F417515

General Info

Members Datasets Scaffolds Average Seq Length
348 188 696 205

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10383900|Ga0105243_103839002
Length 227
Sequence LAEPFETVAARPAQVPPGETPRVFLASRNGKKIEEMRRILDVDLPGIEVLGLDDVVAYAEPVEDQPTFEGNALLKARAGLAATGLPSLADDSGLCVDALNGMPGVLSARWAGSAKDDTANNRLLLEQLADVPDERRGAHFTCAVAFAYPVGAGGVAEHVVHGEMPGRVIRETRGSGGFGYDVLFVADATPDGRTSAELTVEEKDAISHRGKAIRAIAPVVADVLTGL

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
79 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
171 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2643221604 Nocardioides sp. Root190 Isolate Unclassified
177 2643221617 Nocardioides sp. Root79 Isolate Unclassified
178 2643221620 Nocardioides sp. Root240 Isolate Unclassified
179 2739367898 Nocardioides sp. CF479 Isolate Unclassified
180 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
181 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
182 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
183 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
184 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
185 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
186 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
187 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
188 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.69
Metatranscriptomes 0.57
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 5.46
Nodule 0
Rhizoplane 10.06
Rhizosphere 78.74
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10383900 3300009148 Bacteria 1300
2 JGI24740J21852_10011285 3300001979 Bacteria 3405
3 JGI24739J22299_10019858 3300001989 Bacteria 2403
4 JGI24737J22298_10025142 3300001990 Bacteria 1884
5 JGI24735J21928_10023776 3300002067 Bacteria 1858
6 JGI24735J21928_10066507 3300002067 Bacteria 1034
7 rootL2_10120522 3300003322 Bacteria 4670
8 Ga0006562J51391_1028210 3300003578 Bacteria 1813
9 Ga0070683_100002484 3300005329 Bacteria 14674
10 Ga0070683_100017850 3300005329 Bacteria 6272
11 Ga0070683_100099620 3300005329 Bacteria 2735
12 Ga0070682_100032459 3300005337 Bacteria 3166
13 Ga0070682_100781375 3300005337 Bacteria 774
14 Ga0068868_100326577 3300005338 Bacteria 1308
15 Ga0068868_100455553 3300005338 Bacteria 1113
16 Ga0070660_100014043 3300005339 Bacteria 5765
17 Ga0070675_100768220 3300005354 Bacteria 880
18 Ga0070659_100049183 3300005366 Bacteria 3315
19 Ga0070667_100051216 3300005367 Bacteria 3481
20 Ga0070667_100205126 3300005367 Bacteria 1750
21 Ga0070700_100105614 3300005441 Bacteria 1863
22 Ga0070678_100601017 3300005456 Bacteria 982
23 Ga0070685_10261524 3300005466 Bacteria 1151
24 Ga0070698_100003002 3300005471 Bacteria 18586
25 Ga0070684_100005484 3300005535 Bacteria 9720
26 Ga0070684_100693379 3300005535 Bacteria 949
27 Ga0070672_100432350 3300005543 Bacteria 1132
28 Ga0068855_101339887 3300005563 Bacteria 739
29 Ga0068857_100007737 3300005577 Bacteria 9257
30 Ga0068856_100007197 3300005614 Bacteria 10853
31 Ga0070702_101021549 3300005615 Bacteria 656
32 Ga0068864_100533866 3300005618 Bacteria 1132
33 Ga0068864_100734153 3300005618 Bacteria 967
34 Ga0068870_10338963 3300005840 Bacteria 961
35 Ga0068863_100139358 3300005841 Bacteria 2318
36 Ga0068860_100000467 3300005843 Bacteria 50515
37 Ga0068860_100208202 3300005843 Bacteria 1897
38 Ga0075365_10021869 3300006038 Bacteria 3996
39 Ga0075365_10185948 3300006038 Bacteria 1453
40 Ga0075368_10000363 3300006042 Bacteria 13338
41 Ga0075363_100016932 3300006048 Bacteria 3607
42 Ga0075364_10004217 3300006051 Bacteria 8255
43 Ga0075367_10036691 3300006178 Bacteria 2844
44 Ga0068871_100095529 3300006358 Bacteria 2482
45 Ga0068871_100453468 3300006358 Bacteria 1150
46 Ga0068865_100011722 3300006881 Bacteria 5492
47 Ga0105245_10001389 3300009098 Bacteria 21921
48 Ga0105245_10137265 3300009098 Bacteria 2299
49 Ga0105245_10508340 3300009098 Bacteria 1222
50 Ga0105245_10742873 3300009098 Bacteria 1017
51 Ga0114129_10884171 3300009147 Bacteria 1133
52 Ga0105243_10063484 3300009148 Bacteria 2960
53 Ga0105243_10066113 3300009148 Bacteria 2907
54 Ga0105243_10539262 3300009148 Bacteria 1113
55 Ga0105243_10578869 3300009148 Bacteria 1077
56 Ga0105242_10033727 3300009176 Bacteria 4101
57 Ga0105242_11350300 3300009176 Bacteria 738
58 Ga0105248_10378222 3300009177 Bacteria 1594
59 Ga0105248_10569024 3300009177 Bacteria 1278
60 Ga0105249_10031845 3300009553 Bacteria 4771
61 Ga0105249_11531896 3300009553 Bacteria 739
62 Ga0105239_10059054 3300010375 Bacteria 4210
63 Ga0105239_10196049 3300010375 Bacteria 2262
64 Ga0105246_10020735 3300011119 Bacteria 4220
65 Ga0105246_10030718 3300011119 Bacteria 3550
66 Ga0105246_10572045 3300011119 Bacteria 972
67 Ga0157371_10115510 3300013102 Bacteria 1906
68 Ga0157369_10010908 3300013105 Bacteria 10347
69 Ga0157369_10606013 3300013105 Bacteria 1130
70 Ga0157374_10510461 3300013296 Bacteria 1207
71 Ga0163162_10002716 3300013306 Bacteria 16784
72 Ga0157372_10022009 3300013307 Bacteria 6892
73 Ga0157372_10220213 3300013307 Bacteria 2200
74 Ga0157372_10331403 3300013307 Bacteria 1772
75 Ga0157375_10047994 3300013308 Bacteria 4174
76 Ga0157375_10220167 3300013308 Bacteria 2056
77 Ga0163163_10156303 3300014325 Bacteria 2325
78 Ga0163163_10276384 3300014325 Bacteria 1731
79 Ga0182008_10032092 3300014497 Bacteria 2640
80 Ga0182008_10071880 3300014497 Bacteria 1702
81 Ga0182008_10086717 3300014497 Bacteria 1542
82 Ga0157377_10272099 3300014745 Bacteria 1106
83 Ga0157377_10288727 3300014745 Bacteria 1078
84 Ga0157379_10060786 3300014968 Bacteria 3378
85 Ga0157379_10908209 3300014968 Bacteria 836
86 Ga0157376_10498558 3300014969 Bacteria 1196
87 Ga0163161_10688615 3300017792 Bacteria 850
88 Ga0207688_10053554 3300025901 Bacteria 2263
89 Ga0207647_10019032 3300025904 Bacteria 4625
90 Ga0207647_10342578 3300025904 Bacteria 847
91 Ga0207643_10440355 3300025908 Bacteria 828
92 Ga0207662_10073123 3300025918 Bacteria 2079
93 Ga0207657_10068426 3300025919 Bacteria 3016
94 Ga0207659_10569336 3300025926 Bacteria 964
95 Ga0207690_10016526 3300025932 Bacteria 4492
96 Ga0207686_10198416 3300025934 Bacteria 1435
97 Ga0207709_10141071 3300025935 Bacteria 1656
98 Ga0207704_10010985 3300025938 Bacteria 4441
99 Ga0207704_10338930 3300025938 Bacteria 1166
100 Ga0207691_10117466 3300025940 Bacteria 2360
101 Ga0207661_10011604 3300025944 Bacteria 6392
102 Ga0207661_10030338 3300025944 Bacteria 4164
103 Ga0207658_10034723 3300025986 Bacteria 3606
104 Ga0207658_10548247 3300025986 Bacteria 1034
105 Ga0207677_10250567 3300026023 Bacteria 1438
106 Ga0207677_10473832 3300026023 Bacteria 1077
107 Ga0207703_10049266 3300026035 Bacteria 3405
108 Ga0207678_10157237 3300026067 Bacteria 1941
109 Ga0207708_10124727 3300026075 Bacteria 2009
110 Ga0207708_10127205 3300026075 Bacteria 1989
111 Ga0207702_10126895 3300026078 Bacteria 2292
112 Ga0207641_10404643 3300026088 Bacteria 1311
113 Ga0207674_10042528 3300026116 Bacteria 4692
114 Ga0207674_10732928 3300026116 Bacteria 954
115 Ga0207683_10335125 3300026121 Bacteria 1387
116 Ga0207683_10643627 3300026121 Bacteria 982
117 Ga0209813_10001169 3300027866 Bacteria 5857
118 Ga0209813_10071333 3300027866 Bacteria 1130
119 Ga0268264_10001967 3300028381 Bacteria 18458
120 Ga0268264_10034080 3300028381 Bacteria 4187
121 Ga0307512_10094543 3300030522 Bacteria 2062
122 Ga0316181_1103859 3300030744 Bacteria 965
123 Ga0307513_10203046 3300031456 Bacteria 1821
124 Ga0307408_100114360 3300031548 Bacteria 2079
125 Ga0307405_10311449 3300031731 Bacteria 1198
126 Ga0307413_10335100 3300031824 Bacteria 1161
127 Ga0307413_10466685 3300031824 Bacteria 1006
128 Ga0307518_10135741 3300031838 Bacteria 1722
129 Ga0307410_10006951 3300031852 Bacteria 6154
130 Ga0307410_10065964 3300031852 Bacteria 2492
131 Ga0307410_10171870 3300031852 Bacteria 1634
132 Ga0307410_10488479 3300031852 Bacteria 1011
133 Ga0307406_10041290 3300031901 Bacteria 2874
134 Ga0307407_10041580 3300031903 Bacteria 2571
135 Ga0307407_10060463 3300031903 Bacteria 2211
136 Ga0307407_10181580 3300031903 Bacteria 1395
137 Ga0307407_10443357 3300031903 Bacteria 941
138 Ga0307407_10546877 3300031903 Bacteria 855
139 Ga0307412_10048086 3300031911 Bacteria 2804
140 Ga0307412_10054537 3300031911 Bacteria 2654
141 Ga0307412_10251635 3300031911 Bacteria 1372
142 Ga0307409_100011357 3300031995 Bacteria 5608
143 Ga0307409_100033247 3300031995 Bacteria 3751
144 Ga0307409_100080917 3300031995 Bacteria 2623
145 Ga0307416_100002929 3300032002 Bacteria 9946
146 Ga0307416_100013988 3300032002 Bacteria 5476
147 Ga0307416_100211213 3300032002 Bacteria 1851
148 Ga0307416_100222066 3300032002 Bacteria 1813
149 Ga0307414_10405877 3300032004 Bacteria 1185
150 Ga0307411_10126093 3300032005 Bacteria 1862
151 Ga0307411_10151645 3300032005 Bacteria 1723
152 Ga0307411_10198912 3300032005 Bacteria 1537
153 Ga0307415_100006264 3300032126 Bacteria 6393
154 Ga0307415_100219659 3300032126 Bacteria 1523
155 Ga0373960_0123341 3300035121 Bacteria 862
156 Ga0395901_0448724 3300038443 Bacteria 1319
157 Ga0439461_0046354 3300041410 Bacteria 953
158 Ga0451793_0246444 3300041452 Bacteria 7564
159 Ga0451837_0343219 3300041494 Bacteria 5233
160 Ga0451839_0020397 3300041496 Bacteria 6480
161 Ga0450907_013017 3300042146 Bacteria 1385
162 Ga0451577_0304746 3300042876 Bacteria 1443
163 Ga0451577_0322143 3300042876 Unclassified 1402
164 Ga0466972_0265180 3300044658 Bacteria 803
165 Ga0453683_0008754 3300044673 Bacteria 6785
166 Ga0466965_0027225 3300044683 Bacteria 2774
167 Ga0466965_0028405 3300044683 Bacteria 2718
168 Ga0466966_0030804 3300044684 Bacteria 3480
169 Ga0466966_0107594 3300044684 Bacteria 1720
170 Ga0466961_0282214 3300044693 Bacteria 1016
171 Ga0466961_0322185 3300044693 Bacteria 942
172 Ga0466963_0051182 3300044694 Bacteria 2737
173 Ga0466963_0083506 3300044694 Bacteria 2166
174 Ga0466963_0086464 3300044694 Bacteria 2130
175 Ga0466963_0140181 3300044694 Bacteria 1674
176 Ga0466963_0269188 3300044694 Bacteria 1197
177 Ga0466964_0045781 3300044706 Bacteria 1781
178 Ga0453684_0003689 3300044712 Bacteria 33928
179 Ga0453684_0127172 3300044712 Unclassified 3065
180 Ga0453684_0147711 3300044712 Unclassified 2798
181 Ga0466971_0278323 3300044719 Bacteria 800
182 Ga0466957_0001115 3300044842 Bacteria 13906
183 Ga0466957_0042866 3300044842 Bacteria 2739
184 Ga0466957_0207708 3300044842 Bacteria 1288
185 Ga0466960_0006974 3300044901 Bacteria 4563
186 Ga0466960_0020936 3300044901 Bacteria 2905
187 Ga0466960_0038137 3300044901 Bacteria 2257
188 Ga0466960_0144611 3300044901 Bacteria 1265
189 Ga0466960_0203812 3300044901 Bacteria 1082
190 Ga0466959_0249889 3300045049 Bacteria 1223
191 Ga0451576_0033349 3300045051 Bacteria 5473
192 Ga0451576_0566685 3300045051 Bacteria 1193
193 Ga0466958_0075923 3300045836 Bacteria 2062
194 Ga0466958_0120758 3300045836 Bacteria 1640
195 Ga0466967_0000988 3300045976 Bacteria 15473
196 Ga0466967_0020738 3300045976 Bacteria 5320
197 Ga0466967_0063937 3300045976 Bacteria 3271
198 Ga0466967_0068489 3300045976 Bacteria 3169
199 Ga0466967_0089264 3300045976 Bacteria 2798
200 Ga0466967_0105236 3300045976 Bacteria 2585
201 Ga0466967_0818634 3300045976 Bacteria 925
202 Ga0495658_0289242 3300046683 Bacteria 1035
203 Ga0496100_0284232 3300048903 Bacteria 1234
204 Ga0496101_0101439 3300048904 Bacteria 2155
205 Ga0496101_0476229 3300048904 Bacteria 986
206 Ga0496102_0570936 3300048905 Bacteria 1054
207 Ga0496102_0724334 3300048905 Bacteria 917
208 Ga0496102_0976636 3300048905 Bacteria 768
209 Ga0496103_0006700 3300048906 Bacteria 6874
210 Ga0496103_0069217 3300048906 Bacteria 2206
211 Ga0496104_0163170 3300048907 Bacteria 2137
212 Ga0496106_0461298 3300048909 Bacteria 1021
213 Ga0496107_0125211 3300048910 Bacteria 1895
214 Ga0496107_0207701 3300048910 Bacteria 1456
215 Ga0496107_0363916 3300048910 Bacteria 1076
216 Ga0496108_0008499 3300048911 Bacteria 8329
217 Ga0496108_0025621 3300048911 Bacteria 4861
218 Ga0496108_0026740 3300048911 Bacteria 4763
219 Ga0496109_0003050 3300048912 Bacteria 13962
220 Ga0496109_0015913 3300048912 Bacteria 6569
221 Ga0496109_0265877 3300048912 Bacteria 1616
222 Ga0496109_0790315 3300048912 Bacteria 887
223 Ga0496110_0022918 3300048913 Bacteria 5306
224 Ga0496110_0184121 3300048913 Bacteria 1896
225 Ga0496110_0247551 3300048913 Bacteria 1622
226 Ga0496110_0411220 3300048913 Bacteria 1233
227 Ga0496110_0517872 3300048913 Bacteria 1085
228 Ga0496111_0237875 3300048914 Bacteria 1352
229 Ga0496111_0823345 3300048914 Bacteria 671
230 Ga0496112_0043626 3300048915 Bacteria 4391
231 Ga0496113_0031910 3300048916 Bacteria 3826
232 Ga0496113_0181720 3300048916 Bacteria 1667
233 Ga0496114_0023844 3300048917 Bacteria 4993
234 Ga0496114_0058786 3300048917 Bacteria 3211
235 Ga0496114_0112392 3300048917 Bacteria 2335
236 Ga0496114_0171901 3300048917 Bacteria 1889
237 Ga0496122_0255408 3300048925 Bacteria 977
238 Ga0501317_003122 3300049533 Bacteria 1623
239 Ga0501031_0128689 3300049568 Bacteria 1654
240 Ga0501031_0228305 3300049568 Bacteria 1212
241 Ga0501031_0458838 3300049568 Bacteria 823
242 Ga0501033_0168436 3300049570 Bacteria 1574
243 Ga0501034_0013243 3300049571 Bacteria 8498
244 Ga0501034_0013956 3300049571 Bacteria 8270
245 Ga0501034_0313596 3300049571 Bacteria 1502
246 Ga0501036_0010035 3300049572 Bacteria 7801
247 Ga0501036_0193121 3300049572 Bacteria 1713
248 Ga0501036_0554320 3300049572 Bacteria 955
249 Ga0501036_0562841 3300049572 Bacteria 947
250 Ga0501037_0024042 3300049573 Bacteria 4505
251 Ga0501038_0049773 3300049574 Bacteria 3622
252 Ga0501039_0051464 3300049575 Bacteria 3187
253 Ga0501039_0177737 3300049575 Bacteria 1674
254 Ga0501039_0248640 3300049575 Bacteria 1398
255 Ga0501039_0496618 3300049575 Bacteria 958
256 Ga0501041_0145672 3300049577 Bacteria 1478
257 Ga0501042_0066364 3300049578 Bacteria 2579
258 Ga0501042_0157969 3300049578 Bacteria 1636
259 Ga0501043_0106410 3300049579 Bacteria 2203
260 Ga0501046_0014736 3300049580 Bacteria 6581
261 Ga0501046_0288388 3300049580 Bacteria 1201
262 Ga0501047_0167809 3300049581 Bacteria 2065
263 Ga0501047_0225365 3300049581 Bacteria 1729
264 Ga0501048_0098734 3300049582 Bacteria 2060
265 Ga0501067_0004112 3300049583 Bacteria 8022
266 Ga0501067_0004699 3300049583 Bacteria 7562
267 Ga0501067_0037470 3300049583 Bacteria 2693
268 Ga0501067_0199716 3300049583 Bacteria 1114
269 Ga0501067_0338405 3300049583 Bacteria 838
270 Ga0501068_0032369 3300049584 Bacteria 3110
271 Ga0501068_0036917 3300049584 Bacteria 2924
272 Ga0501068_0062552 3300049584 Bacteria 2263
273 Ga0501068_0700807 3300049584 Bacteria 662
274 Ga0501069_0004130 3300049585 Bacteria 7498
275 Ga0501069_0070689 3300049585 Bacteria 1956
276 Ga0501069_0165905 3300049585 Bacteria 1273
277 Ga0501069_0243425 3300049585 Bacteria 1048
278 Ga0501070_0004792 3300049586 Bacteria 11571
279 Ga0501070_0035442 3300049586 Bacteria 4169
280 Ga0501070_0571313 3300049586 Bacteria 904
281 Ga0501070_0578783 3300049586 Bacteria 897
282 Ga0501071_0140843 3300049587 Bacteria 1796
283 Ga0501071_0200745 3300049587 Bacteria 1498
284 Ga0501071_0260404 3300049587 Bacteria 1310
285 Ga0501071_0305844 3300049587 Bacteria 1206
286 Ga0501071_0545317 3300049587 Bacteria 891
287 Ga0501072_0009890 3300049588 Bacteria 7253
288 Ga0501072_0052375 3300049588 Bacteria 3214
289 Ga0501073_0019457 3300049589 Bacteria 4901
290 Ga0501073_0020255 3300049589 Bacteria 4798
291 Ga0501073_0031017 3300049589 Bacteria 3815
292 Ga0501073_0431904 3300049589 Bacteria 910
293 Ga0501074_0007589 3300049590 Bacteria 7849
294 Ga0501074_0033630 3300049590 Bacteria 3715
295 Ga0501074_0084620 3300049590 Bacteria 2273
296 Ga0501074_0208343 3300049590 Bacteria 1393
297 Ga0501075_0203319 3300049591 Bacteria 1511
298 Ga0501075_0320229 3300049591 Bacteria 1182
299 Ga0501075_0320737 3300049591 Bacteria 1181
300 Ga0501076_0259863 3300049592 Bacteria 1422
301 Ga0501076_1159815 3300049592 Bacteria 636
302 Ga0501077_0030724 3300049593 Bacteria 3418
303 Ga0501077_0043306 3300049593 Bacteria 2861
304 Ga0501079_0032242 3300049741 Bacteria 4028
305 Ga0501079_0327153 3300049741 Bacteria 1200
306 Ga0501080_0000857 3300049742 Bacteria 24883
307 Ga0501080_0013574 3300049742 Bacteria 7500
308 Ga0501080_0100447 3300049742 Bacteria 2684
309 Ga0501080_0691538 3300049742 Bacteria 900
310 Ga0501083_0020109 3300049744 Bacteria 4645
311 Ga0501035_0008456 3300049822 Bacteria 9587
312 Ga0501035_0653687 3300049822 Bacteria 852
313 Ga0501044_0005123 3300049823 Bacteria 14617
314 Ga0501044_0752972 3300049823 Bacteria 856
315 Ga0501045_0073793 3300049824 Bacteria 2513
316 nmdc:mga03683_354079_c1 3300050489 Bacteria 695
317 nmdc:mga03n38_2207_c1 3300050490 Bacteria 5945
318 nmdc:mga00v17_16022_c1 3300050491 Bacteria 4219
319 nmdc:mga00v17_211844_c1 3300050491 Bacteria 1254
320 nmdc:mga0yw44_33510_c1 3300050492 Bacteria 3002
321 nmdc:mga0yw44_38987_c1 3300050492 Bacteria 2814
322 nmdc:mga0yw44_39593_c1 3300050492 Bacteria 2796
323 nmdc:mga0yw44_594669_c1 3300050492 Bacteria 752
324 nmdc:mga04h51_4510_c1 3300050495 Bacteria 3472
325 nmdc:mga07m45_9413_c1 3300050496 Bacteria 5068
326 Ga0495655_0062846 3300053083 Bacteria 1017
327 Ga0500637_0088142 3300053178 Bacteria 1795
328 Ga0501084_0022730 3300054114 Bacteria 5234
329 Ga0501084_0112412 3300054114 Bacteria 2289
330 Ga0501082_0226341 3300060353 Bacteria 1627
331 Ga0466962_0061378 3300061719 Bacteria 1794
332 Ga0530510_0082225 3300061734 Bacteria 2345
333 Ga0530510_0092008 3300061734 Bacteria 2213
334 Ga0530510_0345206 3300061734 Bacteria 1118
335 Ga0530510_0563322 3300061734 Bacteria 866
336 2644033900 2643221604 Bacteria 5014917
337 2644102582 2643221617 Bacteria 5139111
338 2644118244 2643221620 Bacteria 5134593
339 2740166561 2739367898 Bacteria 4367674
340 2774393824 2773857762 Bacteria 5971770
341 2809195303 2808606439 Bacteria 5952208
342 2812350178 2811994878 Bacteria 5992952
343 2816424135 2816332119 Bacteria 8120218
344 2855388901 2855386786 Bacteria 4752232
345 2857483229 2857481737 Bacteria 4761446
346 2891972197 2891968417 Bacteria 5821697
347 2984577216 2984576629 Bacteria 4248407
348 2990260891 2990256926 Bacteria 4252839
349 Ga0105243_10383900
350 JGI24740J21852_10011285
351 JGI24739J22299_10019858
352 JGI24737J22298_10025142
353 JGI24735J21928_10023776
354 JGI24735J21928_10066507
355 rootL2_10120522
356 Ga0006562J51391_1028210
357 Ga0070683_100002484
358 Ga0070683_100017850
359 Ga0070683_100099620
360 Ga0070682_100032459
361 Ga0070682_100781375
362 Ga0068868_100326577
363 Ga0068868_100455553
364 Ga0070660_100014043
365 Ga0070675_100768220
366 Ga0070659_100049183
367 Ga0070667_100051216
368 Ga0070667_100205126
369 Ga0070700_100105614
370 Ga0070678_100601017
371 Ga0070685_10261524
372 Ga0070698_100003002
373 Ga0070684_100005484
374 Ga0070684_100693379
375 Ga0070672_100432350
376 Ga0068855_101339887
377 Ga0068857_100007737
378 Ga0068856_100007197
379 Ga0070702_101021549
380 Ga0068864_100533866
381 Ga0068864_100734153
382 Ga0068870_10338963
383 Ga0068863_100139358
384 Ga0068860_100000467
385 Ga0068860_100208202
386 Ga0075365_10021869
387 Ga0075365_10185948
388 Ga0075368_10000363
389 Ga0075363_100016932
390 Ga0075364_10004217
391 Ga0075367_10036691
392 Ga0068871_100095529
393 Ga0068871_100453468
394 Ga0068865_100011722
395 Ga0105245_10001389
396 Ga0105245_10137265
397 Ga0105245_10508340
398 Ga0105245_10742873
399 Ga0114129_10884171
400 Ga0105243_10063484
401 Ga0105243_10066113
402 Ga0105243_10539262
403 Ga0105243_10578869
404 Ga0105242_10033727
405 Ga0105242_11350300
406 Ga0105248_10378222
407 Ga0105248_10569024
408 Ga0105249_10031845
409 Ga0105249_11531896
410 Ga0105239_10059054
411 Ga0105239_10196049
412 Ga0105246_10020735
413 Ga0105246_10030718
414 Ga0105246_10572045
415 Ga0157371_10115510
416 Ga0157369_10010908
417 Ga0157369_10606013
418 Ga0157374_10510461
419 Ga0163162_10002716
420 Ga0157372_10022009
421 Ga0157372_10220213
422 Ga0157372_10331403
423 Ga0157375_10047994
424 Ga0157375_10220167
425 Ga0163163_10156303
426 Ga0163163_10276384
427 Ga0182008_10032092
428 Ga0182008_10071880
429 Ga0182008_10086717
430 Ga0157377_10272099
431 Ga0157377_10288727
432 Ga0157379_10060786
433 Ga0157379_10908209
434 Ga0157376_10498558
435 Ga0163161_10688615
436 Ga0207688_10053554
437 Ga0207647_10019032
438 Ga0207647_10342578
439 Ga0207643_10440355
440 Ga0207662_10073123
441 Ga0207657_10068426
442 Ga0207659_10569336
443 Ga0207690_10016526
444 Ga0207686_10198416
445 Ga0207709_10141071
446 Ga0207704_10010985
447 Ga0207704_10338930
448 Ga0207691_10117466
449 Ga0207661_10011604
450 Ga0207661_10030338
451 Ga0207658_10034723
452 Ga0207658_10548247
453 Ga0207677_10250567
454 Ga0207677_10473832
455 Ga0207703_10049266
456 Ga0207678_10157237
457 Ga0207708_10124727
458 Ga0207708_10127205
459 Ga0207702_10126895
460 Ga0207641_10404643
461 Ga0207674_10042528
462 Ga0207674_10732928
463 Ga0207683_10335125
464 Ga0207683_10643627
465 Ga0209813_10001169
466 Ga0209813_10071333
467 Ga0268264_10001967
468 Ga0268264_10034080
469 Ga0307512_10094543
470 Ga0316181_1103859
471 Ga0307513_10203046
472 Ga0307408_100114360
473 Ga0307405_10311449
474 Ga0307413_10335100
475 Ga0307413_10466685
476 Ga0307518_10135741
477 Ga0307410_10006951
478 Ga0307410_10065964
479 Ga0307410_10171870
480 Ga0307410_10488479
481 Ga0307406_10041290
482 Ga0307407_10041580
483 Ga0307407_10060463
484 Ga0307407_10181580
485 Ga0307407_10443357
486 Ga0307407_10546877
487 Ga0307412_10048086
488 Ga0307412_10054537
489 Ga0307412_10251635
490 Ga0307409_100011357
491 Ga0307409_100033247
492 Ga0307409_100080917
493 Ga0307416_100002929
494 Ga0307416_100013988
495 Ga0307416_100211213
496 Ga0307416_100222066
497 Ga0307414_10405877
498 Ga0307411_10126093
499 Ga0307411_10151645
500 Ga0307411_10198912
501 Ga0307415_100006264
502 Ga0307415_100219659
503 Ga0373960_0123341
504 Ga0395901_0448724
505 Ga0439461_0046354
506 Ga0451793_0246444
507 Ga0451837_0343219
508 Ga0451839_0020397
509 Ga0450907_013017
510 Ga0451577_0304746
511 Ga0451577_0322143
512 Ga0466972_0265180
513 Ga0453683_0008754
514 Ga0466965_0027225
515 Ga0466965_0028405
516 Ga0466966_0030804
517 Ga0466966_0107594
518 Ga0466961_0282214
519 Ga0466961_0322185
520 Ga0466963_0051182
521 Ga0466963_0083506
522 Ga0466963_0086464
523 Ga0466963_0140181
524 Ga0466963_0269188
525 Ga0466964_0045781
526 Ga0453684_0003689
527 Ga0453684_0127172
528 Ga0453684_0147711
529 Ga0466971_0278323
530 Ga0466957_0001115
531 Ga0466957_0042866
532 Ga0466957_0207708
533 Ga0466960_0006974
534 Ga0466960_0020936
535 Ga0466960_0038137
536 Ga0466960_0144611
537 Ga0466960_0203812
538 Ga0466959_0249889
539 Ga0451576_0033349
540 Ga0451576_0566685
541 Ga0466958_0075923
542 Ga0466958_0120758
543 Ga0466967_0000988
544 Ga0466967_0020738
545 Ga0466967_0063937
546 Ga0466967_0068489
547 Ga0466967_0089264
548 Ga0466967_0105236
549 Ga0466967_0818634
550 Ga0495658_0289242
551 Ga0496100_0284232
552 Ga0496101_0101439
553 Ga0496101_0476229
554 Ga0496102_0570936
555 Ga0496102_0724334
556 Ga0496102_0976636
557 Ga0496103_0006700
558 Ga0496103_0069217
559 Ga0496104_0163170
560 Ga0496106_0461298
561 Ga0496107_0125211
562 Ga0496107_0207701
563 Ga0496107_0363916
564 Ga0496108_0008499
565 Ga0496108_0025621
566 Ga0496108_0026740
567 Ga0496109_0003050
568 Ga0496109_0015913
569 Ga0496109_0265877
570 Ga0496109_0790315
571 Ga0496110_0022918
572 Ga0496110_0184121
573 Ga0496110_0247551
574 Ga0496110_0411220
575 Ga0496110_0517872
576 Ga0496111_0237875
577 Ga0496111_0823345
578 Ga0496112_0043626
579 Ga0496113_0031910
580 Ga0496113_0181720
581 Ga0496114_0023844
582 Ga0496114_0058786
583 Ga0496114_0112392
584 Ga0496114_0171901
585 Ga0496122_0255408
586 Ga0501317_003122
587 Ga0501031_0128689
588 Ga0501031_0228305
589 Ga0501031_0458838
590 Ga0501033_0168436
591 Ga0501034_0013243
592 Ga0501034_0013956
593 Ga0501034_0313596
594 Ga0501036_0010035
595 Ga0501036_0193121
596 Ga0501036_0554320
597 Ga0501036_0562841
598 Ga0501037_0024042
599 Ga0501038_0049773
600 Ga0501039_0051464
601 Ga0501039_0177737
602 Ga0501039_0248640
603 Ga0501039_0496618
604 Ga0501041_0145672
605 Ga0501042_0066364
606 Ga0501042_0157969
607 Ga0501043_0106410
608 Ga0501046_0014736
609 Ga0501046_0288388
610 Ga0501047_0167809
611 Ga0501047_0225365
612 Ga0501048_0098734
613 Ga0501067_0004112
614 Ga0501067_0004699
615 Ga0501067_0037470
616 Ga0501067_0199716
617 Ga0501067_0338405
618 Ga0501068_0032369
619 Ga0501068_0036917
620 Ga0501068_0062552
621 Ga0501068_0700807
622 Ga0501069_0004130
623 Ga0501069_0070689
624 Ga0501069_0165905
625 Ga0501069_0243425
626 Ga0501070_0004792
627 Ga0501070_0035442
628 Ga0501070_0571313
629 Ga0501070_0578783
630 Ga0501071_0140843
631 Ga0501071_0200745
632 Ga0501071_0260404
633 Ga0501071_0305844
634 Ga0501071_0545317
635 Ga0501072_0009890
636 Ga0501072_0052375
637 Ga0501073_0019457
638 Ga0501073_0020255
639 Ga0501073_0031017
640 Ga0501073_0431904
641 Ga0501074_0007589
642 Ga0501074_0033630
643 Ga0501074_0084620
644 Ga0501074_0208343
645 Ga0501075_0203319
646 Ga0501075_0320229
647 Ga0501075_0320737
648 Ga0501076_0259863
649 Ga0501076_1159815
650 Ga0501077_0030724
651 Ga0501077_0043306
652 Ga0501079_0032242
653 Ga0501079_0327153
654 Ga0501080_0000857
655 Ga0501080_0013574
656 Ga0501080_0100447
657 Ga0501080_0691538
658 Ga0501083_0020109
659 Ga0501035_0008456
660 Ga0501035_0653687
661 Ga0501044_0005123
662 Ga0501044_0752972
663 Ga0501045_0073793
664 nmdc:mga03683_354079_c1
665 nmdc:mga03n38_2207_c1
666 nmdc:mga00v17_16022_c1
667 nmdc:mga00v17_211844_c1
668 nmdc:mga0yw44_33510_c1
669 nmdc:mga0yw44_38987_c1
670 nmdc:mga0yw44_39593_c1
671 nmdc:mga0yw44_594669_c1
672 nmdc:mga04h51_4510_c1
673 nmdc:mga07m45_9413_c1
674 Ga0495655_0062846
675 Ga0500637_0088142
676 Ga0501084_0022730
677 Ga0501084_0112412
678 Ga0501082_0226341
679 Ga0466962_0061378
680 Ga0530510_0082225
681 Ga0530510_0092008
682 Ga0530510_0345206
683 Ga0530510_0563322
684 2644033900
685 2644102582
686 2644118244
687 2740166561
688 2774393824
689 2809195303
690 2812350178
691 2816424135
692 2855388901
693 2857483229
694 2891972197
695 2984577216
696 2990260891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

23

219

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.9404 2 198
4bnq-assembly1.cif.gz_B the structure of the staphylococcus aureus ham1 protein 0.9311 2 198
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.9176 1 197
1k7k-assembly1.cif.gz_A crystal structure of rdgb- inosine triphosphate pyrophosphatase from e. coli 0.9175 1 201
2pyu-assembly1.cif.gz_A-2 structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with imp 0.9143 1 201
ID Description Score Start End Superfamily
af_P9WMR7_2_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.96 1 197 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9572 1 195 3.90.950.10
af_P9WMR7_2_201_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9414 1 197 3.90.950.10
af_Q2FZC5_1_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9239 1 195 3.90.950.10
1b78B00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9171 4 198 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A1V4G4X8-F1-model_v4 deleted 0.99 64 157
AF-A0A6I3JFN8-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9891 18 199 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A2X1V7D5-F1-model_v4 deleted 0.9872 33 188
AF-A0A255GZ08-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9805 2 200 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A7I8B7A8-F1-model_v4 deleted 0.9799 27 200

Map