F417501

General Info

Members Datasets Scaffolds Average Seq Length
348 251 696 216

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10130586|Ga0099795_101305862
Length 238
Sequence MVRSISDGKAMKRRVAILISGRGSNMAALIKAARAEDFPAEIVVVISNRGDAGGLEKAKASGVPTVTIESKPFGDDRSAFEAVLQSALDQHSIDLICLGGFMRLFTAEFVQRWYGRMLNIHPSLLPSFPGLDPHGQALKAGVKISGATVHFVTPETDAGPILVQGAVAVRDDDTPDMLAARILEVEHRIYPDALRLVAGGLVRLEGDTCKTAGSAGSDVSLISPVVGRLQPSGRSRGE

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
243 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
244 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
245 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
246 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
249 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
250 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
251 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.76
Nodule 0.86
Rhizoplane 10.06
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10130586 3300007788 Bacteria 1013
2 LJQas_1003225 3300000549 Bacteria 2200
3 JGI25406J46586_10002338 3300003203 Bacteria 8955
4 rootH1_10083308 3300003323 Bacteria 2955
5 JGI25404J52841_10015257 3300003659 Bacteria 1667
6 JGI25404J52841_10023614 3300003659 Bacteria 1326
7 Ga0070658_10048865 3300005327 Bacteria 3426
8 Ga0070683_100028736 3300005329 Bacteria 5028
9 Ga0070670_100002788 3300005331 Bacteria 14454
10 Ga0070670_100444858 3300005331 Bacteria 1148
11 Ga0070680_100134703 3300005336 Bacteria 2068
12 Ga0068868_100019306 3300005338 Bacteria 5107
13 Ga0070660_100360369 3300005339 Bacteria 1198
14 Ga0070661_100030328 3300005344 Bacteria 3906
15 Ga0070661_100228651 3300005344 Bacteria 1429
16 Ga0070668_100444108 3300005347 Bacteria 1114
17 Ga0070671_100263427 3300005355 Bacteria 1465
18 Ga0070673_100398719 3300005364 Bacteria 1230
19 Ga0070659_100334411 3300005366 Bacteria 1268
20 Ga0070714_100025261 3300005435 Bacteria 4900
21 Ga0070714_100174294 3300005435 Bacteria 1954
22 Ga0070713_100001137 3300005436 Bacteria 17038
23 Ga0070710_10010976 3300005437 Bacteria 4464
24 Ga0070711_100000787 3300005439 Bacteria 16583
25 Ga0070708_100736623 3300005445 Bacteria 927
26 Ga0070663_100015197 3300005455 Bacteria 4961
27 Ga0070707_100530831 3300005468 Bacteria 1139
28 Ga0070679_100040886 3300005530 Bacteria 4614
29 Ga0070684_100448911 3300005535 Bacteria 1192
30 Ga0070697_100069654 3300005536 Bacteria 2881
31 Ga0068853_100012308 3300005539 Bacteria 6958
32 Ga0070672_100520229 3300005543 Bacteria 1031
33 Ga0070693_100100004 3300005547 Bacteria 1765
34 Ga0070665_100019304 3300005548 Bacteria 6840
35 Ga0070665_100637115 3300005548 Bacteria 1079
36 Ga0070665_100813250 3300005548 Bacteria 947
37 Ga0068855_100078688 3300005563 Bacteria 3824
38 Ga0068855_100423243 3300005563 Bacteria 1456
39 Ga0070664_100169935 3300005564 Bacteria 1934
40 Ga0068857_100152454 3300005577 Bacteria 2094
41 Ga0068856_100079401 3300005614 Bacteria 3253
42 Ga0070702_100340173 3300005615 Bacteria 1053
43 Ga0068852_100013542 3300005616 Bacteria 6243
44 Ga0068852_100201710 3300005616 Bacteria 1882
45 Ga0068852_100242330 3300005616 Bacteria 1724
46 Ga0068861_100839772 3300005719 Bacteria 865
47 Ga0081455_10009327 3300005937 Bacteria 10102
48 Ga0081455_10011624 3300005937 Bacteria 8833
49 Ga0081455_10077242 3300005937 Bacteria 2740
50 Ga0081455_10123334 3300005937 Bacteria 2038
51 Ga0081538_10023766 3300005981 Bacteria 4393
52 Ga0081540_1001754 3300005983 Bacteria 18232
53 Ga0081540_1002687 3300005983 Bacteria 14469
54 Ga0081540_1009115 3300005983 Bacteria 6852
55 Ga0081540_1015423 3300005983 Bacteria 4840
56 Ga0081540_1016329 3300005983 Bacteria 4651
57 Ga0081539_10000735 3300005985 Bacteria 65597
58 Ga0081539_10068483 3300005985 Bacteria 1914
59 Ga0070717_10004596 3300006028 Bacteria 9995
60 Ga0075365_10331969 3300006038 Bacteria 1071
61 Ga0075368_10041765 3300006042 Bacteria 1802
62 Ga0075368_10116228 3300006042 Bacteria 1105
63 Ga0075363_100015196 3300006048 Bacteria 3778
64 Ga0075363_100046367 3300006048 Bacteria 2306
65 Ga0070715_10002356 3300006163 Bacteria 5781
66 Ga0070712_100019777 3300006175 Bacteria 4398
67 Ga0070712_100624164 3300006175 Bacteria 914
68 Ga0075367_10001055 3300006178 Bacteria 11364
69 Ga0075367_10051248 3300006178 Bacteria 2439
70 Ga0097621_100018244 3300006237 Bacteria 5353
71 Ga0075370_10216198 3300006353 Bacteria 1132
72 Ga0068871_100086824 3300006358 Bacteria 2600
73 Ga0068871_100454314 3300006358 Bacteria 1149
74 Ga0075431_100236667 3300006847 Bacteria 1859
75 Ga0075433_10573817 3300006852 Bacteria 991
76 Ga0075434_100239474 3300006871 Bacteria 1835
77 Ga0068865_100538734 3300006881 Bacteria 979
78 Ga0075435_100253676 3300007076 Bacteria 1498
79 Ga0099794_10062410 3300007265 Bacteria 1812
80 Ga0099794_10096553 3300007265 Bacteria 1471
81 Ga0105240_10020403 3300009093 Bacteria 8841
82 Ga0111539_10085824 3300009094 Bacteria 3699
83 Ga0105245_10311379 3300009098 Bacteria 1548
84 Ga0105245_10449862 3300009098 Bacteria 1296
85 Ga0105247_10660246 3300009101 Bacteria 782
86 Ga0114129_10033676 3300009147 Bacteria 7238
87 Ga0105243_10159011 3300009148 Bacteria 1946
88 Ga0105238_10043792 3300009551 Bacteria 4527
89 Ga0105238_10063013 3300009551 Bacteria 3708
90 Ga0105238_10407310 3300009551 Bacteria 1354
91 Ga0099796_10006081 3300010159 Bacteria 3068
92 Ga0099796_10034018 3300010159 Bacteria 1681
93 Ga0105239_10078612 3300010375 Bacteria 3630
94 Ga0105239_10255581 3300010375 Bacteria 1968
95 Ga0105239_10497373 3300010375 Bacteria 1386
96 Ga0105239_11251332 3300010375 Bacteria 856
97 Ga0105246_10074229 3300011119 Bacteria 2404
98 Ga0105246_10269285 3300011119 Bacteria 1361
99 Ga0157369_10000996 3300013105 Bacteria 35806
100 Ga0157378_10001896 3300013297 Bacteria 18775
101 Ga0157378_10399018 3300013297 Bacteria 1355
102 Ga0163162_10250680 3300013306 Bacteria 1902
103 Ga0163162_10384537 3300013306 Bacteria 1537
104 Ga0157372_10764042 3300013307 Bacteria 1124
105 Ga0163163_10701096 3300014325 Bacteria 1076
106 Ga0157379_10209650 3300014968 Bacteria 1763
107 Ga0157379_11069084 3300014968 Bacteria 772
108 Ga0157376_10076151 3300014969 Bacteria 2866
109 Ga0157376_10387228 3300014969 Bacteria 1348
110 Ga0163161_10307803 3300017792 Bacteria 1249
111 Ga0213872_10021809 3300021361 Bacteria 2950
112 Ga0209758_1007667 3300025297 Bacteria 7266
113 Ga0207656_10232054 3300025321 Bacteria 900
114 Ga0207692_10000661 3300025898 Bacteria 12146
115 Ga0207685_10002866 3300025905 Bacteria 4063
116 Ga0207699_10024716 3300025906 Bacteria 3288
117 Ga0207707_10002881 3300025912 Bacteria 15359
118 Ga0207695_10148511 3300025913 Bacteria 2285
119 Ga0207671_10023475 3300025914 Bacteria 4652
120 Ga0207693_10000095 3300025915 Bacteria 78764
121 Ga0207663_10003376 3300025916 Bacteria 7801
122 Ga0207660_10005760 3300025917 Bacteria 8039
123 Ga0207657_10013083 3300025919 Bacteria 8155
124 Ga0207649_10054126 3300025920 Bacteria 2496
125 Ga0207649_10191813 3300025920 Bacteria 1438
126 Ga0207652_10006732 3300025921 Bacteria 9262
127 Ga0207646_10280840 3300025922 Bacteria 1505
128 Ga0207694_10213875 3300025924 Bacteria 1571
129 Ga0207694_10500019 3300025924 Bacteria 1018
130 Ga0207650_10005717 3300025925 Bacteria 8486
131 Ga0207700_10012342 3300025928 Bacteria 5504
132 Ga0207664_10108232 3300025929 Bacteria 2307
133 Ga0207644_10134038 3300025931 Bacteria 1900
134 Ga0207690_10259297 3300025932 Bacteria 1346
135 Ga0207686_10256405 3300025934 Bacteria 1280
136 Ga0207665_10424696 3300025939 Bacteria 1016
137 Ga0207691_10385440 3300025940 Bacteria 1196
138 Ga0207661_10024359 3300025944 Bacteria 4587
139 Ga0207679_10365827 3300025945 Bacteria 1261
140 Ga0207667_10198273 3300025949 Bacteria 2059
141 Ga0207651_10523232 3300025960 Bacteria 1028
142 Ga0207640_10439262 3300025981 Bacteria 1072
143 Ga0207677_10132020 3300026023 Bacteria 1898
144 Ga0207639_10015799 3300026041 Bacteria 5329
145 Ga0207678_10044622 3300026067 Bacteria 3834
146 Ga0207674_10156844 3300026116 Bacteria 2231
147 Ga0207674_10269693 3300026116 Bacteria 1649
148 Ga0207674_10810034 3300026116 Bacteria 904
149 Ga0207698_10014043 3300026142 Bacteria 5308
150 Ga0207698_10025086 3300026142 Bacteria 4194
151 Ga0209179_1043266 3300027512 Bacteria 952
152 Ga0207428_10377633 3300027907 Bacteria 1040
153 Ga0268266_10003536 3300028379 Bacteria 15508
154 Ga0307517_10001000 3300028786 Bacteria 47916
155 Ga0307515_10059361 3300028794 Bacteria 5483
156 Ga0307515_10385609 3300028794 Bacteria 1032
157 Ga0265330_10215401 3300031235 Bacteria 811
158 Ga0265332_10053176 3300031238 Bacteria 1738
159 Ga0265328_10013830 3300031239 Bacteria 3186
160 Ga0265339_10016951 3300031249 Bacteria 4326
161 Ga0265339_10238343 3300031249 Bacteria 884
162 Ga0265331_10024266 3300031250 Bacteria 3070
163 Ga0307513_10108806 3300031456 Bacteria 2771
164 Ga0307509_10224918 3300031507 Bacteria 1685
165 Ga0307509_10362656 3300031507 Bacteria 1168
166 Ga0307508_10223669 3300031616 Bacteria 1482
167 Ga0265314_10041197 3300031711 Bacteria 3308
168 Ga0265342_10031325 3300031712 Bacteria 3289
169 Ga0307516_10006834 3300031730 Bacteria 13300
170 Ga0307516_10196758 3300031730 Bacteria 1738
171 Ga0307405_10162886 3300031731 Bacteria 1582
172 Ga0307412_10171356 3300031911 Bacteria 1623
173 Ga0307416_100982969 3300032002 Bacteria 947
174 Ga0307415_100144658 3300032126 Bacteria 1821
175 Ga0307510_10090553 3300033180 Bacteria 2905
176 Ga0373936_0011608 3300035113 Bacteria 3340
177 Ga0373945_0128896 3300035116 Bacteria 1012
178 Ga0373943_0017423 3300035170 Bacteria 3286
179 Ga0373946_0003494 3300035171 Bacteria 5578
180 Ga0373946_0045114 3300035171 Bacteria 1823
181 Ga0373955_0018251 3300035172 Bacteria 3486
182 Ga0373935_0002523 3300035692 Bacteria 10491
183 Ga0373935_0034006 3300035692 Bacteria 3176
184 Ga0373927_0003588 3300035695 Bacteria 11066
185 Ga0373927_0005981 3300035695 Bacteria 8333
186 Ga0373927_0079841 3300035695 Bacteria 2120
187 Ga0373947_0002253 3300035725 Bacteria 11647
188 Ga0373947_0011580 3300035725 Bacteria 5060
189 Ga0373937_0034481 3300036401 Bacteria 4604
190 Ga0373925_0009658 3300037068 Bacteria 7028
191 Ga0373925_0093977 3300037068 Bacteria 2296
192 Ga0373925_0381926 3300037068 Bacteria 1147
193 Ga0395905_0467950 3300037471 Bacteria 1159
194 Ga0436365_0178602 3300039437 Bacteria 1206
195 Ga0436365_1038904 3300039437 Bacteria 1400
196 Ga0436361_1069367 3300039447 Bacteria 3166
197 Ga0436363_1321564 3300039450 Bacteria 2382
198 Ga0495592_0013852 3300046454 Bacteria 6130
199 Ga0495603_0000329 3300046455 Bacteria 25682
200 Ga0495629_0000355 3300046459 Bacteria 39013
201 Ga0495629_0111716 3300046459 Bacteria 1905
202 Ga0495641_0005203 3300046461 Bacteria 8878
203 Ga0495641_0162165 3300046461 Bacteria 1000
204 Ga0495651_0021184 3300046462 Bacteria 5050
205 Ga0495651_0168725 3300046462 Bacteria 1561
206 Ga0495580_0000744 3300046472 Bacteria 27906
207 Ga0495580_0297282 3300046472 Bacteria 1100
208 Ga0495582_0001995 3300046473 Bacteria 11430
209 Ga0495639_0000061 3300046475 Bacteria 48670
210 Ga0495639_0050640 3300046475 Bacteria 1887
211 Ga0495662_0000232 3300046476 Bacteria 23279
212 Ga0495662_0100383 3300046476 Bacteria 1416
213 Ga0495664_0005365 3300046477 Bacteria 7032
214 Ga0495594_0006906 3300046499 Bacteria 5839
215 Ga0495618_0176550 3300046514 Bacteria 1358
216 Ga0495618_0183280 3300046514 Bacteria 1330
217 Ga0495628_0028879 3300046516 Bacteria 4503
218 Ga0495628_0400793 3300046516 Bacteria 1002
219 Ga0495630_0034714 3300046517 Bacteria 3767
220 Ga0495630_0286491 3300046517 Bacteria 1259
221 Ga0495630_0365696 3300046517 Bacteria 1104
222 Ga0495630_0514798 3300046517 Bacteria 917
223 Ga0495632_0241224 3300046519 Bacteria 813
224 Ga0495644_0013121 3300046523 Bacteria 3183
225 Ga0495648_0009547 3300046524 Bacteria 7489
226 Ga0495663_0103754 3300046525 Bacteria 939
227 Ga0495666_0057999 3300046526 Bacteria 1853
228 Ga0495665_0000414 3300046531 Bacteria 21734
229 Ga0495640_0001092 3300046533 Bacteria 21130
230 Ga0495586_0202116 3300046535 Bacteria 1126
231 Ga0495609_0137473 3300046538 Bacteria 1044
232 Ga0495622_0002318 3300046557 Bacteria 9265
233 Ga0495667_0002936 3300046559 Bacteria 11444
234 Ga0495656_0207789 3300046615 Bacteria 974
235 Ga0495634_0000762 3300046642 Bacteria 31177
236 Ga0495635_0000187 3300046663 Bacteria 39002
237 Ga0495588_0019803 3300046674 Bacteria 3301
238 Ga0495588_0246857 3300046674 Bacteria 941
239 Ga0495623_0318239 3300046679 Bacteria 855
240 Ga0495646_0100491 3300046680 Bacteria 1659
241 Ga0495647_0001739 3300046681 Bacteria 6755
242 Ga0495658_0000047 3300046683 Bacteria 59626
243 Ga0495658_0171476 3300046683 Bacteria 1343
244 Ga0495613_0001104 3300046689 Bacteria 20593
245 Ga0495613_0082301 3300046689 Bacteria 2338
246 Ga0495613_0142033 3300046689 Bacteria 1715
247 Ga0495624_0000188 3300046690 Bacteria 46706
248 Ga0495624_0062655 3300046690 Bacteria 2326
249 Ga0495600_0041005 3300046809 Bacteria 3017
250 Ga0495581_0000705 3300047315 Bacteria 17570
251 Ga0495581_0058504 3300047315 Bacteria 2226
252 Ga0495581_0221357 3300047315 Bacteria 1107
253 Ga0495674_0112027 3300047319 Bacteria 2312
254 Ga0495672_0168647 3300047320 Bacteria 1119
255 Ga0495676_0066933 3300047321 Bacteria 2781
256 Ga0495680_0069998 3300047322 Bacteria 2676
257 Ga0495685_082582 3300047447 Bacteria 1069
258 Ga0495684_0080301 3300047471 Bacteria 2476
259 Ga0495684_0205050 3300047471 Bacteria 1452
260 Ga0495593_0000616 3300047673 Bacteria 20328
261 Ga0495593_0064376 3300047673 Bacteria 1914
262 Ga0495614_0079381 3300048089 Bacteria 1421
263 Ga0496100_0044495 3300048903 Bacteria 2844
264 Ga0496101_0101772 3300048904 Bacteria 2151
265 Ga0496101_0143911 3300048904 Bacteria 1819
266 Ga0496102_0267474 3300048905 Bacteria 1612
267 Ga0496103_0001588 3300048906 Bacteria 14972
268 Ga0496104_0028904 3300048907 Bacteria 5140
269 Ga0496104_0242393 3300048907 Bacteria 1715
270 Ga0496105_0000888 3300048908 Bacteria 20456
271 Ga0496105_0066481 3300048908 Bacteria 2976
272 Ga0496106_0003256 3300048909 Bacteria 12144
273 Ga0496106_0018512 3300048909 Bacteria 5151
274 Ga0496107_0007506 3300048910 Bacteria 7521
275 Ga0496107_0021431 3300048910 Bacteria 4567
276 Ga0496107_0442021 3300048910 Bacteria 966
277 Ga0496108_0086370 3300048911 Bacteria 2663
278 Ga0496109_0003074 3300048912 Bacteria 13919
279 Ga0496109_0068452 3300048912 Bacteria 3254
280 Ga0496109_0238438 3300048912 Bacteria 1711
281 Ga0496109_0464831 3300048912 Bacteria 1195
282 Ga0496110_0205388 3300048913 Bacteria 1790
283 Ga0496110_0252986 3300048913 Bacteria 1603
284 Ga0496111_0002095 3300048914 Bacteria 11901
285 Ga0496111_0069315 3300048914 Bacteria 2564
286 Ga0496112_0006496 3300048915 Bacteria 10276
287 Ga0496112_0031486 3300048915 Bacteria 5146
288 Ga0496112_0057413 3300048915 Bacteria 3832
289 Ga0496112_0098990 3300048915 Bacteria 2885
290 Ga0496113_0000604 3300048916 Bacteria 17909
291 Ga0496113_0083752 3300048916 Bacteria 2447
292 Ga0496114_0018578 3300048917 Bacteria 5624
293 Ga0496114_1061627 3300048917 Bacteria 694
294 Ga0496115_0005600 3300048918 Bacteria 9141
295 Ga0496115_0019151 3300048918 Bacteria 5266
296 Ga0496115_0073998 3300048918 Bacteria 2766
297 Ga0496115_0253550 3300048918 Bacteria 1448
298 Ga0496117_0025815 3300048920 Bacteria 4608
299 Ga0496118_0049578 3300048921 Bacteria 3232
300 Ga0496118_0184144 3300048921 Bacteria 1258
301 Ga0496124_0027999 3300048927 Bacteria 5045
302 Ga0496124_0212112 3300048927 Bacteria 1464
303 Ga0496124_0421399 3300048927 Bacteria 920
304 Ga0496125_0081617 3300048928 Bacteria 2469
305 Ga0501031_0006250 3300049568 Bacteria 7766
306 Ga0501033_0000519 3300049570 Bacteria 36092
307 Ga0501036_0117285 3300049572 Bacteria 2248
308 Ga0501037_0002906 3300049573 Bacteria 12423
309 Ga0501038_0030465 3300049574 Bacteria 4774
310 Ga0501039_0005655 3300049575 Bacteria 9465
311 Ga0501042_0408026 3300049578 Bacteria 984
312 Ga0501046_0008899 3300049580 Bacteria 8714
313 Ga0501069_0124484 3300049585 Bacteria 1474
314 Ga0501073_0039175 3300049589 Bacteria 3359
315 Ga0501077_0288198 3300049593 Bacteria 1045
316 Ga0501079_0310915 3300049741 Bacteria 1233
317 Ga0501035_0060014 3300049822 Bacteria 3386
318 Ga0501044_0025530 3300049823 Bacteria 6263
319 Ga0501045_0460004 3300049824 Bacteria 946
320 nmdc:mga03n38_235627_c1 3300050490 Bacteria 961
321 nmdc:mga03n38_31577_c1 3300050490 Bacteria 2236
322 nmdc:mga0yw44_21766_c1 3300050492 Bacteria 3583
323 nmdc:mga0k408_123376_c1 3300050493 Bacteria 1535
324 nmdc:mga06z11_3824_c1 3300050494 Bacteria 5864
325 nmdc:mga07m45_148679_c1 3300050496 Bacteria 1358
326 nmdc:mga07m45_196821_c1 3300050496 Bacteria 1172
327 nmdc:mga05p37_3144_c1 3300050507 Bacteria 10267
328 nmdc:mga09592_251412_c1 3300050508 Bacteria 1532
329 nmdc:mga06r32_225610_c1 3300050510 Bacteria 1862
330 nmdc:mga08y16_130433_c1 3300050511 Bacteria 2614
331 Ga0495601_0029020 3300053077 Bacteria 3429
332 Ga0495612_0065084 3300053078 Bacteria 1514
333 Ga0495619_0010637 3300053085 Bacteria 5790
334 Ga0500566_0279640 3300053094 Bacteria 796
335 Ga0500641_0190126 3300053096 Bacteria 879
336 Ga0500572_000172 3300053111 Bacteria 22845
337 Ga0500572_064632 3300053111 Bacteria 1119
338 Ga0500595_002125 3300053119 Bacteria 10100
339 Ga0500614_094241 3300053123 Bacteria 855
340 Ga0500590_116261 3300053148 Bacteria 1260
341 Ga0500603_001508 3300053150 Bacteria 5304
342 Ga0500637_0082258 3300053178 Bacteria 1860
343 Ga0500576_183418 3300053725 Bacteria 735
344 Ga0500645_029226 3300053730 Bacteria 1664
345 2723845015 2721755755 Bacteria 8322773
346 2874605270 2874604998 Bacteria 7834745
347 8006986470 8006984368 Bacteria 9651211
348 8006995961 8006994254 Bacteria 8309700
349 Ga0099795_10130586
350 LJQas_1003225
351 JGI25406J46586_10002338
352 rootH1_10083308
353 JGI25404J52841_10015257
354 JGI25404J52841_10023614
355 Ga0070658_10048865
356 Ga0070683_100028736
357 Ga0070670_100002788
358 Ga0070670_100444858
359 Ga0070680_100134703
360 Ga0068868_100019306
361 Ga0070660_100360369
362 Ga0070661_100030328
363 Ga0070661_100228651
364 Ga0070668_100444108
365 Ga0070671_100263427
366 Ga0070673_100398719
367 Ga0070659_100334411
368 Ga0070714_100025261
369 Ga0070714_100174294
370 Ga0070713_100001137
371 Ga0070710_10010976
372 Ga0070711_100000787
373 Ga0070708_100736623
374 Ga0070663_100015197
375 Ga0070707_100530831
376 Ga0070679_100040886
377 Ga0070684_100448911
378 Ga0070697_100069654
379 Ga0068853_100012308
380 Ga0070672_100520229
381 Ga0070693_100100004
382 Ga0070665_100019304
383 Ga0070665_100637115
384 Ga0070665_100813250
385 Ga0068855_100078688
386 Ga0068855_100423243
387 Ga0070664_100169935
388 Ga0068857_100152454
389 Ga0068856_100079401
390 Ga0070702_100340173
391 Ga0068852_100013542
392 Ga0068852_100201710
393 Ga0068852_100242330
394 Ga0068861_100839772
395 Ga0081455_10009327
396 Ga0081455_10011624
397 Ga0081455_10077242
398 Ga0081455_10123334
399 Ga0081538_10023766
400 Ga0081540_1001754
401 Ga0081540_1002687
402 Ga0081540_1009115
403 Ga0081540_1015423
404 Ga0081540_1016329
405 Ga0081539_10000735
406 Ga0081539_10068483
407 Ga0070717_10004596
408 Ga0075365_10331969
409 Ga0075368_10041765
410 Ga0075368_10116228
411 Ga0075363_100015196
412 Ga0075363_100046367
413 Ga0070715_10002356
414 Ga0070712_100019777
415 Ga0070712_100624164
416 Ga0075367_10001055
417 Ga0075367_10051248
418 Ga0097621_100018244
419 Ga0075370_10216198
420 Ga0068871_100086824
421 Ga0068871_100454314
422 Ga0075431_100236667
423 Ga0075433_10573817
424 Ga0075434_100239474
425 Ga0068865_100538734
426 Ga0075435_100253676
427 Ga0099794_10062410
428 Ga0099794_10096553
429 Ga0105240_10020403
430 Ga0111539_10085824
431 Ga0105245_10311379
432 Ga0105245_10449862
433 Ga0105247_10660246
434 Ga0114129_10033676
435 Ga0105243_10159011
436 Ga0105238_10043792
437 Ga0105238_10063013
438 Ga0105238_10407310
439 Ga0099796_10006081
440 Ga0099796_10034018
441 Ga0105239_10078612
442 Ga0105239_10255581
443 Ga0105239_10497373
444 Ga0105239_11251332
445 Ga0105246_10074229
446 Ga0105246_10269285
447 Ga0157369_10000996
448 Ga0157378_10001896
449 Ga0157378_10399018
450 Ga0163162_10250680
451 Ga0163162_10384537
452 Ga0157372_10764042
453 Ga0163163_10701096
454 Ga0157379_10209650
455 Ga0157379_11069084
456 Ga0157376_10076151
457 Ga0157376_10387228
458 Ga0163161_10307803
459 Ga0213872_10021809
460 Ga0209758_1007667
461 Ga0207656_10232054
462 Ga0207692_10000661
463 Ga0207685_10002866
464 Ga0207699_10024716
465 Ga0207707_10002881
466 Ga0207695_10148511
467 Ga0207671_10023475
468 Ga0207693_10000095
469 Ga0207663_10003376
470 Ga0207660_10005760
471 Ga0207657_10013083
472 Ga0207649_10054126
473 Ga0207649_10191813
474 Ga0207652_10006732
475 Ga0207646_10280840
476 Ga0207694_10213875
477 Ga0207694_10500019
478 Ga0207650_10005717
479 Ga0207700_10012342
480 Ga0207664_10108232
481 Ga0207644_10134038
482 Ga0207690_10259297
483 Ga0207686_10256405
484 Ga0207665_10424696
485 Ga0207691_10385440
486 Ga0207661_10024359
487 Ga0207679_10365827
488 Ga0207667_10198273
489 Ga0207651_10523232
490 Ga0207640_10439262
491 Ga0207677_10132020
492 Ga0207639_10015799
493 Ga0207678_10044622
494 Ga0207674_10156844
495 Ga0207674_10269693
496 Ga0207674_10810034
497 Ga0207698_10014043
498 Ga0207698_10025086
499 Ga0209179_1043266
500 Ga0207428_10377633
501 Ga0268266_10003536
502 Ga0307517_10001000
503 Ga0307515_10059361
504 Ga0307515_10385609
505 Ga0265330_10215401
506 Ga0265332_10053176
507 Ga0265328_10013830
508 Ga0265339_10016951
509 Ga0265339_10238343
510 Ga0265331_10024266
511 Ga0307513_10108806
512 Ga0307509_10224918
513 Ga0307509_10362656
514 Ga0307508_10223669
515 Ga0265314_10041197
516 Ga0265342_10031325
517 Ga0307516_10006834
518 Ga0307516_10196758
519 Ga0307405_10162886
520 Ga0307412_10171356
521 Ga0307416_100982969
522 Ga0307415_100144658
523 Ga0307510_10090553
524 Ga0373936_0011608
525 Ga0373945_0128896
526 Ga0373943_0017423
527 Ga0373946_0003494
528 Ga0373946_0045114
529 Ga0373955_0018251
530 Ga0373935_0002523
531 Ga0373935_0034006
532 Ga0373927_0003588
533 Ga0373927_0005981
534 Ga0373927_0079841
535 Ga0373947_0002253
536 Ga0373947_0011580
537 Ga0373937_0034481
538 Ga0373925_0009658
539 Ga0373925_0093977
540 Ga0373925_0381926
541 Ga0395905_0467950
542 Ga0436365_0178602
543 Ga0436365_1038904
544 Ga0436361_1069367
545 Ga0436363_1321564
546 Ga0495592_0013852
547 Ga0495603_0000329
548 Ga0495629_0000355
549 Ga0495629_0111716
550 Ga0495641_0005203
551 Ga0495641_0162165
552 Ga0495651_0021184
553 Ga0495651_0168725
554 Ga0495580_0000744
555 Ga0495580_0297282
556 Ga0495582_0001995
557 Ga0495639_0000061
558 Ga0495639_0050640
559 Ga0495662_0000232
560 Ga0495662_0100383
561 Ga0495664_0005365
562 Ga0495594_0006906
563 Ga0495618_0176550
564 Ga0495618_0183280
565 Ga0495628_0028879
566 Ga0495628_0400793
567 Ga0495630_0034714
568 Ga0495630_0286491
569 Ga0495630_0365696
570 Ga0495630_0514798
571 Ga0495632_0241224
572 Ga0495644_0013121
573 Ga0495648_0009547
574 Ga0495663_0103754
575 Ga0495666_0057999
576 Ga0495665_0000414
577 Ga0495640_0001092
578 Ga0495586_0202116
579 Ga0495609_0137473
580 Ga0495622_0002318
581 Ga0495667_0002936
582 Ga0495656_0207789
583 Ga0495634_0000762
584 Ga0495635_0000187
585 Ga0495588_0019803
586 Ga0495588_0246857
587 Ga0495623_0318239
588 Ga0495646_0100491
589 Ga0495647_0001739
590 Ga0495658_0000047
591 Ga0495658_0171476
592 Ga0495613_0001104
593 Ga0495613_0082301
594 Ga0495613_0142033
595 Ga0495624_0000188
596 Ga0495624_0062655
597 Ga0495600_0041005
598 Ga0495581_0000705
599 Ga0495581_0058504
600 Ga0495581_0221357
601 Ga0495674_0112027
602 Ga0495672_0168647
603 Ga0495676_0066933
604 Ga0495680_0069998
605 Ga0495685_082582
606 Ga0495684_0080301
607 Ga0495684_0205050
608 Ga0495593_0000616
609 Ga0495593_0064376
610 Ga0495614_0079381
611 Ga0496100_0044495
612 Ga0496101_0101772
613 Ga0496101_0143911
614 Ga0496102_0267474
615 Ga0496103_0001588
616 Ga0496104_0028904
617 Ga0496104_0242393
618 Ga0496105_0000888
619 Ga0496105_0066481
620 Ga0496106_0003256
621 Ga0496106_0018512
622 Ga0496107_0007506
623 Ga0496107_0021431
624 Ga0496107_0442021
625 Ga0496108_0086370
626 Ga0496109_0003074
627 Ga0496109_0068452
628 Ga0496109_0238438
629 Ga0496109_0464831
630 Ga0496110_0205388
631 Ga0496110_0252986
632 Ga0496111_0002095
633 Ga0496111_0069315
634 Ga0496112_0006496
635 Ga0496112_0031486
636 Ga0496112_0057413
637 Ga0496112_0098990
638 Ga0496113_0000604
639 Ga0496113_0083752
640 Ga0496114_0018578
641 Ga0496114_1061627
642 Ga0496115_0005600
643 Ga0496115_0019151
644 Ga0496115_0073998
645 Ga0496115_0253550
646 Ga0496117_0025815
647 Ga0496118_0049578
648 Ga0496118_0184144
649 Ga0496124_0027999
650 Ga0496124_0212112
651 Ga0496124_0421399
652 Ga0496125_0081617
653 Ga0501031_0006250
654 Ga0501033_0000519
655 Ga0501036_0117285
656 Ga0501037_0002906
657 Ga0501038_0030465
658 Ga0501039_0005655
659 Ga0501042_0408026
660 Ga0501046_0008899
661 Ga0501069_0124484
662 Ga0501073_0039175
663 Ga0501077_0288198
664 Ga0501079_0310915
665 Ga0501035_0060014
666 Ga0501044_0025530
667 Ga0501045_0460004
668 nmdc:mga03n38_235627_c1
669 nmdc:mga03n38_31577_c1
670 nmdc:mga0yw44_21766_c1
671 nmdc:mga0k408_123376_c1
672 nmdc:mga06z11_3824_c1
673 nmdc:mga07m45_148679_c1
674 nmdc:mga07m45_196821_c1
675 nmdc:mga05p37_3144_c1
676 nmdc:mga09592_251412_c1
677 nmdc:mga06r32_225610_c1
678 nmdc:mga08y16_130433_c1
679 Ga0495601_0029020
680 Ga0495612_0065084
681 Ga0495619_0010637
682 Ga0500566_0279640
683 Ga0500641_0190126
684 Ga0500572_000172
685 Ga0500572_064632
686 Ga0500595_002125
687 Ga0500614_094241
688 Ga0500590_116261
689 Ga0500603_001508
690 Ga0500637_0082258
691 Ga0500576_183418
692 Ga0500645_029226
693 2723845015
694 2874605270
695 8006986470
696 8006995961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

13

194

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gar-assembly1.cif.gz_A a ph-dependent stablization of an active site loop observed from low and high ph crystal structures of mutant monomeric glycinamide ribonucleotide transformylase 0.9288 4 199
1grc-assembly1.cif.gz_A crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy 0.9234 4 199
1cdd-assembly2.cif.gz_B-2 structures of apo and complexed escherichia coli glycinamide ribonucleotide transformylase 0.9144 1 199
1grc-assembly1.cif.gz_B crystal structure of glycinamide ribonucleotide transformylase from escherichia coli at 3.0 angstroms resolution: a target enzyme for chemotherapy 0.9113 4 201
1gar-assembly1.cif.gz_A towards structure-based drug design: crystal structure of a multisubstrate adduct complex of glycinamide ribonucleotide transformylase at 1.96 angstroms resolution 0.9051 4 199
ID Description Score Start End Superfamily
1cddB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9144 1 199 3.40.50.170
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8912 2 190 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8814 2 199 3.40.50.170
af_Q2FZI7_1_188_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8811 3 185 3.40.50.170
4ds3A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.8803 1 195 3.40.50.170
ID Description Score Start End GO Terms
AF-Q7ZUW1-F1-model_v4 deleted 0.9731 2 104
AF-A0A7C5SBW3-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9693 1 81 GO:0004644
GO:0005829
GO:0006189
AF-A0A836PTE4-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9272 3 81 GO:0004644
GO:0005737
GO:0006189
AF-A0A7C5SBW3-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9244 1 81 GO:0004644
GO:0005829
GO:0006189
AF-A0A258J1C2-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9071 2 204 GO:0004644
GO:0005829
GO:0006189

Map