F418268

General Info

Members Datasets Scaffolds Average Seq Length
350 174 700 225

Family's Representative Sequence

Representative Sequence 3300025925|Ga0207650_10583059|Ga0207650_105830592
Length 248
Sequence MAASPVGMKRFYGLLAAVAVIGIGLLGYQLSKPATVSIPANVQIGVKDTAGFHGYVKGDANAPVEITEYADYQCPFCQTFATLQMPTIEERLIRTGRLRWRYRDFPLQQHPFSRVAAHSAACADDQGKYWDQHQKIYDGQAEWAAARDAAPIFRQYAQADGLDLAKYDACMSGGVHAGRIQASYEEGVRVGVQSTPTLLIGGRLLHAYGVSQSPPIMRYRVYGMWLTFTSLGLAALVCLALSTLFLAV

Samples

Sample ID Description Type Environment
1 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
90 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
91 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
95 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
96 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
100 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
103 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
146 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
147 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
150 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
151 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
152 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
153 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
158 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
159 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.29
Rhizosphere 85.14
Stem 0
Stem Tuber 0
Unclassified 13.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207650_10583059 3300025925 Bacteria 939
2 MBSR1b_contig_8174435 2162886012 Bacteria 1333
3 rootL2_10084260 3300003322 Bacteria 2120
4 rootL2_10164352 3300003322 Bacteria 4423
5 Ga0065715_10322030 3300005293 Unclassified 1000
6 Ga0068869_100477202 3300005334 Bacteria 1038
7 Ga0070691_10092759 3300005341 Bacteria 1491
8 Ga0070691_10297281 3300005341 Bacteria 881
9 Ga0070668_100182963 3300005347 Bacteria 1713
10 Ga0070659_100047565 3300005366 Bacteria 3365
11 Ga0070659_100364145 3300005366 Bacteria 1215
12 Ga0070711_100014365 3300005439 Bacteria 4990
13 Ga0070705_100007321 3300005440 Bacteria 5431
14 Ga0070705_100151487 3300005440 Bacteria 1539
15 Ga0070700_100318887 3300005441 Bacteria 1141
16 Ga0070694_100029727 3300005444 Bacteria 3568
17 Ga0070694_100288634 3300005444 Bacteria 1253
18 Ga0070708_100001609 3300005445 Bacteria 17323
19 Ga0070708_100203581 3300005445 Bacteria 1853
20 Ga0070708_100616227 3300005445 Bacteria 1023
21 Ga0070662_100182981 3300005457 Bacteria 1653
22 Ga0070681_10010871 3300005458 Bacteria 8996
23 Ga0070681_10434567 3300005458 Bacteria 1225
24 Ga0070681_10556182 3300005458 Bacteria 1061
25 Ga0070706_100001152 3300005467 Bacteria 28450
26 Ga0070706_100089767 3300005467 Bacteria 2850
27 Ga0070707_100000281 3300005468 Bacteria 50088
28 Ga0070707_100447992 3300005468 Unclassified 1252
29 Ga0070707_100602526 3300005468 Unclassified 1061
30 Ga0070699_100001115 3300005518 Bacteria 25014
31 Ga0070699_100004735 3300005518 Bacteria 12027
32 Ga0070679_100485905 3300005530 Bacteria 1179
33 Ga0070697_100010131 3300005536 Bacteria 7354
34 Ga0070697_100205411 3300005536 Bacteria 1675
35 Ga0070697_100405833 3300005536 Bacteria 1183
36 Ga0068853_100456030 3300005539 Bacteria 1203
37 Ga0070695_100331683 3300005545 Bacteria 1134
38 Ga0070696_100000578 3300005546 Bacteria 23368
39 Ga0070696_100010046 3300005546 Bacteria 6333
40 Ga0070693_100068416 3300005547 Bacteria 2084
41 Ga0070704_100001630 3300005549 Bacteria 12162
42 Ga0070704_100081306 3300005549 Bacteria 2386
43 Ga0070664_100525485 3300005564 Bacteria 1092
44 Ga0068857_100262085 3300005577 Bacteria 1587
45 Ga0068854_100149674 3300005578 Unclassified 1799
46 Ga0068856_101039107 3300005614 Bacteria 837
47 Ga0070702_100053096 3300005615 Bacteria 2327
48 Ga0070702_100067868 3300005615 Bacteria 2097
49 Ga0068859_101530637 3300005617 Unclassified 736
50 Ga0068851_10339722 3300005834 Bacteria 871
51 Ga0081455_10006999 3300005937 Bacteria 11983
52 Ga0081538_10069787 3300005981 Bacteria 1944
53 Ga0070712_100110485 3300006175 Unclassified 2050
54 Ga0070712_100359243 3300006175 Bacteria 1194
55 Ga0075430_100079734 3300006846 Bacteria 2743
56 Ga0075430_100106415 3300006846 Bacteria 2340
57 Ga0075431_100007055 3300006847 Bacteria 11158
58 Ga0075433_10032059 3300006852 Bacteria 4498
59 Ga0075433_10054051 3300006852 Bacteria 3503
60 Ga0075434_100004228 3300006871 Bacteria 12870
61 Ga0075434_100073649 3300006871 Bacteria 3408
62 Ga0075434_100274509 3300006871 Bacteria 1705
63 Ga0075429_100025541 3300006880 Bacteria 5127
64 Ga0075436_100202707 3300006914 Bacteria 1405
65 Ga0097620_101530875 3300006931 Unclassified 736
66 Ga0111539_10604928 3300009094 Bacteria 1277
67 Ga0114129_10000646 3300009147 Bacteria 43522
68 Ga0114129_10088565 3300009147 Bacteria 4291
69 Ga0114129_10182128 3300009147 Bacteria 2858
70 Ga0114129_10261176 3300009147 Bacteria 2321
71 Ga0114129_10500889 3300009147 Bacteria 1586
72 Ga0114129_10659136 3300009147 Unclassified 1350
73 Ga0114129_10911255 3300009147 Bacteria 1113
74 Ga0105248_10388692 3300009177 Bacteria 1571
75 Ga0105237_10314858 3300009545 Unclassified 1568
76 Ga0105249_10130224 3300009553 Bacteria 2401
77 Ga0105239_10006189 3300010375 Bacteria 13926
78 Ga0105246_10212427 3300011119 Bacteria 1511
79 Ga0157374_11132989 3300013296 Bacteria 803
80 Ga0157378_11262625 3300013297 Bacteria 779
81 Ga0157380_10144826 3300014326 Unclassified 2046
82 Ga0182008_10238446 3300014497 Bacteria 935
83 Ga0207684_10004647 3300025910 Bacteria 12892
84 Ga0207684_10102711 3300025910 Bacteria 2445
85 Ga0207684_10814187 3300025910 Bacteria 789
86 Ga0207707_10045465 3300025912 Bacteria 3826
87 Ga0207707_10067195 3300025912 Bacteria 3123
88 Ga0207693_10049474 3300025915 Bacteria 3301
89 Ga0207649_10434908 3300025920 Bacteria 988
90 Ga0207652_10015029 3300025921 Bacteria 6278
91 Ga0207646_10004289 3300025922 Bacteria 15560
92 Ga0207646_10058526 3300025922 Bacteria 3442
93 Ga0207646_10165442 3300025922 Bacteria 1997
94 Ga0207687_10188976 3300025927 Bacteria 1601
95 Ga0207690_10242227 3300025932 Unclassified 1389
96 Ga0207690_10316819 3300025932 Bacteria 1225
97 Ga0207706_10075828 3300025933 Bacteria 2958
98 Ga0207706_10171343 3300025933 Bacteria 1907
99 Ga0207686_10509924 3300025934 Bacteria 935
100 Ga0207661_10467112 3300025944 Bacteria 1151
101 Ga0207679_10069495 3300025945 Bacteria 2650
102 Ga0207668_10417889 3300025972 Bacteria 1138
103 Ga0207708_10101086 3300026075 Archaea 2232
104 Ga0207708_10426999 3300026075 Bacteria 1100
105 Ga0207702_10910090 3300026078 Bacteria 872
106 Ga0207641_10039610 3300026088 Bacteria 3942
107 Ga0207648_10918918 3300026089 Unclassified 818
108 Ga0207676_10009558 3300026095 Bacteria 6904
109 Ga0207674_10379430 3300026116 Bacteria 1367
110 Ga0207683_10312316 3300026121 Bacteria 1439
111 Ga0209998_10047066 3300027717 Bacteria 991
112 Ga0209974_10025488 3300027876 Bacteria 1956
113 Ga0207428_10178916 3300027907 Bacteria 1603
114 Ga0307408_100024740 3300031548 Bacteria 4104
115 Ga0307408_100053512 3300031548 Bacteria 2915
116 Ga0307408_100073308 3300031548 Bacteria 2537
117 Ga0307405_10027768 3300031731 Bacteria 3287
118 Ga0307405_10031244 3300031731 Bacteria 3133
119 Ga0307405_10329018 3300031731 Unclassified 1170
120 Ga0307405_10371431 3300031731 Unclassified 1110
121 Ga0307413_10004487 3300031824 Bacteria 6080
122 Ga0307413_10009291 3300031824 Bacteria 4698
123 Ga0307413_10021899 3300031824 Bacteria 3432
124 Ga0307413_10026638 3300031824 Bacteria 3189
125 Ga0307413_10049720 3300031824 Bacteria 2514
126 Ga0307413_10063616 3300031824 Bacteria 2288
127 Ga0307413_10078320 3300031824 Unclassified 2108
128 Ga0307413_10351189 3300031824 Unclassified 1138
129 Ga0307410_10001421 3300031852 Bacteria 10773
130 Ga0307410_10013290 3300031852 Bacteria 4798
131 Ga0307410_10021912 3300031852 Bacteria 3939
132 Ga0307410_10027668 3300031852 Bacteria 3586
133 Ga0307410_10073192 3300031852 Bacteria 2382
134 Ga0307410_10096840 3300031852 Bacteria 2107
135 Ga0307410_10451225 3300031852 Unclassified 1049
136 Ga0307410_10595929 3300031852 Unclassified 921
137 Ga0307406_10025209 3300031901 Bacteria 3559
138 Ga0307406_10062737 3300031901 Unclassified 2405
139 Ga0307406_10152387 3300031901 Unclassified 1651
140 Ga0307406_10258917 3300031901 Bacteria 1315
141 Ga0307406_10453358 3300031901 Bacteria 1029
142 Ga0307407_10015225 3300031903 Bacteria 3793
143 Ga0307407_10024538 3300031903 Bacteria 3164
144 Ga0307412_10072644 3300031911 Bacteria 2352
145 Ga0307412_10074629 3300031911 Bacteria 2324
146 Ga0307409_100004650 3300031995 Bacteria 7756
147 Ga0307409_100058064 3300031995 Bacteria 3002
148 Ga0307409_100119825 3300031995 Bacteria 2226
149 Ga0307409_100171514 3300031995 Bacteria 1910
150 Ga0307409_100173367 3300031995 Bacteria 1901
151 Ga0307409_100220517 3300031995 Bacteria 1712
152 Ga0307409_100255206 3300031995 Bacteria 1605
153 Ga0307409_100262341 3300031995 Unclassified 1586
154 Ga0307416_100004439 3300032002 Bacteria 8456
155 Ga0307416_100005912 3300032002 Bacteria 7596
156 Ga0307416_100007825 3300032002 Bacteria 6832
157 Ga0307416_100015759 3300032002 Bacteria 5230
158 Ga0307416_100025794 3300032002 Bacteria 4317
159 Ga0307416_100044638 3300032002 Bacteria 3482
160 Ga0307416_100126257 3300032002 Bacteria 2292
161 Ga0307416_100466808 3300032002 Unclassified 1319
162 Ga0307416_100498792 3300032002 Unclassified 1281
163 Ga0307414_10022549 3300032004 Bacteria 3975
164 Ga0307414_10023515 3300032004 Bacteria 3910
165 Ga0307414_10035807 3300032004 Bacteria 3307
166 Ga0307414_10065054 3300032004 Unclassified 2600
167 Ga0307414_10157653 3300032004 Bacteria 1799
168 Ga0307414_10464365 3300032004 Unclassified 1113
169 Ga0307414_10688334 3300032004 Unclassified 925
170 Ga0307411_10005651 3300032005 Bacteria 6170
171 Ga0307411_10043368 3300032005 Bacteria 2877
172 Ga0307411_10079978 3300032005 Bacteria 2246
173 Ga0307415_100003520 3300032126 Bacteria 7986
174 Ga0307415_100005227 3300032126 Bacteria 6865
175 Ga0307415_100051029 3300032126 Bacteria 2805
176 Ga0307415_100079757 3300032126 Unclassified 2333
177 Ga0373938_0058724 3300034957 Unclassified 895
178 Ga0373929_0017851 3300035085 Bacteria 1405
179 Ga0373940_0006120 3300035088 Bacteria 2648
180 Ga0373940_0047316 3300035088 Bacteria 1199
181 Ga0373951_0026459 3300035091 Bacteria 1352
182 Ga0373932_0024694 3300035112 Bacteria 1620
183 Ga0373939_0086656 3300035114 Bacteria 1051
184 Ga0373960_0007828 3300035121 Bacteria 2542
185 Ga0373931_0129694 3300035691 Bacteria 1450
186 Ga0373925_0448196 3300037068 Unclassified 1057
187 Ga0395905_0081445 3300037471 Bacteria 3034
188 Ga0395905_0106490 3300037471 Bacteria 2633
189 Ga0395905_0369628 3300037471 Bacteria 1327
190 Ga0242420_023214 3300038996 Bacteria 1119
191 Ga0439455_0042794 3300042012 Bacteria 1164
192 Ga0439446_0082477 3300042156 Bacteria 997
193 Ga0439458_0015938 3300042157 Unclassified 1707
194 Ga0439435_0009195 3300042436 Bacteria 2313
195 Ga0439435_0103138 3300042436 Bacteria 879
196 Ga0453683_0024707 3300044673 Bacteria 3821
197 Ga0453683_0038089 3300044673 Bacteria 3024
198 Ga0466964_0036697 3300044706 Bacteria 1967
199 Ga0453684_0644022 3300044712 Bacteria 1157
200 Ga0466967_0827960 3300045976 Bacteria 919
201 Ga0495580_0044407 3300046472 Bacteria 3161
202 Ga0496100_0053068 3300048903 Bacteria 2639
203 Ga0496100_0216112 3300048903 Bacteria 1405
204 Ga0496101_0051495 3300048904 Bacteria 2967
205 Ga0496101_0154297 3300048904 Bacteria 1758
206 Ga0496102_0003209 3300048905 Bacteria 13871
207 Ga0496102_0183896 3300048905 Bacteria 1969
208 Ga0496102_0199806 3300048905 Bacteria 1884
209 Ga0496102_0389975 3300048905 Bacteria 1310
210 Ga0496102_0936044 3300048905 Bacteria 788
211 Ga0496103_0054506 3300048906 Bacteria 2478
212 Ga0496104_0017692 3300048907 Bacteria 6497
213 Ga0496104_0040471 3300048907 Bacteria 4368
214 Ga0496104_0151464 3300048907 Unclassified 2226
215 Ga0496104_0184571 3300048907 Bacteria 1996
216 Ga0496105_0062259 3300048908 Bacteria 3079
217 Ga0496106_0045699 3300048909 Bacteria 3290
218 Ga0496106_0116920 3300048909 Bacteria 2080
219 Ga0496107_0192362 3300048910 Bacteria 1516
220 Ga0496107_0413033 3300048910 Bacteria 1004
221 Ga0496107_0469292 3300048910 Unclassified 934
222 Ga0496107_0531512 3300048910 Bacteria 872
223 Ga0496107_0580375 3300048910 Unclassified 829
224 Ga0496108_0008066 3300048911 Bacteria 8544
225 Ga0496108_0038935 3300048911 Bacteria 3962
226 Ga0496108_0050523 3300048911 Bacteria 3480
227 Ga0496108_0125399 3300048911 Bacteria 2204
228 Ga0496108_0234084 3300048911 Bacteria 1597
229 Ga0496109_0003801 3300048912 Bacteria 12599
230 Ga0496109_0011717 3300048912 Bacteria 7543
231 Ga0496109_0015661 3300048912 Bacteria 6614
232 Ga0496109_0022447 3300048912 Bacteria 5589
233 Ga0496110_0003328 3300048913 Bacteria 12280
234 Ga0496110_0022202 3300048913 Bacteria 5386
235 Ga0496110_0053106 3300048913 Bacteria 3562
236 Ga0496110_0061037 3300048913 Bacteria 3326
237 Ga0496111_0010557 3300048914 Bacteria 6203
238 Ga0496111_0012699 3300048914 Bacteria 5710
239 Ga0496111_0057181 3300048914 Bacteria 2824
240 Ga0496111_0096516 3300048914 Bacteria 2169
241 Ga0496112_0018597 3300048915 Bacteria 6546
242 Ga0496112_0070512 3300048915 Bacteria 3454
243 Ga0496112_0129742 3300048915 Bacteria 2492
244 Ga0496112_0568971 3300048915 Bacteria 1066
245 Ga0496113_0005261 3300048916 Bacteria 8058
246 Ga0496113_0094112 3300048916 Bacteria 2314
247 Ga0496114_0060620 3300048917 Bacteria 3163
248 Ga0496114_0194927 3300048917 Bacteria 1773
249 Ga0496114_0204166 3300048917 Unclassified 1732
250 Ga0496115_0139066 3300048918 Bacteria 2003
251 Ga0496115_0720132 3300048918 Unclassified 783
252 Ga0501295_013026 3300049518 Bacteria 1371
253 Ga0501031_0118367 3300049568 Bacteria 1731
254 Ga0501033_0159004 3300049570 Bacteria 1627
255 Ga0501036_0172519 3300049572 Bacteria 1822
256 Ga0501036_0393474 3300049572 Bacteria 1156
257 Ga0501037_0279392 3300049573 Bacteria 1164
258 Ga0501038_0010210 3300049574 Bacteria 8593
259 Ga0501039_0167502 3300049575 Bacteria 1727
260 Ga0501039_0181169 3300049575 Bacteria 1657
261 Ga0501040_0080875 3300049576 Bacteria 2251
262 Ga0501040_0082340 3300049576 Bacteria 2231
263 Ga0501040_0144699 3300049576 Bacteria 1675
264 Ga0501041_0082844 3300049577 Bacteria 1977
265 Ga0501042_0047259 3300049578 Bacteria 3069
266 Ga0501042_0141375 3300049578 Bacteria 1736
267 Ga0501042_0322334 3300049578 Bacteria 1116
268 Ga0501046_0086411 3300049580 Bacteria 2418
269 Ga0501046_0117114 3300049580 Bacteria 2030
270 Ga0501046_0243880 3300049580 Bacteria 1324
271 Ga0501048_0163502 3300049582 Bacteria 1576
272 Ga0501048_0240238 3300049582 Bacteria 1285
273 Ga0501067_0024025 3300049583 Bacteria 3380
274 Ga0501067_0139400 3300049583 Unclassified 1350
275 Ga0501067_0392074 3300049583 Unclassified 774
276 Ga0501068_0058727 3300049584 Bacteria 2335
277 Ga0501068_0090624 3300049584 Bacteria 1886
278 Ga0501068_0213767 3300049584 Bacteria 1225
279 Ga0501069_0055094 3300049585 Unclassified 2215
280 Ga0501069_0098955 3300049585 Unclassified 1655
281 Ga0501069_0134101 3300049585 Bacteria 1419
282 Ga0501069_0173375 3300049585 Bacteria 1245
283 Ga0501072_0041067 3300049588 Bacteria 3633
284 Ga0501072_0151452 3300049588 Bacteria 1849
285 Ga0501072_0163593 3300049588 Bacteria 1775
286 Ga0501072_0208121 3300049588 Unclassified 1559
287 Ga0501074_0085609 3300049590 Bacteria 2259
288 Ga0501074_0295787 3300049590 Bacteria 1150
289 Ga0501075_0018035 3300049591 Bacteria 5102
290 Ga0501075_0067949 3300049591 Bacteria 2692
291 Ga0501076_0099624 3300049592 Bacteria 2341
292 Ga0501076_0154903 3300049592 Bacteria 1865
293 Ga0501077_0017742 3300049593 Bacteria 4496
294 Ga0501077_0071365 3300049593 Bacteria 2201
295 Ga0501209_116635 3300049656 Bacteria 790
296 Ga0501217_014123 3300049661 Bacteria 1800
297 Ga0501233_009060 3300049668 Bacteria 1935
298 Ga0501235_005721 3300049669 Bacteria 2704
299 Ga0501235_065438 3300049669 Unclassified 855
300 Ga0501247_013385 3300049677 Bacteria 1008
301 Ga0501249_015551 3300049679 Bacteria 1628
302 Ga0501257_050648 3300049686 Unclassified 1035
303 Ga0501229_003032 3300049706 Bacteria 1997
304 Ga0501079_0027259 3300049741 Bacteria 4380
305 Ga0501079_0069955 3300049741 Bacteria 2709
306 Ga0501079_0086663 3300049741 Bacteria 2424
307 Ga0501079_0150983 3300049741 Unclassified 1811
308 Ga0501080_0061473 3300049742 Bacteria 3497
309 Ga0501080_0171688 3300049742 Unclassified 2000
310 Ga0501081_0022691 3300049743 Bacteria 4201
311 Ga0501081_0044993 3300049743 Bacteria 3031
312 Ga0501081_0241337 3300049743 Bacteria 1318
313 Ga0501083_0173985 3300049744 Bacteria 1407
314 Ga0501267_014243 3300049764 Bacteria 833
315 Ga0501271_010429 3300049768 Unclassified 981
316 Ga0501272_005144 3300049769 Bacteria 1371
317 Ga0501045_0058490 3300049824 Bacteria 2823
318 Ga0501045_0085226 3300049824 Bacteria 2331
319 Ga0501045_0234094 3300049824 Bacteria 1367
320 Ga0501045_0636151 3300049824 Bacteria 789
321 nmdc:mga05p37_122333_c1 3300050507 Bacteria 3196
322 nmdc:mga05p37_12680_c1 3300050507 Bacteria 10070
323 nmdc:mga09592_19677_c1 3300050508 Bacteria 5544
324 nmdc:mga0qj67_142820_c1 3300050509 Unclassified 1941
325 nmdc:mga06r32_10243_c1 3300050510 Bacteria 8458
326 nmdc:mga08y16_46040_c1 3300050511 Bacteria 4568
327 nmdc:mga0n895_185974_c1 3300050512 Bacteria 2108
328 nmdc:mga0n895_45349_c1 3300050512 Bacteria 4290
329 nmdc:mga0n895_58213_c1 3300050512 Bacteria 3809
330 nmdc:mga0n895_60197_c1 3300050512 Bacteria 3747
331 nmdc:mga0n895_851963_c1 3300050512 Bacteria 899
332 nmdc:mga0rr50_153695_c1 3300050513 Bacteria 1862
333 nmdc:mga0rr50_229646_c1 3300050513 Bacteria 1535
334 nmdc:mga08x19_126870_c1 3300050514 Bacteria 1714
335 nmdc:mga08x19_172777_c1 3300050514 Bacteria 1472
336 nmdc:mga0a205_18174_c2 3300050515 Bacteria 5687
337 nmdc:mga0a205_245048_c1 3300050515 Unclassified 1673
338 nmdc:mga0a205_62792_c1 3300050515 Bacteria 3589
339 Ga0501084_0028070 3300054114 Bacteria 4703
340 Ga0501084_0124727 3300054114 Bacteria 2167
341 Ga0501084_0366389 3300054114 Bacteria 1217
342 Ga0590071_000666 3300059421 Bacteria 9718
343 Ga0590075_011415 3300059424 Bacteria 2147
344 Ga0501082_0083464 3300060353 Bacteria 2756
345 Ga0501082_0175686 3300060353 Bacteria 1862
346 Ga0530510_0106871 3300061734 Bacteria 2048
347 Ga0530510_0147487 3300061734 Bacteria 1736
348 Ga0530510_0171310 3300061734 Bacteria 1608
349 Ga0530510_0274167 3300061734 Unclassified 1259
350 Ga0530510_0393343 3300061734 Bacteria 1044
351 Ga0207650_10583059
352 MBSR1b_contig_8174435
353 rootL2_10084260
354 rootL2_10164352
355 Ga0065715_10322030
356 Ga0068869_100477202
357 Ga0070691_10092759
358 Ga0070691_10297281
359 Ga0070668_100182963
360 Ga0070659_100047565
361 Ga0070659_100364145
362 Ga0070711_100014365
363 Ga0070705_100007321
364 Ga0070705_100151487
365 Ga0070700_100318887
366 Ga0070694_100029727
367 Ga0070694_100288634
368 Ga0070708_100001609
369 Ga0070708_100203581
370 Ga0070708_100616227
371 Ga0070662_100182981
372 Ga0070681_10010871
373 Ga0070681_10434567
374 Ga0070681_10556182
375 Ga0070706_100001152
376 Ga0070706_100089767
377 Ga0070707_100000281
378 Ga0070707_100447992
379 Ga0070707_100602526
380 Ga0070699_100001115
381 Ga0070699_100004735
382 Ga0070679_100485905
383 Ga0070697_100010131
384 Ga0070697_100205411
385 Ga0070697_100405833
386 Ga0068853_100456030
387 Ga0070695_100331683
388 Ga0070696_100000578
389 Ga0070696_100010046
390 Ga0070693_100068416
391 Ga0070704_100001630
392 Ga0070704_100081306
393 Ga0070664_100525485
394 Ga0068857_100262085
395 Ga0068854_100149674
396 Ga0068856_101039107
397 Ga0070702_100053096
398 Ga0070702_100067868
399 Ga0068859_101530637
400 Ga0068851_10339722
401 Ga0081455_10006999
402 Ga0081538_10069787
403 Ga0070712_100110485
404 Ga0070712_100359243
405 Ga0075430_100079734
406 Ga0075430_100106415
407 Ga0075431_100007055
408 Ga0075433_10032059
409 Ga0075433_10054051
410 Ga0075434_100004228
411 Ga0075434_100073649
412 Ga0075434_100274509
413 Ga0075429_100025541
414 Ga0075436_100202707
415 Ga0097620_101530875
416 Ga0111539_10604928
417 Ga0114129_10000646
418 Ga0114129_10088565
419 Ga0114129_10182128
420 Ga0114129_10261176
421 Ga0114129_10500889
422 Ga0114129_10659136
423 Ga0114129_10911255
424 Ga0105248_10388692
425 Ga0105237_10314858
426 Ga0105249_10130224
427 Ga0105239_10006189
428 Ga0105246_10212427
429 Ga0157374_11132989
430 Ga0157378_11262625
431 Ga0157380_10144826
432 Ga0182008_10238446
433 Ga0207684_10004647
434 Ga0207684_10102711
435 Ga0207684_10814187
436 Ga0207707_10045465
437 Ga0207707_10067195
438 Ga0207693_10049474
439 Ga0207649_10434908
440 Ga0207652_10015029
441 Ga0207646_10004289
442 Ga0207646_10058526
443 Ga0207646_10165442
444 Ga0207687_10188976
445 Ga0207690_10242227
446 Ga0207690_10316819
447 Ga0207706_10075828
448 Ga0207706_10171343
449 Ga0207686_10509924
450 Ga0207661_10467112
451 Ga0207679_10069495
452 Ga0207668_10417889
453 Ga0207708_10101086
454 Ga0207708_10426999
455 Ga0207702_10910090
456 Ga0207641_10039610
457 Ga0207648_10918918
458 Ga0207676_10009558
459 Ga0207674_10379430
460 Ga0207683_10312316
461 Ga0209998_10047066
462 Ga0209974_10025488
463 Ga0207428_10178916
464 Ga0307408_100024740
465 Ga0307408_100053512
466 Ga0307408_100073308
467 Ga0307405_10027768
468 Ga0307405_10031244
469 Ga0307405_10329018
470 Ga0307405_10371431
471 Ga0307413_10004487
472 Ga0307413_10009291
473 Ga0307413_10021899
474 Ga0307413_10026638
475 Ga0307413_10049720
476 Ga0307413_10063616
477 Ga0307413_10078320
478 Ga0307413_10351189
479 Ga0307410_10001421
480 Ga0307410_10013290
481 Ga0307410_10021912
482 Ga0307410_10027668
483 Ga0307410_10073192
484 Ga0307410_10096840
485 Ga0307410_10451225
486 Ga0307410_10595929
487 Ga0307406_10025209
488 Ga0307406_10062737
489 Ga0307406_10152387
490 Ga0307406_10258917
491 Ga0307406_10453358
492 Ga0307407_10015225
493 Ga0307407_10024538
494 Ga0307412_10072644
495 Ga0307412_10074629
496 Ga0307409_100004650
497 Ga0307409_100058064
498 Ga0307409_100119825
499 Ga0307409_100171514
500 Ga0307409_100173367
501 Ga0307409_100220517
502 Ga0307409_100255206
503 Ga0307409_100262341
504 Ga0307416_100004439
505 Ga0307416_100005912
506 Ga0307416_100007825
507 Ga0307416_100015759
508 Ga0307416_100025794
509 Ga0307416_100044638
510 Ga0307416_100126257
511 Ga0307416_100466808
512 Ga0307416_100498792
513 Ga0307414_10022549
514 Ga0307414_10023515
515 Ga0307414_10035807
516 Ga0307414_10065054
517 Ga0307414_10157653
518 Ga0307414_10464365
519 Ga0307414_10688334
520 Ga0307411_10005651
521 Ga0307411_10043368
522 Ga0307411_10079978
523 Ga0307415_100003520
524 Ga0307415_100005227
525 Ga0307415_100051029
526 Ga0307415_100079757
527 Ga0373938_0058724
528 Ga0373929_0017851
529 Ga0373940_0006120
530 Ga0373940_0047316
531 Ga0373951_0026459
532 Ga0373932_0024694
533 Ga0373939_0086656
534 Ga0373960_0007828
535 Ga0373931_0129694
536 Ga0373925_0448196
537 Ga0395905_0081445
538 Ga0395905_0106490
539 Ga0395905_0369628
540 Ga0242420_023214
541 Ga0439455_0042794
542 Ga0439446_0082477
543 Ga0439458_0015938
544 Ga0439435_0009195
545 Ga0439435_0103138
546 Ga0453683_0024707
547 Ga0453683_0038089
548 Ga0466964_0036697
549 Ga0453684_0644022
550 Ga0466967_0827960
551 Ga0495580_0044407
552 Ga0496100_0053068
553 Ga0496100_0216112
554 Ga0496101_0051495
555 Ga0496101_0154297
556 Ga0496102_0003209
557 Ga0496102_0183896
558 Ga0496102_0199806
559 Ga0496102_0389975
560 Ga0496102_0936044
561 Ga0496103_0054506
562 Ga0496104_0017692
563 Ga0496104_0040471
564 Ga0496104_0151464
565 Ga0496104_0184571
566 Ga0496105_0062259
567 Ga0496106_0045699
568 Ga0496106_0116920
569 Ga0496107_0192362
570 Ga0496107_0413033
571 Ga0496107_0469292
572 Ga0496107_0531512
573 Ga0496107_0580375
574 Ga0496108_0008066
575 Ga0496108_0038935
576 Ga0496108_0050523
577 Ga0496108_0125399
578 Ga0496108_0234084
579 Ga0496109_0003801
580 Ga0496109_0011717
581 Ga0496109_0015661
582 Ga0496109_0022447
583 Ga0496110_0003328
584 Ga0496110_0022202
585 Ga0496110_0053106
586 Ga0496110_0061037
587 Ga0496111_0010557
588 Ga0496111_0012699
589 Ga0496111_0057181
590 Ga0496111_0096516
591 Ga0496112_0018597
592 Ga0496112_0070512
593 Ga0496112_0129742
594 Ga0496112_0568971
595 Ga0496113_0005261
596 Ga0496113_0094112
597 Ga0496114_0060620
598 Ga0496114_0194927
599 Ga0496114_0204166
600 Ga0496115_0139066
601 Ga0496115_0720132
602 Ga0501295_013026
603 Ga0501031_0118367
604 Ga0501033_0159004
605 Ga0501036_0172519
606 Ga0501036_0393474
607 Ga0501037_0279392
608 Ga0501038_0010210
609 Ga0501039_0167502
610 Ga0501039_0181169
611 Ga0501040_0080875
612 Ga0501040_0082340
613 Ga0501040_0144699
614 Ga0501041_0082844
615 Ga0501042_0047259
616 Ga0501042_0141375
617 Ga0501042_0322334
618 Ga0501046_0086411
619 Ga0501046_0117114
620 Ga0501046_0243880
621 Ga0501048_0163502
622 Ga0501048_0240238
623 Ga0501067_0024025
624 Ga0501067_0139400
625 Ga0501067_0392074
626 Ga0501068_0058727
627 Ga0501068_0090624
628 Ga0501068_0213767
629 Ga0501069_0055094
630 Ga0501069_0098955
631 Ga0501069_0134101
632 Ga0501069_0173375
633 Ga0501072_0041067
634 Ga0501072_0151452
635 Ga0501072_0163593
636 Ga0501072_0208121
637 Ga0501074_0085609
638 Ga0501074_0295787
639 Ga0501075_0018035
640 Ga0501075_0067949
641 Ga0501076_0099624
642 Ga0501076_0154903
643 Ga0501077_0017742
644 Ga0501077_0071365
645 Ga0501209_116635
646 Ga0501217_014123
647 Ga0501233_009060
648 Ga0501235_005721
649 Ga0501235_065438
650 Ga0501247_013385
651 Ga0501249_015551
652 Ga0501257_050648
653 Ga0501229_003032
654 Ga0501079_0027259
655 Ga0501079_0069955
656 Ga0501079_0086663
657 Ga0501079_0150983
658 Ga0501080_0061473
659 Ga0501080_0171688
660 Ga0501081_0022691
661 Ga0501081_0044993
662 Ga0501081_0241337
663 Ga0501083_0173985
664 Ga0501267_014243
665 Ga0501271_010429
666 Ga0501272_005144
667 Ga0501045_0058490
668 Ga0501045_0085226
669 Ga0501045_0234094
670 Ga0501045_0636151
671 nmdc:mga05p37_122333_c1
672 nmdc:mga05p37_12680_c1
673 nmdc:mga09592_19677_c1
674 nmdc:mga0qj67_142820_c1
675 nmdc:mga06r32_10243_c1
676 nmdc:mga08y16_46040_c1
677 nmdc:mga0n895_185974_c1
678 nmdc:mga0n895_45349_c1
679 nmdc:mga0n895_58213_c1
680 nmdc:mga0n895_60197_c1
681 nmdc:mga0n895_851963_c1
682 nmdc:mga0rr50_153695_c1
683 nmdc:mga0rr50_229646_c1
684 nmdc:mga08x19_126870_c1
685 nmdc:mga08x19_172777_c1
686 nmdc:mga0a205_18174_c2
687 nmdc:mga0a205_245048_c1
688 nmdc:mga0a205_62792_c1
689 Ga0501084_0028070
690 Ga0501084_0124727
691 Ga0501084_0366389
692 Ga0590071_000666
693 Ga0590075_011415
694 Ga0501082_0083464
695 Ga0501082_0175686
696 Ga0530510_0106871
697 Ga0530510_0147487
698 Ga0530510_0171310
699 Ga0530510_0274167
700 Ga0530510_0393343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13462

Thioredoxin_4

Thioredoxin

52

212

0.91

PF01323

DSBA

DSBA-like thioredoxin domain

65

217

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f4s-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 t172v 0.8766 49 214
3f4t-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 c97a/c146a 0.8729 49 214
3f4r-assembly1.cif.gz_A crystal structure of wolbachia pipientis alpha-dsba1 0.8723 49 214
5kbc-assembly1.cif.gz_B crystal structure of chlamydia trachomatis dsba 0.8328 49 214
3eu4-assembly1.cif.gz_A crystal structure of bdbd from bacillus subtilis (oxidised) 0.8318 32 213
ID Description Score Start End Superfamily
3gykA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8418 48 213 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8317 32 213 3.40.30.10
5xwhA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8141 57 213 3.40.30.10
4xvwC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8137 49 214 3.40.30.10
3eu4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8108 32 213 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W1ENJ5-F1-model_v4 Thioredoxin domain-containing protein 0.9749 47 214
AF-A0A2V7MHB3-F1-model_v4 Thioredoxin-like fold domain-containing protein 0.9736 63 213
AF-A0A2V7RTQ0-F1-model_v4 Thioredoxin domain-containing protein 0.9716 49 214
AF-A0A2G9LVD1-F1-model_v4 Thioredoxin domain-containing protein 0.968 46 214 GO:0016020
AF-A0A842WB47-F1-model_v4 Thioredoxin domain-containing protein 0.9666 46 213 GO:0016020

Map