F418144

General Info

Members Datasets Scaffolds Average Seq Length
350 208 700 274

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100010174|Ga0070669_1000101745
Length 300
Sequence LERRCHEDRADGEELSEFVGRAAVVVGGSRGIGLAVAELLASLGAGVVVNGRDEAAVDDAVARLGNGAVGFAGSPAEPGVADALIESCTTEFGRIDILINCAGTPEPAGSSIFNVTSDQFRALLDAHLLTTFETCRAAVPKLMAQGGGAIVNTSSFAFLGDYGGTGYPAGKGGVNGLTMAIAAELREYDVRANVVCPGAKTRLSTGPDYEAQIAGLNRRGLLDDVNAQGALDAPPPEYVAPTYAYLVSDRAKDVTGQILAAAGGFVGRFKRQQPKILAYRDHQDAPPWSLDELEGFISAE

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
194 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 2547132424 Nocardia nova SH22a Isolate Unclassified
199 2643221692 Nocardia sp. Root136 Isolate Unclassified
200 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
201 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
202 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
203 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
204 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
205 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
206 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
207 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
208 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.86
Nodule 0.29
Rhizoplane 12.57
Rhizosphere 58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100010174 3300005353 Bacteria 6686
2 rootH2_10142052 3300003320 Bacteria 2970
3 Ga0055540_1004517 3300003792 Bacteria 6228
4 Ga0055540_1007298 3300003792 Bacteria 4207
5 Ga0070676_10028764 3300005328 Bacteria 3157
6 Ga0070683_100030790 3300005329 Bacteria 4876
7 Ga0070671_100011045 3300005355 Bacteria 7248
8 Ga0070674_100032121 3300005356 Bacteria 3484
9 Ga0070667_100000487 3300005367 Bacteria 40279
10 Ga0070667_100053649 3300005367 Bacteria 3402
11 Ga0070667_100165656 3300005367 Bacteria 1949
12 Ga0070667_100208343 3300005367 Bacteria 1737
13 Ga0070714_100119460 3300005435 Bacteria 2343
14 Ga0070713_100083990 3300005436 Bacteria 2723
15 Ga0070710_10004326 3300005437 Bacteria 6732
16 Ga0070701_10004360 3300005438 Bacteria 5719
17 Ga0070711_100004082 3300005439 Bacteria 8584
18 Ga0070700_100008969 3300005441 Bacteria 5474
19 Ga0070694_100078685 3300005444 Bacteria 2287
20 Ga0070663_100013609 3300005455 Bacteria 5193
21 Ga0070663_100022532 3300005455 Bacteria 4213
22 Ga0070678_100047572 3300005456 Bacteria 3083
23 Ga0070662_100011547 3300005457 Bacteria 5828
24 Ga0070684_100045047 3300005535 Bacteria 3819
25 Ga0070684_100074816 3300005535 Bacteria 2986
26 Ga0068853_100010233 3300005539 Bacteria 7584
27 Ga0070695_100320635 3300005545 Bacteria 1152
28 Ga0070696_100009787 3300005546 Bacteria 6414
29 Ga0070665_100022607 3300005548 Bacteria 6331
30 Ga0070704_100004952 3300005549 Bacteria 7732
31 Ga0068855_100154390 3300005563 Bacteria 2609
32 Ga0068855_100230530 3300005563 Bacteria 2074
33 Ga0068854_100053485 3300005578 Bacteria 2900
34 Ga0068856_100310603 3300005614 Bacteria 1594
35 Ga0070702_100071801 3300005615 Bacteria 2047
36 Ga0068852_100139366 3300005616 Bacteria 2243
37 Ga0068852_100210339 3300005616 Bacteria 1845
38 Ga0068859_100718323 3300005617 Bacteria 1089
39 Ga0068866_10083023 3300005718 Bacteria 1725
40 Ga0068861_100041304 3300005719 Bacteria 3454
41 Ga0068863_100003638 3300005841 Bacteria 15225
42 Ga0068858_100034565 3300005842 Bacteria 4689
43 Ga0068860_100000079 3300005843 Bacteria 170752
44 Ga0068860_100027939 3300005843 Bacteria 5432
45 Ga0068860_100181521 3300005843 Bacteria 2034
46 Ga0068862_100000093 3300005844 Bacteria 106838
47 Ga0075365_10003427 3300006038 Bacteria 8160
48 Ga0075365_10003451 3300006038 Bacteria 8143
49 Ga0075365_10010213 3300006038 Bacteria 5455
50 Ga0075365_10039436 3300006038 Bacteria 3075
51 Ga0075365_10081199 3300006038 Bacteria 2196
52 Ga0075363_100001104 3300006048 Bacteria 9788
53 Ga0075363_100001134 3300006048 Bacteria 9723
54 Ga0075363_100004049 3300006048 Bacteria 6341
55 Ga0075363_100005539 3300006048 Bacteria 5630
56 Ga0075363_100018394 3300006048 Bacteria 3482
57 Ga0075364_10004527 3300006051 Bacteria 8008
58 Ga0075364_10006554 3300006051 Bacteria 6848
59 Ga0075364_10008023 3300006051 Bacteria 6296
60 Ga0075364_10015077 3300006051 Bacteria 4786
61 Ga0075364_10019928 3300006051 Bacteria 4214
62 Ga0070716_100052495 3300006173 Bacteria 2321
63 Ga0070716_100057842 3300006173 Bacteria 2229
64 Ga0070712_100008217 3300006175 Bacteria 6555
65 Ga0075367_10004991 3300006178 Bacteria 6545
66 Ga0075367_10013422 3300006178 Bacteria 4403
67 Ga0075369_10000029 3300006186 Bacteria 39213
68 Ga0075369_10009294 3300006186 Bacteria 3814
69 Ga0075370_10007651 3300006353 Bacteria 5514
70 Ga0075370_10011527 3300006353 Bacteria 4649
71 Ga0075370_10054066 3300006353 Bacteria 2279
72 Ga0068871_100143174 3300006358 Bacteria 2034
73 Ga0097620_100718317 3300006931 Bacteria 1089
74 Ga0099795_10042762 3300007788 Bacteria 1619
75 Ga0105245_10259065 3300009098 Bacteria 1692
76 Ga0105247_10000044 3300009101 Bacteria 153728
77 Ga0105243_10011436 3300009148 Bacteria 6716
78 Ga0105241_10163507 3300009174 Bacteria 1832
79 Ga0105242_10007318 3300009176 Bacteria 8500
80 Ga0105248_10000060 3300009177 Bacteria 131634
81 Ga0105248_10028232 3300009177 Bacteria 6250
82 Ga0105248_10096565 3300009177 Bacteria 3329
83 Ga0105237_10001746 3300009545 Bacteria 28078
84 Ga0105249_10000049 3300009553 Bacteria 169899
85 Ga0105239_10003558 3300010375 Bacteria 19045
86 Ga0105239_10043042 3300010375 Bacteria 4948
87 Ga0105246_10049068 3300011119 Bacteria 2889
88 Ga0157378_10003545 3300013297 Bacteria 13831
89 Ga0163162_10030492 3300013306 Bacteria 5343
90 Ga0163162_10080414 3300013306 Bacteria 3327
91 Ga0163162_10128583 3300013306 Bacteria 2641
92 Ga0157372_10065161 3300013307 Bacteria 4090
93 Ga0157375_10864924 3300013308 Bacteria 1050
94 Ga0163163_10057489 3300014325 Bacteria 3846
95 Ga0157380_10005065 3300014326 Bacteria 9199
96 Ga0157379_10059004 3300014968 Bacteria 3431
97 Ga0163161_10090016 3300017792 Bacteria 2270
98 Ga0213876_10006627 3300021384 Bacteria 6317
99 Ga0213875_10039002 3300021388 Bacteria 2238
100 Ga0209673_1013790 3300025273 Bacteria 3170
101 Ga0209051_1000776 3300025303 Bacteria 33909
102 Ga0209051_1005160 3300025303 Bacteria 7737
103 Ga0209051_1023612 3300025303 Bacteria 2551
104 Ga0207710_10000066 3300025900 Bacteria 153734
105 Ga0207688_10007036 3300025901 Bacteria 6116
106 Ga0207680_10108593 3300025903 Bacteria 1795
107 Ga0207685_10017525 3300025905 Bacteria 2318
108 Ga0207645_10017236 3300025907 Bacteria 4770
109 Ga0207671_10008052 3300025914 Bacteria 9008
110 Ga0207657_10336422 3300025919 Bacteria 1192
111 Ga0207681_10002233 3300025923 Bacteria 12310
112 Ga0207694_10046268 3300025924 Bacteria 3363
113 Ga0207700_10085680 3300025928 Bacteria 2473
114 Ga0207664_10021970 3300025929 Bacteria 4755
115 Ga0207664_10192840 3300025929 Bacteria 1755
116 Ga0207664_10482723 3300025929 Bacteria 1109
117 Ga0207664_10649670 3300025929 Bacteria 948
118 Ga0207644_10013751 3300025931 Bacteria 5404
119 Ga0207706_10012653 3300025933 Bacteria 7678
120 Ga0207706_10052028 3300025933 Bacteria 3616
121 Ga0207704_10025010 3300025938 Bacteria 3251
122 Ga0207665_10024400 3300025939 Bacteria 3986
123 Ga0207711_10000058 3300025941 Bacteria 133317
124 Ga0207689_10017673 3300025942 Bacteria 6027
125 Ga0207661_10167761 3300025944 Bacteria 1909
126 Ga0207712_10000038 3300025961 Bacteria 192762
127 Ga0207668_10001652 3300025972 Bacteria 13029
128 Ga0207668_10234146 3300025972 Bacteria 1482
129 Ga0207658_10000061 3300025986 Bacteria 119045
130 Ga0207658_10062847 3300025986 Bacteria 2780
131 Ga0207658_10155923 3300025986 Bacteria 1866
132 Ga0207703_10022940 3300026035 Bacteria 4901
133 Ga0207678_10010285 3300026067 Bacteria 8212
134 Ga0207678_10033845 3300026067 Bacteria 4451
135 Ga0207678_10139695 3300026067 Bacteria 2067
136 Ga0207708_10012134 3300026075 Bacteria 6424
137 Ga0207641_10138662 3300026088 Bacteria 2191
138 Ga0207648_10004179 3300026089 Bacteria 14923
139 Ga0207675_100067218 3300026118 Bacteria 3350
140 Ga0207683_10028991 3300026121 Bacteria 4790
141 Ga0207698_10184977 3300026142 Bacteria 1850
142 Ga0268266_10028411 3300028379 Bacteria 4755
143 Ga0268265_10000053 3300028380 Bacteria 170215
144 Ga0268264_10000017 3300028381 Bacteria 498037
145 Ga0268264_10169283 3300028381 Bacteria 1975
146 Ga0265327_10006336 3300031251 Bacteria 9495
147 Ga0307409_100003692 3300031995 Bacteria 8393
148 Ga0307416_100010772 3300032002 Bacteria 6057
149 Ga0307414_10017627 3300032004 Bacteria 4375
150 Ga0307415_100010570 3300032126 Bacteria 5233
151 Ga0307510_10299059 3300033180 Bacteria 1072
152 Ga0373939_0025573 3300035114 Bacteria 1657
153 Ga0373931_0217490 3300035691 Bacteria 1149
154 Ga0436364_0142680 3300037853 Bacteria 13599
155 Ga0436364_0408055 3300037853 Bacteria 6097
156 Ga0436364_0964457 3300037853 Bacteria 4955
157 Ga0436365_0475464 3300039437 Bacteria 18893
158 Ga0436365_1560865 3300039437 Bacteria 12619
159 Ga0436361_0846370 3300039447 Bacteria 2507
160 Ga0436363_0019125 3300039450 Bacteria 2111
161 Ga0436363_1684618 3300039450 Bacteria 1934
162 Ga0439461_0025527 3300041410 Bacteria 1200
163 Ga0439466_0006705 3300041411 Bacteria 4368
164 Ga0439465_0003151 3300041413 Bacteria 5385
165 Ga0439465_0004041 3300041413 Bacteria 4785
166 Ga0451795_0552295 3300041456 Bacteria 1806
167 Ga0439431_0004497 3300041997 Bacteria 3067
168 Ga0439431_0018417 3300041997 Bacteria 1652
169 Ga0439442_038113 3300042002 Bacteria 1008
170 Ga0439445_0014714 3300042004 Bacteria 1908
171 Ga0439434_0000830 3300042435 Bacteria 8911
172 Ga0439434_0034213 3300042435 Bacteria 1551
173 Ga0466969_0018292 3300044656 Bacteria 3651
174 Ga0466972_0001893 3300044658 Bacteria 10280
175 Ga0466972_0006441 3300044658 Bacteria 5896
176 Ga0466965_0000732 3300044683 Bacteria 12261
177 Ga0466965_0014710 3300044683 Bacteria 3704
178 Ga0466965_0164972 3300044683 Bacteria 1163
179 Ga0466966_0002596 3300044684 Bacteria 11839
180 Ga0466966_0008098 3300044684 Bacteria 6968
181 Ga0466966_0008315 3300044684 Bacteria 6879
182 Ga0466966_0015503 3300044684 Bacteria 5038
183 Ga0466963_0005746 3300044694 Bacteria 7292
184 Ga0466963_0083894 3300044694 Bacteria 2161
185 Ga0466963_0229330 3300044694 Bacteria 1301
186 Ga0466963_0297258 3300044694 Bacteria 1135
187 Ga0466963_0357773 3300044694 Bacteria 1028
188 Ga0466971_0196065 3300044719 Bacteria 952
189 Ga0466968_0003752 3300044735 Bacteria 5630
190 Ga0466968_0004166 3300044735 Bacteria 5388
191 Ga0466968_0005295 3300044735 Bacteria 4831
192 Ga0466968_0153160 3300044735 Bacteria 1060
193 Ga0466957_0003513 3300044842 Bacteria 8619
194 Ga0466957_0008951 3300044842 Bacteria 5706
195 Ga0466957_0230704 3300044842 Bacteria 1225
196 Ga0466960_0000220 3300044901 Bacteria 19822
197 Ga0466960_0003232 3300044901 Bacteria 6247
198 Ga0466960_0006060 3300044901 Bacteria 4832
199 Ga0466959_0024805 3300045049 Bacteria 4441
200 Ga0466959_0046510 3300045049 Bacteria 3192
201 Ga0466958_0002045 3300045836 Bacteria 9966
202 Ga0466958_0028464 3300045836 Bacteria 3313
203 Ga0466967_0003081 3300045976 Bacteria 10717
204 Ga0466967_0016517 3300045976 Bacteria 5825
205 Ga0466967_0051441 3300045976 Bacteria 3610
206 Ga0466967_0108051 3300045976 Bacteria 2552
207 Ga0466967_0191537 3300045976 Bacteria 1933
208 Ga0466967_0221807 3300045976 Bacteria 1797
209 Ga0466967_0965734 3300045976 Bacteria 848
210 Ga0495606_0019624 3300046507 Bacteria 5019
211 Ga0495648_0002131 3300046524 Bacteria 18629
212 Ga0495654_0094501 3300046530 Bacteria 1383
213 Ga0495672_0007997 3300047320 Bacteria 7872
214 Ga0495672_0035660 3300047320 Bacteria 3062
215 Ga0495672_0058931 3300047320 Bacteria 2224
216 Ga0495673_0008774 3300047469 Bacteria 5645
217 Ga0495686_0007552 3300047472 Bacteria 8131
218 Ga0495686_0135569 3300047472 Bacteria 1456
219 Ga0496100_0000798 3300048903 Bacteria 15034
220 Ga0496100_0074610 3300048903 Bacteria 2273
221 Ga0496101_0000031 3300048904 Bacteria 195195
222 Ga0496101_0002994 3300048904 Bacteria 10408
223 Ga0496101_0010778 3300048904 Bacteria 6047
224 Ga0496101_0118591 3300048904 Bacteria 1999
225 Ga0496101_0361177 3300048904 Bacteria 1142
226 Ga0496102_0000065 3300048905 Bacteria 161370
227 Ga0496102_0000336 3300048905 Bacteria 57396
228 Ga0496102_0005751 3300048905 Bacteria 10538
229 Ga0496102_0026288 3300048905 Bacteria 5190
230 Ga0496102_0065999 3300048905 Bacteria 3317
231 Ga0496102_0253348 3300048905 Bacteria 1660
232 Ga0496103_0000048 3300048906 Bacteria 160911
233 Ga0496103_0000271 3300048906 Bacteria 49217
234 Ga0496103_0027856 3300048906 Bacteria 3427
235 Ga0496104_0029813 3300048907 Bacteria 5064
236 Ga0496104_0030423 3300048907 Bacteria 5017
237 Ga0496105_0007149 3300048908 Bacteria 8613
238 Ga0496105_0032430 3300048908 Bacteria 4287
239 Ga0496106_0004592 3300048909 Bacteria 10243
240 Ga0496106_0019268 3300048909 Bacteria 5059
241 Ga0496106_0399690 3300048909 Bacteria 1104
242 Ga0496107_0000649 3300048910 Bacteria 19601
243 Ga0496107_0010437 3300048910 Bacteria 6453
244 Ga0496107_0096919 3300048910 Bacteria 2159
245 Ga0496108_0184049 3300048911 Bacteria 1809
246 Ga0496109_0062040 3300048912 Bacteria 3418
247 Ga0496110_0013736 3300048913 Bacteria 6710
248 Ga0496110_0319997 3300048913 Bacteria 1413
249 Ga0496111_0051239 3300048914 Bacteria 2980
250 Ga0496111_0083295 3300048914 Bacteria 2337
251 Ga0496112_0002704 3300048915 Bacteria 14341
252 Ga0496112_0133290 3300048915 Bacteria 2455
253 Ga0496112_0236010 3300048915 Bacteria 1782
254 Ga0496112_0309083 3300048915 Bacteria 1526
255 Ga0496113_0006830 3300048916 Bacteria 7277
256 Ga0496113_0014175 3300048916 Bacteria 5429
257 Ga0496114_0002600 3300048917 Bacteria 13777
258 Ga0496114_0009406 3300048917 Bacteria 7760
259 Ga0496115_0004345 3300048918 Bacteria 10257
260 Ga0496115_0016835 3300048918 Bacteria 5574
261 Ga0496115_0267186 3300048918 Bacteria 1406
262 Ga0496116_0000125 3300048919 Bacteria 160885
263 Ga0496116_0013160 3300048919 Bacteria 6695
264 Ga0496117_0000111 3300048920 Bacteria 184570
265 Ga0496117_0001352 3300048920 Bacteria 35887
266 Ga0496117_0052851 3300048920 Bacteria 2859
267 Ga0496118_0000083 3300048921 Bacteria 184570
268 Ga0496118_0000505 3300048921 Bacteria 64638
269 Ga0496118_0013176 3300048921 Bacteria 7844
270 Ga0496119_0010640 3300048922 Bacteria 7711
271 Ga0496119_0025469 3300048922 Bacteria 4130
272 Ga0496120_0001769 3300048923 Bacteria 24335
273 Ga0496120_0056785 3300048923 Bacteria 2207
274 Ga0496121_0001000 3300048924 Bacteria 50532
275 Ga0496121_0009717 3300048924 Bacteria 11008
276 Ga0496123_0022281 3300048926 Bacteria 4888
277 Ga0496125_0105213 3300048928 Bacteria 2063
278 Ga0496125_0108866 3300048928 Bacteria 2014
279 Ga0496126_0000220 3300048929 Bacteria 124547
280 Ga0496126_0006911 3300048929 Bacteria 12569
281 Ga0496126_0015053 3300048929 Bacteria 7796
282 Ga0496126_0026981 3300048929 Bacteria 5496
283 Ga0496126_0099525 3300048929 Bacteria 2546
284 Ga0496126_0307410 3300048929 Bacteria 1306
285 Ga0501032_0006512 3300049569 Bacteria 8582
286 Ga0501033_0123696 3300049570 Bacteria 1876
287 Ga0501034_0017635 3300049571 Bacteria 7320
288 Ga0501034_0084775 3300049571 Bacteria 3170
289 Ga0501036_0011991 3300049572 Bacteria 7185
290 Ga0501036_0490264 3300049572 Bacteria 1023
291 Ga0501037_0000219 3300049573 Bacteria 49904
292 Ga0501038_0073762 3300049574 Bacteria 2888
293 Ga0501043_0008862 3300049579 Bacteria 7917
294 Ga0501046_0062200 3300049580 Bacteria 2917
295 Ga0501047_0067731 3300049581 Bacteria 3439
296 Ga0501048_0092296 3300049582 Bacteria 2135
297 Ga0501067_0042347 3300049583 Bacteria 2528
298 Ga0501069_0051146 3300049585 Bacteria 2299
299 Ga0501070_0004633 3300049586 Bacteria 11795
300 Ga0501070_0062903 3300049586 Bacteria 3074
301 Ga0501071_0130467 3300049587 Bacteria 1867
302 Ga0501073_0019516 3300049589 Bacteria 4893
303 Ga0501077_0092790 3300049593 Bacteria 1913
304 Ga0501080_0100806 3300049742 Bacteria 2679
305 Ga0501035_0111970 3300049822 Bacteria 2391
306 Ga0501044_0033329 3300049823 Bacteria 5414
307 nmdc:mga03683_76828_c1 3300050489 Bacteria 1436
308 nmdc:mga03n38_11320_c1 3300050490 Bacteria 3318
309 nmdc:mga03n38_28068_c1 3300050490 Bacteria 2342
310 nmdc:mga03n38_33684_c1 3300050490 Bacteria 2181
311 nmdc:mga03n38_43260_c1 3300050490 Bacteria 1468
312 nmdc:mga03n38_77351_c1 3300050490 Bacteria 1555
313 nmdc:mga03n38_87925_c1 3300050490 Bacteria 1473
314 nmdc:mga03n38_8858_c1 3300050490 Bacteria 3632
315 nmdc:mga03n38_9094_c1 3300050490 Bacteria 3595
316 nmdc:mga00v17_22307_c1 3300050491 Bacteria 3652
317 nmdc:mga00v17_35083_c1 3300050491 Bacteria 2983
318 nmdc:mga00v17_47963_c1 3300050491 Bacteria 2588
319 nmdc:mga00v17_5481_c1 3300050491 Bacteria 6685
320 nmdc:mga00v17_7782_c1 3300050491 Bacteria 5742
321 nmdc:mga0yw44_19180_c1 3300050492 Bacteria 3765
322 nmdc:mga0yw44_36631_c1 3300050492 Bacteria 2892
323 nmdc:mga06z11_5501_c1 3300050494 Bacteria 5089
324 nmdc:mga07m45_12974_c1 3300050496 Bacteria 4408
325 nmdc:mga07m45_13554_c1 3300050496 Bacteria 4329
326 nmdc:mga07m45_21921_c1 3300050496 Bacteria 3483
327 nmdc:mga07m45_52996_c1 3300050496 Bacteria 2292
328 nmdc:mga0sz30_26483_c1 3300050516 Bacteria 2377
329 nmdc:mga0sz30_2762_c1 3300050516 Bacteria 6260
330 Ga0500635_0003381 3300053080 Bacteria 4008
331 Ga0500635_0044477 3300053080 Bacteria 1498
332 Ga0500643_004994 3300053087 Bacteria 5825
333 Ga0500643_017514 3300053087 Bacteria 2398
334 Ga0500628_008150 3300053129 Bacteria 1815
335 Ga0500652_000344 3300053131 Bacteria 16730
336 Ga0500616_0082267 3300053153 Bacteria 1615
337 Ga0500645_000056 3300053730 Bacteria 92126
338 Ga0466962_0036373 3300061719 Bacteria 2356
339 Ga0466962_0077673 3300061719 Bacteria 1587
340 2548694288 2547132424 Bacteria 8348532
341 2644516497 2643221692 Bacteria 7282860
342 2644636442 2643221715 Bacteria 6671032
343 2738706398 2738541274 Bacteria 6909446
344 2739328889 2738543028 Bacteria 6917070
345 2744954044 2744054611 Bacteria 5611514
346 2842140349 2842134933 Bacteria 5847019
347 2902797157 2902792274 Bacteria 7270173
348 2902814474 2902810491 Bacteria 6794147
349 2902839191 2902837492 Bacteria 6697721
350 2929217939 2929212328 Bacteria 7708288
351 Ga0070669_100010174
352 rootH2_10142052
353 Ga0055540_1004517
354 Ga0055540_1007298
355 Ga0070676_10028764
356 Ga0070683_100030790
357 Ga0070671_100011045
358 Ga0070674_100032121
359 Ga0070667_100000487
360 Ga0070667_100053649
361 Ga0070667_100165656
362 Ga0070667_100208343
363 Ga0070714_100119460
364 Ga0070713_100083990
365 Ga0070710_10004326
366 Ga0070701_10004360
367 Ga0070711_100004082
368 Ga0070700_100008969
369 Ga0070694_100078685
370 Ga0070663_100013609
371 Ga0070663_100022532
372 Ga0070678_100047572
373 Ga0070662_100011547
374 Ga0070684_100045047
375 Ga0070684_100074816
376 Ga0068853_100010233
377 Ga0070695_100320635
378 Ga0070696_100009787
379 Ga0070665_100022607
380 Ga0070704_100004952
381 Ga0068855_100154390
382 Ga0068855_100230530
383 Ga0068854_100053485
384 Ga0068856_100310603
385 Ga0070702_100071801
386 Ga0068852_100139366
387 Ga0068852_100210339
388 Ga0068859_100718323
389 Ga0068866_10083023
390 Ga0068861_100041304
391 Ga0068863_100003638
392 Ga0068858_100034565
393 Ga0068860_100000079
394 Ga0068860_100027939
395 Ga0068860_100181521
396 Ga0068862_100000093
397 Ga0075365_10003427
398 Ga0075365_10003451
399 Ga0075365_10010213
400 Ga0075365_10039436
401 Ga0075365_10081199
402 Ga0075363_100001104
403 Ga0075363_100001134
404 Ga0075363_100004049
405 Ga0075363_100005539
406 Ga0075363_100018394
407 Ga0075364_10004527
408 Ga0075364_10006554
409 Ga0075364_10008023
410 Ga0075364_10015077
411 Ga0075364_10019928
412 Ga0070716_100052495
413 Ga0070716_100057842
414 Ga0070712_100008217
415 Ga0075367_10004991
416 Ga0075367_10013422
417 Ga0075369_10000029
418 Ga0075369_10009294
419 Ga0075370_10007651
420 Ga0075370_10011527
421 Ga0075370_10054066
422 Ga0068871_100143174
423 Ga0097620_100718317
424 Ga0099795_10042762
425 Ga0105245_10259065
426 Ga0105247_10000044
427 Ga0105243_10011436
428 Ga0105241_10163507
429 Ga0105242_10007318
430 Ga0105248_10000060
431 Ga0105248_10028232
432 Ga0105248_10096565
433 Ga0105237_10001746
434 Ga0105249_10000049
435 Ga0105239_10003558
436 Ga0105239_10043042
437 Ga0105246_10049068
438 Ga0157378_10003545
439 Ga0163162_10030492
440 Ga0163162_10080414
441 Ga0163162_10128583
442 Ga0157372_10065161
443 Ga0157375_10864924
444 Ga0163163_10057489
445 Ga0157380_10005065
446 Ga0157379_10059004
447 Ga0163161_10090016
448 Ga0213876_10006627
449 Ga0213875_10039002
450 Ga0209673_1013790
451 Ga0209051_1000776
452 Ga0209051_1005160
453 Ga0209051_1023612
454 Ga0207710_10000066
455 Ga0207688_10007036
456 Ga0207680_10108593
457 Ga0207685_10017525
458 Ga0207645_10017236
459 Ga0207671_10008052
460 Ga0207657_10336422
461 Ga0207681_10002233
462 Ga0207694_10046268
463 Ga0207700_10085680
464 Ga0207664_10021970
465 Ga0207664_10192840
466 Ga0207664_10482723
467 Ga0207664_10649670
468 Ga0207644_10013751
469 Ga0207706_10012653
470 Ga0207706_10052028
471 Ga0207704_10025010
472 Ga0207665_10024400
473 Ga0207711_10000058
474 Ga0207689_10017673
475 Ga0207661_10167761
476 Ga0207712_10000038
477 Ga0207668_10001652
478 Ga0207668_10234146
479 Ga0207658_10000061
480 Ga0207658_10062847
481 Ga0207658_10155923
482 Ga0207703_10022940
483 Ga0207678_10010285
484 Ga0207678_10033845
485 Ga0207678_10139695
486 Ga0207708_10012134
487 Ga0207641_10138662
488 Ga0207648_10004179
489 Ga0207675_100067218
490 Ga0207683_10028991
491 Ga0207698_10184977
492 Ga0268266_10028411
493 Ga0268265_10000053
494 Ga0268264_10000017
495 Ga0268264_10169283
496 Ga0265327_10006336
497 Ga0307409_100003692
498 Ga0307416_100010772
499 Ga0307414_10017627
500 Ga0307415_100010570
501 Ga0307510_10299059
502 Ga0373939_0025573
503 Ga0373931_0217490
504 Ga0436364_0142680
505 Ga0436364_0408055
506 Ga0436364_0964457
507 Ga0436365_0475464
508 Ga0436365_1560865
509 Ga0436361_0846370
510 Ga0436363_0019125
511 Ga0436363_1684618
512 Ga0439461_0025527
513 Ga0439466_0006705
514 Ga0439465_0003151
515 Ga0439465_0004041
516 Ga0451795_0552295
517 Ga0439431_0004497
518 Ga0439431_0018417
519 Ga0439442_038113
520 Ga0439445_0014714
521 Ga0439434_0000830
522 Ga0439434_0034213
523 Ga0466969_0018292
524 Ga0466972_0001893
525 Ga0466972_0006441
526 Ga0466965_0000732
527 Ga0466965_0014710
528 Ga0466965_0164972
529 Ga0466966_0002596
530 Ga0466966_0008098
531 Ga0466966_0008315
532 Ga0466966_0015503
533 Ga0466963_0005746
534 Ga0466963_0083894
535 Ga0466963_0229330
536 Ga0466963_0297258
537 Ga0466963_0357773
538 Ga0466971_0196065
539 Ga0466968_0003752
540 Ga0466968_0004166
541 Ga0466968_0005295
542 Ga0466968_0153160
543 Ga0466957_0003513
544 Ga0466957_0008951
545 Ga0466957_0230704
546 Ga0466960_0000220
547 Ga0466960_0003232
548 Ga0466960_0006060
549 Ga0466959_0024805
550 Ga0466959_0046510
551 Ga0466958_0002045
552 Ga0466958_0028464
553 Ga0466967_0003081
554 Ga0466967_0016517
555 Ga0466967_0051441
556 Ga0466967_0108051
557 Ga0466967_0191537
558 Ga0466967_0221807
559 Ga0466967_0965734
560 Ga0495606_0019624
561 Ga0495648_0002131
562 Ga0495654_0094501
563 Ga0495672_0007997
564 Ga0495672_0035660
565 Ga0495672_0058931
566 Ga0495673_0008774
567 Ga0495686_0007552
568 Ga0495686_0135569
569 Ga0496100_0000798
570 Ga0496100_0074610
571 Ga0496101_0000031
572 Ga0496101_0002994
573 Ga0496101_0010778
574 Ga0496101_0118591
575 Ga0496101_0361177
576 Ga0496102_0000065
577 Ga0496102_0000336
578 Ga0496102_0005751
579 Ga0496102_0026288
580 Ga0496102_0065999
581 Ga0496102_0253348
582 Ga0496103_0000048
583 Ga0496103_0000271
584 Ga0496103_0027856
585 Ga0496104_0029813
586 Ga0496104_0030423
587 Ga0496105_0007149
588 Ga0496105_0032430
589 Ga0496106_0004592
590 Ga0496106_0019268
591 Ga0496106_0399690
592 Ga0496107_0000649
593 Ga0496107_0010437
594 Ga0496107_0096919
595 Ga0496108_0184049
596 Ga0496109_0062040
597 Ga0496110_0013736
598 Ga0496110_0319997
599 Ga0496111_0051239
600 Ga0496111_0083295
601 Ga0496112_0002704
602 Ga0496112_0133290
603 Ga0496112_0236010
604 Ga0496112_0309083
605 Ga0496113_0006830
606 Ga0496113_0014175
607 Ga0496114_0002600
608 Ga0496114_0009406
609 Ga0496115_0004345
610 Ga0496115_0016835
611 Ga0496115_0267186
612 Ga0496116_0000125
613 Ga0496116_0013160
614 Ga0496117_0000111
615 Ga0496117_0001352
616 Ga0496117_0052851
617 Ga0496118_0000083
618 Ga0496118_0000505
619 Ga0496118_0013176
620 Ga0496119_0010640
621 Ga0496119_0025469
622 Ga0496120_0001769
623 Ga0496120_0056785
624 Ga0496121_0001000
625 Ga0496121_0009717
626 Ga0496123_0022281
627 Ga0496125_0105213
628 Ga0496125_0108866
629 Ga0496126_0000220
630 Ga0496126_0006911
631 Ga0496126_0015053
632 Ga0496126_0026981
633 Ga0496126_0099525
634 Ga0496126_0307410
635 Ga0501032_0006512
636 Ga0501033_0123696
637 Ga0501034_0017635
638 Ga0501034_0084775
639 Ga0501036_0011991
640 Ga0501036_0490264
641 Ga0501037_0000219
642 Ga0501038_0073762
643 Ga0501043_0008862
644 Ga0501046_0062200
645 Ga0501047_0067731
646 Ga0501048_0092296
647 Ga0501067_0042347
648 Ga0501069_0051146
649 Ga0501070_0004633
650 Ga0501070_0062903
651 Ga0501071_0130467
652 Ga0501073_0019516
653 Ga0501077_0092790
654 Ga0501080_0100806
655 Ga0501035_0111970
656 Ga0501044_0033329
657 nmdc:mga03683_76828_c1
658 nmdc:mga03n38_11320_c1
659 nmdc:mga03n38_28068_c1
660 nmdc:mga03n38_33684_c1
661 nmdc:mga03n38_43260_c1
662 nmdc:mga03n38_77351_c1
663 nmdc:mga03n38_87925_c1
664 nmdc:mga03n38_8858_c1
665 nmdc:mga03n38_9094_c1
666 nmdc:mga00v17_22307_c1
667 nmdc:mga00v17_35083_c1
668 nmdc:mga00v17_47963_c1
669 nmdc:mga00v17_5481_c1
670 nmdc:mga00v17_7782_c1
671 nmdc:mga0yw44_19180_c1
672 nmdc:mga0yw44_36631_c1
673 nmdc:mga06z11_5501_c1
674 nmdc:mga07m45_12974_c1
675 nmdc:mga07m45_13554_c1
676 nmdc:mga07m45_21921_c1
677 nmdc:mga07m45_52996_c1
678 nmdc:mga0sz30_26483_c1
679 nmdc:mga0sz30_2762_c1
680 Ga0500635_0003381
681 Ga0500635_0044477
682 Ga0500643_004994
683 Ga0500643_017514
684 Ga0500628_008150
685 Ga0500652_000344
686 Ga0500616_0082267
687 Ga0500645_000056
688 Ga0466962_0036373
689 Ga0466962_0077673
690 2548694288
691 2644516497
692 2644636442
693 2738706398
694 2739328889
695 2744954044
696 2842140349
697 2902797157
698 2902814474
699 2902839191
700 2929217939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

21

206

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

26

266

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k9z-assembly2.cif.gz_D crystal structure of putative short-chain dehydrogenase/reductase from burkholderia xenovorans lb400 0.9133 37 226
4weo-assembly1.cif.gz_C crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.872 20 227
5ovl-assembly1.cif.gz_D crystal structure of maba bound to nadp+ from m. smegmatis 0.8707 10 226
4weo-assembly1.cif.gz_B crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.8628 20 227
4za2-assembly1.cif.gz_C crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.8627 23 226
ID Description Score Start End Superfamily
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9125 37 226 3.40.50.720
af_Q9VQ39_34_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8613 37 160 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8575 20 227 3.40.50.720
af_P96825_7_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8568 20 264 3.40.50.720
4cqlI00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8447 29 226 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7T6Z0S7-F1-model_v4 SDR family oxidoreductase 0.9364 21 223
AF-A0A520X369-F1-model_v4 deleted 0.913 23 156
AF-A0A1F8QWL0-F1-model_v4 Short-chain dehydrogenase 0.9114 20 235 GO:0016491
AF-A0A3D0TLE6-F1-model_v4 Short-chain dehydrogenase 0.9083 28 154 GO:0016491
AF-A0A661LXJ4-F1-model_v4 deleted 0.9046 7 146

Map