300032168 Ga0316593_10244667 Ga0316593_102446671 192
4 3300042876 Ga0451577_0000009 Ga0451577_0000009_509151_509744 194
5 iso_pu_bacteria 646564506 646814971 194
6 3300032168 Ga0316593_10189202 Ga0316593_101892021 195
7 3300033524 Ga0316592_1091738 Ga0316592_10917381 195
8 3300032168 Ga0316593_10040909 Ga0316593_100409091 196
9 3300032168 Ga0316593_10092536 Ga0316593_100925361 196
10 3300032168 Ga0316593_10185516 Ga0316593_101855161 196
11 3300032168 Ga0316593_10187854 Ga0316593_101878541 196
12 3300032168 Ga0316593_10223453 Ga0316593_102234531 196
13 3300033524 Ga0316592_1019756 Ga0316592_10197561 196
14 3300033524 Ga0316592_1025755 Ga0316592_10257551 196
15 3300033524 Ga0316592_1030791 Ga0316592_10307912 196
16 3300033524 Ga0316592_1063216 Ga0316592_10632162 196
17 3300033524 Ga0316592_1072335 Ga0316592_10723351 196
18 3300033527 Ga0316586_1026882 Ga0316586_10268821 196
19 3300033527 Ga0316586_1032356 Ga0316586_10323562 196
20 3300033527 Ga0316586_1035330 Ga0316586_10353301 196
21 3300033527 Ga0316586_1036362 Ga0316586_10363621 196
22 3300033527 Ga0316586_1041615 Ga0316586_10416151 196
23 3300033527 Ga0316586_1044005 Ga0316586_10440051 196
24 3300033528 Ga0316588_1013017 Ga0316588_10130171 196
25 3300033528 Ga0316588_1025247 Ga0316588_10252471 196
26 3300033528 Ga0316588_1028955 Ga0316588_10289551 196
27 3300033528 Ga0316588_1032944 Ga0316588_10329441 196
28 3300033528 Ga0316588_1037051 Ga0316588_10370511 196
29 3300033528 Ga0316588_1040516 Ga0316588_10405161 196
30 3300033528 Ga0316588_1047586 Ga0316588_10475862 196
31 3300033528 Ga0316588_1057837 Ga0316588_10578371 196
32 3300033528 Ga0316588_1064851 Ga0316588_10648512 196
33 3300033528 Ga0316588_1090269 Ga0316588_10902691 196
34 3300033528 Ga0316588_1104459 Ga0316588_11044591 196
35 3300033528 Ga0316588_1113783 Ga0316588_11137831 196
36 3300033529 Ga0316587_1017464 Ga0316587_10174641 196
37 3300033529 Ga0316587_1019972 Ga0316587_10199721 196
38 3300033529 Ga0316587_1022193 Ga0316587_10221931 196
39 3300033529 Ga0316587_1030010 Ga0316587_10300101 196
40 3300033529 Ga0316587_1032448 Ga0316587_10324481 196
41 3300033529 Ga0316587_1041025 Ga0316587_10410251 196
42 3300033529 Ga0316587_1044648 Ga0316587_10446481 196
43 3300033529 Ga0316587_1048310 Ga0316587_10483101 196
44 3300033529 Ga0316587_1048639 Ga0316587_10486391 196
45 3300033529 Ga0316587_1054376 Ga0316587_10543761 196
46 3300033529 Ga0316587_1070147 Ga0316587_10701471 196
47 3300033541 Ga0316596_1016016 Ga0316596_10160163 196
48 3300033541 Ga0316596_1024341 Ga0316596_10243413 196
49 3300033541 Ga0316596_1028052 Ga0316596_10280522 196
50 3300033541 Ga0316596_1039798 Ga0316596_10397981 196
51 3300033541 Ga0316596_1050034 Ga0316596_10500342 196
52 3300033541 Ga0316596_1056534 Ga0316596_10565342 196
53 3300033541 Ga0316596_1060664 Ga0316596_10606641 196
54 3300033541 Ga0316596_1063927 Ga0316596_10639271 196
55 3300033541 Ga0316596_1078463 Ga0316596_10784631 196
56 3300033541 Ga0316596_1105827 Ga0316596_11058271 196
57 3300033541 Ga0316596_1106622 Ga0316596_11066221 196
58 3300038726 Ga0400490_14128 Ga0400490_14128_43_636 197
59 3300038742 Ga0400486_08727 Ga0400486_08727_355_948 197
60 3300032168 Ga0316593_10153477 Ga0316593_101534771 198
61 3300032168 Ga0316593_10265980 Ga0316593_102659801 198
62 3300033541 Ga0316596_1095741 Ga0316596_10957411 198
63 3300033541 Ga0316596_1121434 Ga0316596_11214341 198
64 3300036712 Ga0316584_0822320 Ga0316584_0822320_21_617 198
65 3300009092 Ga0105250_10000366 Ga0105250_1000036631 199
66 3300021361 Ga0213872_10010730 Ga0213872_100107305 199
67 3300025711 Ga0207696_1000138 Ga0207696_100013851 199
68 3300025735 Ga0207713_1000080 Ga0207713_100008089 199
69 3300031665 Ga0316575_10000158 Ga0316575_1000015822 199
70 3300031665 Ga0316575_10036253 Ga0316575_100362532 199
71 3300031665 Ga0316575_10069633 Ga0316575_100696332 199
72 3300031665 Ga0316575_10104981 Ga0316575_101049811 199
73 3300031691 Ga0316579_10011152 Ga0316579_100111523 199
74 3300031691 Ga0316579_10146898 Ga0316579_101468981 199
75 3300031727 Ga0316576_10015565 Ga0316576_100155654 199
76 3300031727 Ga0316576_10076833 Ga0316576_100768332 199
77 3300031727 Ga0316576_10084184 Ga0316576_100841842 199
78 3300031727 Ga0316576_10171309 Ga0316576_101713092 199
79 3300031727 Ga0316576_10258267 Ga0316576_102582672 199
80 3300031727 Ga0316576_10282213 Ga0316576_102822131 199
81 3300031728 Ga0316578_10000169 Ga0316578_100001694 199
82 3300031728 Ga0316578_10000642 Ga0316578_100006423 199
83 3300031728 Ga0316578_10022371 Ga0316578_100223714 199
84 3300031728 Ga0316578_10068499 Ga0316578_100684992 199
85 3300031728 Ga0316578_10269885 Ga0316578_102698852 199
86 3300031733 Ga0316577_10003912 Ga0316577_100039122 199
87 3300031733 Ga0316577_10004013 Ga0316577_100040139 199
88 3300031733 Ga0316577_10032116 Ga0316577_100321162 199
89 3300031733 Ga0316577_10036785 Ga0316577_100367852 199
90 3300031733 Ga0316577_10192263 Ga0316577_101922631 199
91 3300031733 Ga0316577_10434955 Ga0316577_104349551 199
92 3300032133 Ga0316583_10000694 Ga0316583_100006948 199
93 3300032133 Ga0316583_10003212 Ga0316583_100032127 199
94 3300032133 Ga0316583_10013893 Ga0316583_100138934 199
95 3300032133 Ga0316583_10014972 Ga0316583_100149723 199
96 3300032133 Ga0316583_10029747 Ga0316583_100297473 199
97 3300032133 Ga0316583_10056282 Ga0316583_100562822 199
98 3300032133 Ga0316583_10088512 Ga0316583_100885122 199
99 3300032137 Ga0316585_10002594 Ga0316585_100025945 199
100 3300032137 Ga0316585_10006923 Ga0316585_100069233 199
101 3300032137 Ga0316585_10010488 Ga0316585_100104884 199
102 3300032137 Ga0316585_10034620 Ga0316585_100346202 199
103 3300032137 Ga0316585_10038554 Ga0316585_100385541 199
104 3300032137 Ga0316585_10120804 Ga0316585_101208041 199
105 3300032139 Ga0316580_10001207 Ga0316580_100012073 199
106 3300032139 Ga0316580_10034632 Ga0316580_100346322 199
107 3300032139 Ga0316580_10072218 Ga0316580_100722181 199
108 3300032168 Ga0316593_10003738 Ga0316593_100037383 199
109 3300032168 Ga0316593_10017944 Ga0316593_100179443 199
110 3300032168 Ga0316593_10034453 Ga0316593_100344531 199
111 3300032168 Ga0316593_10036011 Ga0316593_100360111 199
112 3300032168 Ga0316593_10036151 Ga0316593_100361511 199
113 3300032168 Ga0316593_10079259 Ga0316593_100792592 199
114 3300032168 Ga0316593_10170156 Ga0316593_101701561 199
115 3300032168 Ga0316593_10182700 Ga0316593_101827001 199
116 3300032168 Ga0316593_10182715 Ga0316593_101827151 199
117 3300032168 Ga0316593_10183093 Ga0316593_101830931 199
118 3300032168 Ga0316593_10239661 Ga0316593_102396611 199
119 3300033524 Ga0316592_1005394 Ga0316592_10053943 199
120 3300033524 Ga0316592_1029722 Ga0316592_10297222 199
121 3300033524 Ga0316592_1067643 Ga0316592_10676431 199
122 3300033527 Ga0316586_1016425 Ga0316586_10164252 199
123 3300033527 Ga0316586_1022584 Ga0316586_10225841 199
124 3300033528 Ga0316588_1029744 Ga0316588_10297442 199
125 3300033529 Ga0316587_1026567 Ga0316587_10265671 199
126 3300033529 Ga0316587_1051148 Ga0316587_10511481 199
127 3300033541 Ga0316596_1006806 Ga0316596_10068063 199
128 3300033541 Ga0316596_1022294 Ga0316596_10222941 199
129 3300033541 Ga0316596_1024029 Ga0316596_10240291 199
130 3300033541 Ga0316596_1052470 Ga0316596_10524702 199
131 3300033541 Ga0316596_1056547 Ga0316596_10565472 199
132 3300033541 Ga0316596_1091051 Ga0316596_10910511 199
133 3300033541 Ga0316596_1124675 Ga0316596_11246751 199
134 3300033541 Ga0316596_1133702 Ga0316596_11337021 199
135 3300035398 Ga0316574_0004346 Ga0316574_0004346_4284_4883 199
136 3300035398 Ga0316574_0028855 Ga0316574_0028855_1425_2024 199
137 3300035398 Ga0316574_0054684 Ga0316574_0054684_86_685 199
138 3300035398 Ga0316574_0135372 Ga0316574_0135372_168_767 199
139 3300035398 Ga0316574_0203742 Ga0316574_0203742_627_1226 199
140 3300035398 Ga0316574_0214325 Ga0316574_0214325_622_1224 199
141 3300035398 Ga0316574_0388323 Ga0316574_0388323_158_757 199
142 3300036647 Ga0316582_0007783 Ga0316582_0007783_4721_5353 199
143 3300036647 Ga0316582_0064263 Ga0316582_0064263_686_1285 199
144 3300036647 Ga0316582_0268749 Ga0316582_0268749_181_780 199
145 3300036647 Ga0316582_0331584 Ga0316582_0331584_206_805 199
146 3300036647 Ga0316582_0651529 Ga0316582_0651529_112_711 199
147 3300036712 Ga0316584_0001090 Ga0316584_0001090_3181_3783 199
148 3300036712 Ga0316584_0001589 Ga0316584_0001589_7026_7625 199
149 3300036712 Ga0316584_0008496 Ga0316584_0008496_6219_6818 199
150 3300036712 Ga0316584_0021595 Ga0316584_0021595_3855_4454 199
151 3300036712 Ga0316584_0064901 Ga0316584_0064901_1995_2594 199
152 3300036712 Ga0316584_0294133 Ga0316584_0294133_395_994 199
153 3300037588 Ga0316581_0008931 Ga0316581_0008931_1714_2316 199
154 3300038725 Ga0400484_21458 Ga0400484_21458_2277_2876 199
155 3300038725 Ga0400484_38013 Ga0400484_38013_634_1233 199
156 3300038726 Ga0400490_06663 Ga0400490_06663_24959_25558 199
157 3300038727 Ga0400491_28268 Ga0400491_28268_597_1196 199
158 3300038735 Ga0400485_09016 Ga0400485_09016_696_1295 199
159 3300038735 Ga0400485_10388 Ga0400485_10388_7567_8256 199
160 3300038735 Ga0400485_14999 Ga0400485_14999_8110_8709 199
161 3300038741 Ga0400488_31421 Ga0400488_31421_3650_4297 199
162 3300038742 Ga0400486_08492 Ga0400486_08492_8493_9092 199
163 3300038742 Ga0400486_10354 Ga0400486_10354_8670_9359 199
164 3300038742 Ga0400486_20766 Ga0400486_20766_32530_33129 199
165 3300039093 Ga0400489_72819 Ga0400489_72819_15867_16499 199
166 3300039110 Ga0400487_05468 Ga0400487_05468_14430_15029 199
167 3300039110 Ga0400487_31141 Ga0400487_31141_2165_2764 199
168 3300039110 Ga0400487_38817 Ga0400487_38817_620_1219 199
169 3300041405 Ga0439438_014637 Ga0439438_014637_1366_1965 199
170 3300042876 Ga0451577_0118250 Ga0451577_0118250_1618_2220 199
171 3300045051 Ga0451576_0011513 Ga0451576_0011513_5578_6180 199
172 3300046453 Ga0495627_000215 Ga0495627_000215_27682_28281 199
173 3300046471 Ga0495650_0018782 Ga0495650_0018782_2484_3083 199
174 3300046518 Ga0495631_0001498 Ga0495631_0001498_653_1252 199
175 3300046519 Ga0495632_0004196 Ga0495632_0004196_816_1415 199
176 3300046530 Ga0495654_0000423 Ga0495654_0000423_4491_5090 199
177 3300046543 Ga0495645_0234354 Ga0495645_0234354_525_1124 199
178 3300046692 Ga0495671_0000049 Ga0495671_0000049_96361_96960 199
179 3300046692 Ga0495671_0024200 Ga0495671_0024200_400_999 199
180 3300047320 Ga0495672_0003804 Ga0495672_0003804_8187_8786 199
181 3300047469 Ga0495673_0004094 Ga0495673_0004094_8370_8969 199
182 3300049586 Ga0501070_0145128 Ga0501070_0145128_294_968 199
183 3300049589 Ga0501073_0536768 Ga0501073_0536768_81_755 199
184 3300003161 Ga0006765J45826_105711 Ga0006765J45826_1057111 200
185 3300003320 rootH2_10216387 rootH2_102163874 200
186 3300003323 rootH1_10068586 rootH1_100685867 200
187 3300003577 Ga0007416J51690_1020935 Ga0007416J51690_10209351 200
188 3300004798 Ga0058859_11486287 Ga0058859_114862871 200
189 3300004799 Ga0058863_11749218 Ga0058863_117492182 200
190 3300004800 Ga0058861_12054889 Ga0058861_120548893 200
191 3300004803 Ga0058862_10287046 Ga0058862_102870461 200
192 3300005331 Ga0070670_100000054 Ga0070670_10000005480 200
193 3300005335 Ga0070666_10007111 Ga0070666_100071114 200
194 3300005339 Ga0070660_100222795 Ga0070660_1002227952 200
195 3300005355 Ga0070671_100000037 Ga0070671_10000003754 200
196 3300005366 Ga0070659_100044039 Ga0070659_1000440396 200
197 3300005366 Ga0070659_101012940 Ga0070659_1010129401 200
198 3300005367 Ga0070667_100000002 Ga0070667_100000002434 200
199 3300005455 Ga0070663_100350351 Ga0070663_1003503511 200
200 3300005457 Ga0070662_100011738 Ga0070662_1000117384 200
201 3300005466 Ga0070685_10000014 Ga0070685_1000001474 200
202 3300005536 Ga0070697_100127195 Ga0070697_1001271955 200
203 3300005539 Ga0068853_100311556 Ga0068853_1003115563 200
204 3300005539 Ga0068853_100490173 Ga0068853_1004901731 200
205 3300005539 Ga0068853_100692919 Ga0068853_1006929192 200
206 3300005539 Ga0068853_100844484 Ga0068853_1008444841 200
207 3300005548 Ga0070665_100083984 Ga0070665_1000839844 200
208 3300005563 Ga0068855_100054524 Ga0068855_1000545246 200
209 3300005563 Ga0068855_100263496 Ga0068855_1002634962 200
210 3300005563 Ga0068855_101266846 Ga0068855_1012668462 200
211 3300005614 Ga0068856_100553392 Ga0068856_1005533922 200
212 3300005617 Ga0068859_100312761 Ga0068859_1003127613 200
213 3300005617 Ga0068859_100414387 Ga0068859_1004143873 200
214 3300005618 Ga0068864_100000002 Ga0068864_10000000239 200
215 3300005842 Ga0068858_100020409 Ga0068858_1000204098 200
216 3300005842 Ga0068858_100048969 Ga0068858_1000489694 200
217 3300005843 Ga0068860_100003644 Ga0068860_1000036442 200
218 3300005844 Ga0068862_100001634 Ga0068862_10000163411 200
219 3300006038 Ga0075365_10043363 Ga0075365_100433632 200
220 3300006353 Ga0075370_10311887 Ga0075370_103118871 200
221 3300006931 Ga0097620_100312778 Ga0097620_1003127783 200
222 3300006931 Ga0097620_100414381 Ga0097620_1004143813 200
223 3300006946 Ga0079104_1007462 Ga0079104_10074624 200
224 3300009011 Ga0105251_10134134 Ga0105251_101341342 200
225 3300009093 Ga0105240_10707310 Ga0105240_107073102 200
226 3300009094 Ga0111539_10011868 Ga0111539_100118685 200
227 3300009094 Ga0111539_10069969 Ga0111539_100699693 200
228 3300009101 Ga0105247_10029681 Ga0105247_100296812 200
229 3300009174 Ga0105241_10943109 Ga0105241_109431092 200
230 3300009177 Ga0105248_10078878 Ga0105248_100788782 200
231 3300010375 Ga0105239_10006575 Ga0105239_100065757 200
232 3300011119 Ga0105246_10183471 Ga0105246_101834712 200
233 3300013100 Ga0157373_10657254 Ga0157373_106572541 200
234 3300013104 Ga0157370_10007849 Ga0157370_100078495 200
235 3300013105 Ga0157369_10749542 Ga0157369_107495421 200
236 3300013296 Ga0157374_10148358 Ga0157374_101483583 200
237 3300013307 Ga0157372_10576581 Ga0157372_105765811 200
238 3300013308 Ga0157375_11139869 Ga0157375_111398691 200
239 3300014325 Ga0163163_10000687 Ga0163163_100006872 200
240 3300014497 Ga0182008_10020496 Ga0182008_100204964 200
241 3300014969 Ga0157376_10116552 Ga0157376_101165523 200
242 3300020070 Ga0206356_10861666 Ga0206356_108616661 200
243 3300020080 Ga0206350_11281916 Ga0206350_112819161 200
244 3300025299 Ga0209256_1018088 Ga0209256_10180883 200
245 3300025900 Ga0207710_10107903 Ga0207710_101079032 200
246 3300025903 Ga0207680_10020739 Ga0207680_100207394 200
247 3300025911 Ga0207654_10637256 Ga0207654_106372561 200
248 3300025925 Ga0207650_10000002 Ga0207650_1000000239 200
249 3300025931 Ga0207644_10000114 Ga0207644_1000011442 200
250 3300025932 Ga0207690_10092185 Ga0207690_100921854 200
251 3300025933 Ga0207706_10057230 Ga0207706_100572302 200
252 3300025941 Ga0207711_10000540 Ga0207711_1000054011 200
253 3300025949 Ga0207667_10673351 Ga0207667_106733511 200
254 3300025986 Ga0207658_10000001 Ga0207658_100000011315 200
255 3300026035 Ga0207703_10015908 Ga0207703_100159085 200
256 3300026041 Ga0207639_10332124 Ga0207639_103321242 200
257 3300026041 Ga0207639_10628665 Ga0207639_106286652 200
258 3300026041 Ga0207639_10694082 Ga0207639_106940822 200
259 3300026067 Ga0207678_10085703 Ga0207678_100857034 200
260 3300026088 Ga0207641_10274328 Ga0207641_102743282 200
261 3300026095 Ga0207676_10000001 Ga0207676_1000000139 200
262 3300026121 Ga0207683_10487011 Ga0207683_104870112 200
263 3300027876 Ga0209974_10028776 Ga0209974_100287762 200
264 3300027907 Ga0207428_10074424 Ga0207428_100744242 200
265 3300027907 Ga0207428_10185163 Ga0207428_101851633 200
266 3300028379 Ga0268266_10006302 Ga0268266_100063024 200
267 3300028380 Ga0268265_10001809 Ga0268265_1000180910 200
268 3300028381 Ga0268264_10000004 Ga0268264_1000000436 200
269 3300031251 Ga0265327_10001210 Ga0265327_100012108 200
270 3300031548 Ga0307408_100000249 Ga0307408_10000024933 200
271 3300031548 Ga0307408_100001646 Ga0307408_10000164612 200
272 3300031665 Ga0316575_10008091 Ga0316575_100080914 200
273 3300031901 Ga0307406_10007017 Ga0307406_100070174 200
274 3300031901 Ga0307406_10164375 Ga0307406_101643753 200
275 3300033524 Ga0316592_1104816 Ga0316592_11048161 200
276 3300033527 Ga0316586_1020214 Ga0316586_10202141 200
277 3300033527 Ga0316586_1028044 Ga0316586_10280442 200
278 3300033527 Ga0316586_1033195 Ga0316586_10331951 200
279 3300033528 Ga0316588_1104088 Ga0316588_11040881 200
280 3300033529 Ga0316587_1059248 Ga0316587_10592481 200
281 3300033541 Ga0316596_1078866 Ga0316596_10788661 200
282 3300035692 Ga0373935_0519569 Ga0373935_0519569_77_682 200
283 3300035695 Ga0373927_0017732 Ga0373927_0017732_3337_3942 200
284 3300037418 Ga0395900_0140409 Ga0395900_0140409_861_1463 200
285 3300038725 Ga0400484_44737 Ga0400484_44737_2466_3077 200
286 3300041486 Ga0451807_1858697 Ga0451807_1858697_574_1176 200
287 3300042129 Ga0450891_003174 Ga0450891_003174_718_1320 200
288 3300048910 Ga0496107_0722072 Ga0496107_0722072_23_625 200
289 3300048911 Ga0496108_0085984 Ga0496108_0085984_1066_1668 200
290 3300048912 Ga0496109_0157011 Ga0496109_0157011_717_1319 200
291 3300048913 Ga0496110_0201436 Ga0496110_0201436_1155_1757 200
292 3300048915 Ga0496112_0352120 Ga0496112_0352120_406_1008 200
293 3300048916 Ga0496113_0953385 Ga0496113_0953385_47_649 200
294 3300048917 Ga0496114_0025896 Ga0496114_0025896_4062_4664 200
295 3300048917 Ga0496114_0199888 Ga0496114_0199888_181_783 200
296 3300048917 Ga0496114_0450636 Ga0496114_0450636_231_935 200
297 3300048919 Ga0496116_0000019 Ga0496116_0000019_153245_153850 200
298 3300048924 Ga0496121_0000018 Ga0496121_0000018_385986_386591 200
299 3300048927 Ga0496124_0374293 Ga0496124_0374293_185_790 200
300 3300048929 Ga0496126_0096961 Ga0496126_0096961_1598_2203 200
301 3300049532 Ga0501316_021583 Ga0501316_021583_119_721 200
302 3300049568 Ga0501031_0002498 Ga0501031_0002498_5658_6260 200
303 3300049569 Ga0501032_0000936 Ga0501032_0000936_9364_9966 200
304 3300049569 Ga0501032_0010256 Ga0501032_0010256_4694_5296 200
305 3300049569 Ga0501032_0038720 Ga0501032_0038720_1745_2347 200
306 3300049570 Ga0501033_0005384 Ga0501033_0005384_5628_6230 200
307 3300049570 Ga0501033_0007175 Ga0501033_0007175_409_1011 200
308 3300049571 Ga0501034_0003514 Ga0501034_0003514_12592_13194 200
309 3300049571 Ga0501034_0239771 Ga0501034_0239771_289_891 200
310 3300049572 Ga0501036_0000887 Ga0501036_0000887_3946_4548 200
311 3300049572 Ga0501036_0009776 Ga0501036_0009776_4674_5276 200
312 3300049572 Ga0501036_0010301 Ga0501036_0010301_3528_4130 200
313 3300049572 Ga0501036_0464079 Ga0501036_0464079_276_878 200
314 3300049573 Ga0501037_0002031 Ga0501037_0002031_2028_2630 200
315 3300049574 Ga0501038_0015765 Ga0501038_0015765_476_1078 200
316 3300049575 Ga0501039_0006959 Ga0501039_0006959_1813_2415 200
317 3300049575 Ga0501039_0062540 Ga0501039_0062540_1373_1975 200
318 3300049575 Ga0501039_0809191 Ga0501039_0809191_93_704 200
319 3300049576 Ga0501040_0000774 Ga0501040_0000774_15566_16168 200
320 3300049578 Ga0501042_0000850 Ga0501042_0000850_8610_9212 200
321 3300049579 Ga0501043_0001224 Ga0501043_0001224_12032_12634 200
322 3300049579 Ga0501043_0152138 Ga0501043_0152138_934_1536 200
323 3300049580 Ga0501046_0006333 Ga0501046_0006333_3866_4468 200
324 3300049581 Ga0501047_0011672 Ga0501047_0011672_7513_8115 200
325 3300049581 Ga0501047_0078863 Ga0501047_0078863_2396_2998 200
326 3300049581 Ga0501047_0430769 Ga0501047_0430769_129_740 200
327 3300049582 Ga0501048_0001029 Ga0501048_0001029_12229_12831 200
328 3300049583 Ga0501067_0179588 Ga0501067_0179588_43_645 200
329 3300049584 Ga0501068_0295519 Ga0501068_0295519_162_764 200
330 3300049667 Ga0501230_017907 Ga0501230_017907_365_967 200
331 3300049822 Ga0501035_0000450 Ga0501035_0000450_29195_29797 200
332 3300049822 Ga0501035_0007138 Ga0501035_0007138_4252_4854 200
333 3300049822 Ga0501035_0223876 Ga0501035_0223876_178_780 200
334 3300049822 Ga0501035_0275340 Ga0501035_0275340_165_767 200
335 3300049823 Ga0501044_0000068 Ga0501044_0000068_96513_97115 200
336 3300049823 Ga0501044_0001278 Ga0501044_0001278_16920_17522 200
337 3300049823 Ga0501044_0013125 Ga0501044_0013125_5465_6067 200
338 3300049823 Ga0501044_0022715 Ga0501044_0022715_1486_2088 200
339 3300049824 Ga0501045_0008825 Ga0501045_0008825_1206_1808 200
340 3300050496 nmdc:mga07m45_197797_c1 nmdc:mga07m45_197797_c1_523_1128 200
341 3300050511 nmdc:mga08y16_14116_c1 nmdc:mga08y16_14116_c1_7350_7952 200
342 3300050511 nmdc:mga08y16_89501_c1 nmdc:mga08y16_89501_c1_211_813 200
343 3300053098 Ga0500650_0000029 Ga0500650_0000029_37912_38517 200
344 3300059491 Ga0587070_100693 Ga0587070_100693_45_650 200
345 3300059508 Ga0587088_058014 Ga0587088_058014_14_619 200
346 3300059514 Ga0587095_014345 Ga0587095_014345_86_691 200
347 3300059623 Ga0587101_055615 Ga0587101_055615_78_683 200
348 3300059627 Ga0587117_035471 Ga0587117_035471_54_659 200
349 3300059641 Ga0587068_064990 Ga0587068_064990_94_699 200
350 3300059657 Ga0587118_10765 Ga0587118_10765_79_684 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

189

224

0.96

PF00578

AhpC-TSA

AhpC/TSA family

35

169

0.95

PF08534

Redoxin

Redoxin

35

185

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tue-assembly1.cif.gz_A the structure of tryparedoxin peroxidase i from leishmania major 0.9587 5 167
6j13-assembly2.cif.gz_H redox protein from chlamydomonas reinhardtii 0.9581 2 167
1e2y-assembly1.cif.gz_F tryparedoxin peroxidase from crithidia fasciculata 0.9549 5 163
7e4u-assembly4.cif.gz_H crystal structure of peroxiredoxin-1 0.9538 5 173
2c0d-assembly1.cif.gz_A structure of the mitochondrial 2-cys peroxiredoxin from plasmodium falciparum 0.9527 4 172
ID Description Score Start End Superfamily
2c0dA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9527 4 172 3.40.30.10
5ijtA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9483 5 164 3.40.30.10
2c0dA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9472 4 172 3.40.30.10
af_Q8I5Q6_15_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9421 1 200 3.40.30.10
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.933 2 195 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6N6X8E0-F1-model_v4 deleted 0.9795 2 168
AF-A0A0N1DAZ8-F1-model_v4 Alkyl hydroperoxide reductase 0.9783 1 200 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A0R2ZTX2-F1-model_v4 Alkyl hydroperoxide reductase 0.978 1 200 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1F3B131-F1-model_v4 Alkyl hydroperoxide reductase 0.9778 2 157 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A7T7X180-F1-model_v4 deleted 0.9775 1 200

Feature Viewer

pLDDT pTM Quality
91.62 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map