F417232

General Info

Members Datasets Scaffolds Average Seq Length
347 203 344 233

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0009535|Ga0439436_0009535_89_913
Length 274
Sequence MSHAGYGLACTCLSVMNAIKQISKGAGFIVCDYFHFSITKTWLYMQTNNSNSSSRRDFLGKLAAGAAALGTVSLAPFEAQANQELTDNEFADVEAWFNKIKGKHRIVFDATQPHELMPFAWPKVFLLTNEATGTPQKDCSVVVVLRHDAIPYALQSDLWAKYKMGELFKAHDPNTKEPATFNPFWKPKQDFKIPGIGSVPIAINQLQENGVMFCVCNMAITVYSAVAADMMKMDVEAVKKEWLAGVLPNIQVVPSGVWALGRAQEKGCTYCFAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
5 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
192 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
193 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
196 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
197 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0.58
Isolates 0.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.78
Nodule 0
Rhizoplane 0.29
Rhizosphere 85.88
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_275614 2162886007 Bacteria 1482
2 JGI24736J21556_1022231 3300001904 Bacteria 992
3 JGI24737J22298_10037799 3300001990 Bacteria 1487
4 JGI24744J21845_10010759 3300002077 Bacteria 1873
5 JGI25158J39367_1001972 3300002739 Bacteria 3451
6 JGI25406J46586_10000452 3300003203 Bacteria 19098
7 rootH1_10068501 3300003316 Bacteria 5822
8 rootH2_10002560 3300003320 Bacteria 75599
9 rootH2_10046291 3300003320 Unclassified 2717
10 rootH2_10316767 3300003320 Bacteria 1515
11 rootL2_10102094 3300003322 Bacteria 5489
12 rootL2_10190341 3300003322 Bacteria 1963
13 rootH1_10032311 3300003323 Bacteria 34322
14 rootH1_10043852 3300003323 Unclassified 2223
15 rootH1_10045658 3300003323 Bacteria 10051
16 rootH1_10099773 3300003323 Bacteria 2012
17 rootH1_10171563 3300003323 Bacteria 8936
18 Ga0055531_10000071 3300003794 Bacteria 110534
19 Ga0065704_10002380 3300005289 Bacteria 9001
20 Ga0070658_10114424 3300005327 Bacteria 2237
21 Ga0070676_10004515 3300005328 Bacteria 7325
22 Ga0070676_10162562 3300005328 Bacteria 1438
23 Ga0070683_100348457 3300005329 Bacteria 1410
24 Ga0070670_100019954 3300005331 Bacteria 5754
25 Ga0070670_100245427 3300005331 Unclassified 1559
26 Ga0068869_100111410 3300005334 Bacteria 2082
27 Ga0070666_10000126 3300005335 Bacteria 53667
28 Ga0070666_10008953 3300005335 Bacteria 6231
29 Ga0068868_100029130 3300005338 Bacteria 4227
30 Ga0068868_100081443 3300005338 Bacteria 2595
31 Ga0068868_100083514 3300005338 Bacteria 2564
32 Ga0068868_100398601 3300005338 Bacteria 1187
33 Ga0068868_100470478 3300005338 Bacteria 1096
34 Ga0070660_100112927 3300005339 Bacteria 2163
35 Ga0070668_100118861 3300005347 Bacteria 2110
36 Ga0070669_100437515 3300005353 Bacteria 1076
37 Ga0070675_100085651 3300005354 Bacteria 2633
38 Ga0070671_100018765 3300005355 Bacteria 5622
39 Ga0070671_100084438 3300005355 Unclassified 2656
40 Ga0070671_100374924 3300005355 Unclassified 1216
41 Ga0070673_100045825 3300005364 Bacteria 3393
42 Ga0070673_100206623 3300005364 Bacteria 1693
43 Ga0070688_100215227 3300005365 Unclassified 1351
44 Ga0070688_100388833 3300005365 Unclassified 1030
45 Ga0070659_100023814 3300005366 Bacteria 4688
46 Ga0070667_100013166 3300005367 Bacteria 6838
47 Ga0070667_100014521 3300005367 Bacteria 6508
48 Ga0070667_100079839 3300005367 Unclassified 2798
49 Ga0070667_100516094 3300005367 Bacteria 1096
50 Ga0070714_100003252 3300005435 Bacteria 12091
51 Ga0070678_100097706 3300005456 Bacteria 2269
52 Ga0070662_100003640 3300005457 Bacteria 9620
53 Ga0068867_100023470 3300005459 Bacteria 4415
54 Ga0068867_100178352 3300005459 Bacteria 1687
55 Ga0070685_10067557 3300005466 Bacteria 2109
56 Ga0070698_100162060 3300005471 Bacteria 2180
57 Ga0068853_100043402 3300005539 Bacteria 3846
58 Ga0070672_100106412 3300005543 Unclassified 2282
59 Ga0070665_100327848 3300005548 Unclassified 1535
60 Ga0070665_100813143 3300005548 Unclassified 948
61 Ga0068855_100002500 3300005563 Bacteria 22644
62 Ga0068855_100079016 3300005563 Bacteria 3816
63 Ga0068855_100140284 3300005563 Unclassified 2756
64 Ga0068857_100036020 3300005577 Bacteria 4384
65 Ga0068857_100520752 3300005577 Bacteria 1118
66 Ga0068857_100644843 3300005577 Unclassified 1003
67 Ga0068856_100013918 3300005614 Bacteria 7781
68 Ga0068856_100041235 3300005614 Bacteria 4536
69 Ga0068852_100067239 3300005616 Unclassified 3133
70 Ga0068852_100406999 3300005616 Bacteria 1339
71 Ga0068859_100000003 3300005617 Bacteria 479218
72 Ga0068859_100168449 3300005617 Bacteria 2271
73 Ga0068859_100208177 3300005617 Bacteria 2042
74 Ga0068859_100853246 3300005617 Bacteria 997
75 Ga0068851_10045672 3300005834 Bacteria 2214
76 Ga0068863_100011282 3300005841 Bacteria 8656
77 Ga0068863_100131720 3300005841 Bacteria 2387
78 Ga0068863_100748018 3300005841 Unclassified 973
79 Ga0068863_100852449 3300005841 Unclassified 910
80 Ga0068858_100133211 3300005842 Unclassified 2331
81 Ga0068860_100001494 3300005843 Bacteria 25241
82 Ga0068860_100115061 3300005843 Unclassified 2572
83 Ga0081539_10001418 3300005985 Bacteria 41265
84 Ga0075366_10177853 3300006195 Bacteria 1292
85 Ga0097621_100000057 3300006237 Bacteria 58430
86 Ga0097621_100025126 3300006237 Bacteria 4658
87 Ga0097621_100224359 3300006237 Bacteria 1638
88 Ga0068871_100005032 3300006358 Bacteria 9233
89 Ga0068871_100008780 3300006358 Bacteria 7277
90 Ga0068871_100206620 3300006358 Bacteria 1697
91 Ga0068871_100347572 3300006358 Unclassified 1311
92 Ga0075428_100734361 3300006844 Bacteria 1051
93 Ga0075430_100216197 3300006846 Unclassified 1590
94 Ga0075431_100091273 3300006847 Bacteria 3144
95 Ga0075429_100154710 3300006880 Bacteria 2008
96 Ga0068865_100001571 3300006881 Bacteria 13348
97 Ga0068865_100146776 3300006881 Unclassified 1785
98 Ga0097620_100000003 3300006931 Bacteria 479218
99 Ga0097620_100168442 3300006931 Bacteria 2271
100 Ga0097620_100208186 3300006931 Bacteria 2042
101 Ga0097620_100853145 3300006931 Bacteria 997
102 Ga0105240_10016067 3300009093 Bacteria 10144
103 Ga0105240_10061350 3300009093 Bacteria 4686
104 Ga0105240_10086085 3300009093 Unclassified 3849
105 Ga0105240_10092603 3300009093 Bacteria 3690
106 Ga0111539_10000601 3300009094 Bacteria 46564
107 Ga0111539_10007987 3300009094 Bacteria 13498
108 Ga0105245_10026380 3300009098 Bacteria 5114
109 Ga0105247_10001884 3300009101 Bacteria 14669
110 Ga0105247_10005677 3300009101 Bacteria 7818
111 Ga0105247_10180357 3300009101 Unclassified 1409
112 Ga0114129_10018358 3300009147 Bacteria 9962
113 Ga0114129_10311667 3300009147 Bacteria 2094
114 Ga0105241_10006881 3300009174 Bacteria 8368
115 Ga0105241_10011811 3300009174 Bacteria 6415
116 Ga0105241_10062823 3300009174 Bacteria 2864
117 Ga0105241_10071024 3300009174 Bacteria 2703
118 Ga0105241_10080578 3300009174 Bacteria 2549
119 Ga0105242_10123551 3300009176 Bacteria 2225
120 Ga0105237_10011680 3300009545 Bacteria 9291
121 Ga0105237_10067808 3300009545 Bacteria 3561
122 Ga0105237_10400847 3300009545 Bacteria 1377
123 Ga0105237_10581441 3300009545 Unclassified 1127
124 Ga0105249_10004788 3300009553 Bacteria 11685
125 Ga0105249_10016590 3300009553 Bacteria 6536
126 Ga0105249_10140759 3300009553 Bacteria 2313
127 Ga0105249_10725802 3300009553 Bacteria 1055
128 Ga0105239_10000940 3300010375 Bacteria 41071
129 Ga0105239_10068718 3300010375 Bacteria 3893
130 Ga0105239_10069095 3300010375 Bacteria 3881
131 Ga0105239_10098351 3300010375 Bacteria 3235
132 Ga0105246_10004891 3300011119 Bacteria 8163
133 Ga0105246_10022078 3300011119 Bacteria 4104
134 Ga0105246_10054258 3300011119 Bacteria 2761
135 Ga0105246_10066192 3300011119 Bacteria 2529
136 Ga0157373_10019941 3300013100 Bacteria 4878
137 Ga0157373_10025592 3300013100 Bacteria 4267
138 Ga0157371_10010648 3300013102 Bacteria 7145
139 Ga0157371_10173127 3300013102 Bacteria 1543
140 Ga0157370_10167051 3300013104 Bacteria 2046
141 Ga0157374_10009683 3300013296 Bacteria 8275
142 Ga0157374_10050376 3300013296 Bacteria 3870
143 Ga0157374_10188832 3300013296 Bacteria 2015
144 Ga0157378_10008645 3300013297 Bacteria 8861
145 Ga0157378_10111805 3300013297 Unclassified 2505
146 Ga0157378_10119075 3300013297 Bacteria 2431
147 Ga0163162_10000446 3300013306 Bacteria 38191
148 Ga0163162_10001945 3300013306 Bacteria 19409
149 Ga0163162_10337165 3300013306 Bacteria 1640
150 Ga0157372_10000354 3300013307 Bacteria 50294
151 Ga0157372_10043228 3300013307 Bacteria 4988
152 Ga0157375_10110811 3300013308 Bacteria 2843
153 Ga0157375_10292639 3300013308 Bacteria 1792
154 Ga0163163_10079480 3300014325 Bacteria 3278
155 Ga0163163_10426895 3300014325 Bacteria 1385
156 Ga0157380_10010278 3300014326 Bacteria 6728
157 Ga0157380_10522278 3300014326 Bacteria 1158
158 Ga0157379_10370655 3300014968 Bacteria 1313
159 Ga0157376_10000952 3300014969 Bacteria 18849
160 Ga0157376_10302141 3300014969 Bacteria 1515
161 Ga0163161_10187300 3300017792 Bacteria 1589
162 Ga0206350_11114677 3300020080 Unclassified 931
163 Ga0213872_10004900 3300021361 Bacteria 6977
164 Ga0209436_103736 3300025208 Bacteria 3940
165 Ga0209233_1001157 3300025261 Bacteria 10711
166 Ga0209130_1000510 3300025284 Bacteria 39344
167 Ga0207426_1000024 3300025302 Bacteria 534075
168 Ga0209257_1000001 3300025304 Bacteria 2274655
169 Ga0207710_10001225 3300025900 Bacteria 13013
170 Ga0207710_10134264 3300025900 Bacteria 1190
171 Ga0207680_10000054 3300025903 Bacteria 54305
172 Ga0207680_10041555 3300025903 Bacteria 2684
173 Ga0207647_10001052 3300025904 Bacteria 21267
174 Ga0207647_10028995 3300025904 Bacteria 3587
175 Ga0207645_10170368 3300025907 Bacteria 1427
176 Ga0207645_10236033 3300025907 Bacteria 1208
177 Ga0207654_10002228 3300025911 Bacteria 9952
178 Ga0207654_10045090 3300025911 Bacteria 2508
179 Ga0207654_10069934 3300025911 Bacteria 2082
180 Ga0207654_10164586 3300025911 Bacteria 1435
181 Ga0207695_10011283 3300025913 Bacteria 10833
182 Ga0207695_10015243 3300025913 Bacteria 9062
183 Ga0207695_10093600 3300025913 Bacteria 3014
184 Ga0207695_10146632 3300025913 Bacteria 2303
185 Ga0207671_10003032 3300025914 Bacteria 17202
186 Ga0207662_10414502 3300025918 Bacteria 916
187 Ga0207657_10046915 3300025919 Bacteria 3782
188 Ga0207650_10061918 3300025925 Bacteria 2795
189 Ga0207650_10191743 3300025925 Bacteria 1633
190 Ga0207687_10080965 3300025927 Bacteria 2345
191 Ga0207644_10015789 3300025931 Bacteria 5077
192 Ga0207644_10420008 3300025931 Unclassified 1095
193 Ga0207690_10127137 3300025932 Bacteria 1860
194 Ga0207706_10008208 3300025933 Bacteria 9632
195 Ga0207686_10052139 3300025934 Unclassified 2552
196 Ga0207686_10153447 3300025934 Bacteria 1606
197 Ga0207704_10000052 3300025938 Bacteria 80866
198 Ga0207704_10549554 3300025938 Unclassified 938
199 Ga0207689_10003937 3300025942 Bacteria 13516
200 Ga0207661_10390502 3300025944 Unclassified 1261
201 Ga0207667_10014706 3300025949 Bacteria 8907
202 Ga0207667_10170900 3300025949 Bacteria 2234
203 Ga0207667_11024179 3300025949 Bacteria 812
204 Ga0207651_10048772 3300025960 Bacteria 2865
205 Ga0207651_10117662 3300025960 Bacteria 2008
206 Ga0207651_10355185 3300025960 Bacteria 1235
207 Ga0207712_10070220 3300025961 Bacteria 2515
208 Ga0207712_10204399 3300025961 Bacteria 1568
209 Ga0207668_10217474 3300025972 Bacteria 1532
210 Ga0207658_10010424 3300025986 Bacteria 6312
211 Ga0207658_10041780 3300025986 Bacteria 3322
212 Ga0207677_10009524 3300026023 Bacteria 5467
213 Ga0207677_10052188 3300026023 Unclassified 2777
214 Ga0207677_10108733 3300026023 Bacteria 2060
215 Ga0207703_10307583 3300026035 Unclassified 1448
216 Ga0207639_10078494 3300026041 Bacteria 2606
217 Ga0207639_10278520 3300026041 Bacteria 1470
218 Ga0207702_10034439 3300026078 Bacteria 4233
219 Ga0207702_10061886 3300026078 Bacteria 3194
220 Ga0207641_10000026 3300026088 Bacteria 245091
221 Ga0207648_10012469 3300026089 Bacteria 7959
222 Ga0207648_10070437 3300026089 Bacteria 3048
223 Ga0207674_10074543 3300026116 Bacteria 3405
224 Ga0207674_10110057 3300026116 Unclassified 2730
225 Ga0207674_10128008 3300026116 Unclassified 2504
226 Ga0207674_10444970 3300026116 Bacteria 1252
227 Ga0207683_10095076 3300026121 Bacteria 2656
228 Ga0207698_10142547 3300026142 Unclassified 2067
229 Ga0207698_10804225 3300026142 Bacteria 942
230 Ga0207428_10272921 3300027907 Bacteria 1257
231 Ga0268266_10154286 3300028379 Bacteria 2073
232 Ga0268266_10304328 3300028379 Unclassified 1488
233 Ga0268266_10665158 3300028379 Unclassified 1003
234 Ga0268264_10000558 3300028381 Bacteria 45913
235 Ga0268264_10014235 3300028381 Bacteria 6540
236 Ga0268264_10147504 3300028381 Bacteria 2105
237 Ga0265318_10070037 3300028577 Bacteria 1300
238 Ga0307511_10000263 3300030521 Bacteria 54309
239 Ga0307513_10158849 3300031456 Bacteria 2156
240 Ga0307513_10229071 3300031456 Bacteria 1672
241 Ga0307509_10191986 3300031507 Unclassified 1892
242 Ga0307509_10301769 3300031507 Unclassified 1349
243 Ga0265313_10010479 3300031595 Bacteria 5855
244 Ga0265313_10067875 3300031595 Bacteria 1649
245 Ga0307413_10611993 3300031824 Unclassified 893
246 Ga0307407_10314952 3300031903 Unclassified 1096
247 Ga0307412_10811705 3300031911 Bacteria 813
248 Ga0307409_100425607 3300031995 Bacteria 1275
249 Ga0307416_100001254 3300032002 Bacteria 13691
250 Ga0307414_10122658 3300032004 Bacteria 2001
251 Ga0307414_10190815 3300032004 Unclassified 1658
252 Ga0307414_10334816 3300032004 Unclassified 1293
253 Ga0307414_10887227 3300032004 Unclassified 817
254 Ga0307415_100087718 3300032126 Bacteria 2243
255 Ga0373925_0184367 3300037068 Bacteria 1654
256 Ga0395899_0000237 3300037312 Bacteria 74249
257 Ga0395899_0000286 3300037312 Bacteria 65138
258 Ga0395899_0077898 3300037312 Unclassified 2417
259 Ga0395900_0000143 3300037418 Bacteria 120234
260 Ga0395900_0002189 3300037418 Bacteria 21852
261 Ga0395898_0021010 3300037466 Bacteria 6623
262 Ga0395898_0145857 3300037466 Unclassified 2265
263 Ga0395898_0500190 3300037466 Bacteria 1156
264 Ga0395905_0000045 3300037471 Bacteria 241370
265 Ga0395905_0000765 3300037471 Bacteria 42351
266 Ga0395905_0575197 3300037471 Bacteria 1028
267 Ga0395901_0002501 3300038443 Bacteria 18608
268 Ga0395901_0015030 3300038443 Bacteria 7871
269 Ga0395901_0106836 3300038443 Bacteria 2938
270 Ga0436365_1568995 3300039437 Bacteria 925
271 Ga0436361_0668324 3300039447 Bacteria 8414
272 Ga0439436_0009535 3300041404 Bacteria 2977
273 Ga0439439_0012295 3300041406 Unclassified 2068
274 Ga0451807_0757209 3300041486 Unclassified 906
275 Ga0451853_2026878 3300041512 Bacteria 3132
276 Ga0439448_0086179 3300042005 Unclassified 1058
277 Ga0439449_0013688 3300042007 Bacteria 3053
278 Ga0439449_0049857 3300042007 Bacteria 1549
279 Ga0439457_015293 3300042014 Bacteria 1714
280 Ga0466969_0000759 3300044656 Bacteria 17514
281 Ga0466972_0000049 3300044658 Bacteria 118829
282 Ga0466966_0000015 3300044684 Bacteria 127402
283 Ga0453684_0051536 3300044712 Bacteria 5393
284 Ga0453684_0191509 3300044712 Unclassified 2392
285 Ga0466971_0145259 3300044719 Bacteria 1106
286 Ga0466970_0146664 3300044765 Bacteria 1302
287 Ga0466957_0002564 3300044842 Bacteria 9778
288 Ga0466959_0000345 3300045049 Bacteria 27482
289 Ga0466959_0284991 3300045049 Bacteria 1133
290 Ga0495625_0162540 3300046660 Unclassified 1495
291 Ga0495625_0236787 3300046660 Bacteria 1190
292 Ga0495672_0016079 3300047320 Bacteria 5058
293 Ga0495672_0155386 3300047320 Bacteria 1182
294 Ga0495687_003195 3300047443 Bacteria 12159
295 Ga0496126_0060042 3300048929 Bacteria 3422
296 Ga0501031_0007547 3300049568 Bacteria 7083
297 Ga0501034_0135604 3300049571 Bacteria 2442
298 Ga0501036_0003696 3300049572 Bacteria 12254
299 Ga0501036_0043783 3300049572 Bacteria 3791
300 Ga0501038_0180493 3300049574 Bacteria 1703
301 Ga0501039_0065490 3300049575 Unclassified 2819
302 Ga0501039_0356838 3300049575 Bacteria 1148
303 Ga0501043_0056617 3300049579 Bacteria 3080
304 Ga0501046_0001780 3300049580 Bacteria 20573
305 Ga0501047_0143292 3300049581 Bacteria 2267
306 Ga0501048_0006414 3300049582 Bacteria 8939
307 Ga0501073_0085817 3300049589 Unclassified 2189
308 Ga0501074_0001010 3300049590 Bacteria 18288
309 Ga0501233_037506 3300049668 Bacteria 1126
310 Ga0501257_026796 3300049686 Bacteria 1377
311 Ga0501225_0005724 3300049705 Unclassified 3641
312 Ga0501234_039097 3300049707 Unclassified 775
313 Ga0501079_0266040 3300049741 Bacteria 1340
314 Ga0501083_0004260 3300049744 Bacteria 10070
315 Ga0501035_0028276 3300049822 Bacteria 5119
316 Ga0501044_0048035 3300049823 Bacteria 4411
317 Ga0501044_0142479 3300049823 Bacteria 2385
318 nmdc:mga0k408_164967_c1 3300050493 Bacteria 1320
319 nmdc:mga05p37_13430_c1 3300050507 Bacteria 9815
320 nmdc:mga05p37_546191_c1 3300050507 Bacteria 1320
321 nmdc:mga09592_115725_c1 3300050508 Bacteria 2301
322 nmdc:mga0qj67_172140_c1 3300050509 Bacteria 1758
323 nmdc:mga08y16_154622_c1 3300050511 Bacteria 2384
324 nmdc:mga08y16_29373_c1 3300050511 Bacteria 5793
325 Ga0500578_0000605 3300053086 Bacteria 43458
326 Ga0500644_0000474 3300053088 Bacteria 17719
327 Ga0500646_0012739 3300053090 Bacteria 2173
328 Ga0500646_0031245 3300053090 Bacteria 1465
329 Ga0500583_0000055 3300053092 Bacteria 72367
330 Ga0500583_0000692 3300053092 Bacteria 9847
331 Ga0500569_000231 3300053109 Bacteria 8896
332 Ga0500608_001592 3300053122 Bacteria 8153
333 Ga0500658_0001473 3300053134 Bacteria 9403
334 Ga0500577_0004190 3300053142 Unclassified 3793
335 Ga0500588_0185321 3300053146 Unclassified 766
336 Ga0500616_0030480 3300053153 Bacteria 2962
337 Ga0500616_0038507 3300053153 Unclassified 2582
338 Ga0500622_0003105 3300053156 Bacteria 11430
339 Ga0500622_0012821 3300053156 Bacteria 4530
340 Ga0500633_0008188 3300053160 Bacteria 2680
341 Ga0500636_0065896 3300053177 Bacteria 2107
342 Ga0500636_0120039 3300053177 Bacteria 1476
343 Ga0501084_0077745 3300054114 Bacteria 2782
344 Ga0587109_037617 3300059624 Bacteria 947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10665158 Ga0268266_106651582 182
2 3300049707 Ga0501234_039097 Ga0501234_039097_21_632 203
3 3300050511 nmdc:mga08y16_154622_c1 nmdc:mga08y16_154622_c1_76_702 203
4 3300031903 Ga0307407_10314952 Ga0307407_103149521 205
5 3300009094 Ga0111539_10000601 Ga0111539_100006014 206
6 3300050509 nmdc:mga0qj67_172140_c1 nmdc:mga0qj67_172140_c1_861_1496 206
7 3300053146 Ga0500588_0185321 Ga0500588_0185321_128_748 206
8 3300031995 Ga0307409_100425607 Ga0307409_1004256072 216
9 3300032002 Ga0307416_100001254 Ga0307416_1000012549 216
10 3300032126 Ga0307415_100087718 Ga0307415_1000877183 216
11 3300006846 Ga0075430_100216197 Ga0075430_1002161972 217
12 3300010375 Ga0105239_10068718 Ga0105239_100687182 217
13 3300027907 Ga0207428_10272921 Ga0207428_102729212 217
14 3300005548 Ga0070665_100813143 Ga0070665_1008131431 219
15 3300009094 Ga0111539_10007987 Ga0111539_100079879 219
16 3300014326 Ga0157380_10010278 Ga0157380_100102789 219
17 3300031824 Ga0307413_10611993 Ga0307413_106119931 219
18 3300050511 nmdc:mga08y16_29373_c1 nmdc:mga08y16_29373_c1_3784_4458 219
19 3300044712 Ga0453684_0191509 Ga0453684_0191509_87_758 220
20 3300041486 Ga0451807_0757209 Ga0451807_0757209_46_711 221
21 3300006844 Ga0075428_100734361 Ga0075428_1007343612 224
22 3300006847 Ga0075431_100091273 Ga0075431_1000912735 224
23 3300006880 Ga0075429_100154710 Ga0075429_1001547103 224
24 3300009147 Ga0114129_10311667 Ga0114129_103116671 224
25 3300050507 nmdc:mga05p37_546191_c1 nmdc:mga05p37_546191_c1_67_762 224
26 3300050508 nmdc:mga09592_115725_c1 nmdc:mga09592_115725_c1_903_1598 224
27 3300049823 Ga0501044_0142479 Ga0501044_0142479_65_748 226
28 3300003323 rootH1_10043852 rootH1_100438522 227
29 3300005331 Ga0070670_100019954 Ga0070670_1000199543 227
30 3300005563 Ga0068855_100002500 Ga0068855_10000250020 227
31 3300005577 Ga0068857_100036020 Ga0068857_1000360206 227
32 3300005614 Ga0068856_100041235 Ga0068856_1000412355 227
33 3300009093 Ga0105240_10092603 Ga0105240_100926034 227
34 3300009174 Ga0105241_10062823 Ga0105241_100628234 227
35 3300010375 Ga0105239_10000940 Ga0105239_1000094042 227
36 3300013296 Ga0157374_10188832 Ga0157374_101888322 227
37 3300025911 Ga0207654_10164586 Ga0207654_101645862 227
38 3300025913 Ga0207695_10093600 Ga0207695_100936004 227
39 3300025925 Ga0207650_10191743 Ga0207650_101917432 227
40 3300025949 Ga0207667_10014706 Ga0207667_100147065 227
41 3300026078 Ga0207702_10034439 Ga0207702_100344394 227
42 3300026116 Ga0207674_10074543 Ga0207674_100745432 227
43 3300044712 Ga0453684_0051536 Ga0453684_0051536_1432_2130 227
44 3300044719 Ga0466971_0145259 Ga0466971_0145259_369_1052 227
45 3300045049 Ga0466959_0284991 Ga0466959_0284991_238_921 227
46 iso_pu_bacteria 2738541278 2738725532 227
47 iso_pu_bacteria 2883068021 2883071814 227
48 3300025944 Ga0207661_10390502 Ga0207661_103905022 228
49 3300039437 Ga0436365_1568995 Ga0436365_1568995_200_886 228
50 3300044656 Ga0466969_0000759 Ga0466969_0000759_15929_16615 228
51 3300044684 Ga0466966_0000015 Ga0466966_0000015_7418_8104 228
52 3300044765 Ga0466970_0146664 Ga0466970_0146664_80_766 228
53 3300045049 Ga0466959_0000345 Ga0466959_0000345_19379_20065 228
54 3300003203 JGI25406J46586_10000452 JGI25406J46586_1000045221 229
55 3300003322 rootL2_10102094 rootL2_101020942 229
56 3300005338 Ga0068868_100470478 Ga0068868_1004704781 229
57 3300005985 Ga0081539_10001418 Ga0081539_1000141836 229
58 3300009093 Ga0105240_10061350 Ga0105240_100613503 229
59 3300009174 Ga0105241_10071024 Ga0105241_100710242 229
60 3300009545 Ga0105237_10581441 Ga0105237_105814412 229
61 3300025913 Ga0207695_10146632 Ga0207695_101466322 229
62 iso_pu_bacteria 2818991460 2819681281 229
63 3300003316 rootH1_10068501 rootH1_100685015 230
64 3300003320 rootH2_10046291 rootH2_100462914 230
65 3300003323 rootH1_10032311 rootH1_100323112 230
66 3300005471 Ga0070698_100162060 Ga0070698_1001620602 230
67 3300005614 Ga0068856_100013918 Ga0068856_1000139184 230
68 3300005843 Ga0068860_100001494 Ga0068860_1000014942 230
69 3300006195 Ga0075366_10177853 Ga0075366_101778532 230
70 3300025918 Ga0207662_10414502 Ga0207662_104145021 230
71 3300026078 Ga0207702_10061886 Ga0207702_100618862 230
72 3300028381 Ga0268264_10000558 Ga0268264_100005589 230
73 3300031456 Ga0307513_10229071 Ga0307513_102290712 230
74 3300031507 Ga0307509_10191986 Ga0307509_101919862 230
75 3300031911 Ga0307412_10811705 Ga0307412_108117051 230
76 3300037312 Ga0395899_0077898 Ga0395899_0077898_580_1275 230
77 3300037418 Ga0395900_0002189 Ga0395900_0002189_1023_1718 230
78 3300037466 Ga0395898_0145857 Ga0395898_0145857_1012_1707 230
79 3300037471 Ga0395905_0000765 Ga0395905_0000765_9861_10556 230
80 3300038443 Ga0395901_0015030 Ga0395901_0015030_3653_4348 230
81 3300041404 Ga0439436_0009535 Ga0439436_0009535_89_913 230
82 3300042007 Ga0439449_0013688 Ga0439449_0013688_2189_3013 230
83 3300042014 Ga0439457_015293 Ga0439457_015293_492_1316 230
84 3300049581 Ga0501047_0143292 Ga0501047_0143292_259_951 230
85 3300049686 Ga0501257_026796 Ga0501257_026796_342_1034 230
86 3300049705 Ga0501225_0005724 Ga0501225_0005724_1289_1981 230
87 3300050493 nmdc:mga0k408_164967_c1 nmdc:mga0k408_164967_c1_327_1019 230
88 3300053090 Ga0500646_0012739 Ga0500646_0012739_49_741 230
89 3300053092 Ga0500583_0000692 Ga0500583_0000692_2274_2966 230
90 3300053156 Ga0500622_0012821 Ga0500622_0012821_1559_2251 230
91 3300001904 JGI24736J21556_1022231 JGI24736J21556_10222312 231
92 3300001990 JGI24737J22298_10037799 JGI24737J22298_100377992 231
93 3300003323 rootH1_10099773 rootH1_100997732 231
94 3300005327 Ga0070658_10114424 Ga0070658_101144242 231
95 3300005329 Ga0070683_100348457 Ga0070683_1003484571 231
96 3300005335 Ga0070666_10008953 Ga0070666_100089536 231
97 3300005339 Ga0070660_100112927 Ga0070660_1001129272 231
98 3300005366 Ga0070659_100023814 Ga0070659_1000238141 231
99 3300005367 Ga0070667_100014521 Ga0070667_1000145216 231
100 3300005457 Ga0070662_100003640 Ga0070662_1000036409 231
101 3300005459 Ga0068867_100178352 Ga0068867_1001783521 231
102 3300005563 Ga0068855_100079016 Ga0068855_1000790165 231
103 3300005577 Ga0068857_100520752 Ga0068857_1005207522 231
104 3300005577 Ga0068857_100644843 Ga0068857_1006448432 231
105 3300005617 Ga0068859_100208177 Ga0068859_1002081772 231
106 3300005841 Ga0068863_100748018 Ga0068863_1007480181 231
107 3300005842 Ga0068858_100133211 Ga0068858_1001332112 231
108 3300006931 Ga0097620_100208186 Ga0097620_1002081862 231
109 3300009093 Ga0105240_10086085 Ga0105240_100860853 231
110 3300009147 Ga0114129_10018358 Ga0114129_100183586 231
111 3300009174 Ga0105241_10006881 Ga0105241_100068819 231
112 3300009553 Ga0105249_10016590 Ga0105249_100165907 231
113 3300009553 Ga0105249_10725802 Ga0105249_107258022 231
114 3300011119 Ga0105246_10054258 Ga0105246_100542583 231
115 3300013100 Ga0157373_10019941 Ga0157373_100199415 231
116 3300013100 Ga0157373_10025592 Ga0157373_100255921 231
117 3300013102 Ga0157371_10173127 Ga0157371_101731271 231
118 3300013104 Ga0157370_10167051 Ga0157370_101670511 231
119 3300013296 Ga0157374_10009683 Ga0157374_100096831 231
120 3300013307 Ga0157372_10000354 Ga0157372_1000035444 231
121 3300014325 Ga0163163_10426895 Ga0163163_104268952 231
122 3300020080 Ga0206350_11114677 Ga0206350_111146771 231
123 3300025261 Ga0209233_1001157 Ga0209233_10011579 231
124 3300025903 Ga0207680_10041555 Ga0207680_100415553 231
125 3300025904 Ga0207647_10001052 Ga0207647_100010524 231
126 3300025904 Ga0207647_10028995 Ga0207647_100289954 231
127 3300025911 Ga0207654_10045090 Ga0207654_100450901 231
128 3300025913 Ga0207695_10015243 Ga0207695_100152432 231
129 3300025919 Ga0207657_10046915 Ga0207657_100469154 231
130 3300025932 Ga0207690_10127137 Ga0207690_101271371 231
131 3300025933 Ga0207706_10008208 Ga0207706_100082083 231
132 3300025934 Ga0207686_10052139 Ga0207686_100521392 231
133 3300025949 Ga0207667_10170900 Ga0207667_101709001 231
134 3300025949 Ga0207667_11024179 Ga0207667_110241791 231
135 3300025961 Ga0207712_10070220 Ga0207712_100702203 231
136 3300025961 Ga0207712_10204399 Ga0207712_102043992 231
137 3300025986 Ga0207658_10041780 Ga0207658_100417803 231
138 3300026035 Ga0207703_10307583 Ga0207703_103075832 231
139 3300026041 Ga0207639_10078494 Ga0207639_100784942 231
140 3300026116 Ga0207674_10128008 Ga0207674_101280081 231
141 3300026116 Ga0207674_10444970 Ga0207674_104449702 231
142 3300026142 Ga0207698_10804225 Ga0207698_108042251 231
143 3300028379 Ga0268266_10154286 Ga0268266_101542862 231
144 3300028381 Ga0268264_10147504 Ga0268264_101475043 231
145 3300031456 Ga0307513_10158849 Ga0307513_101588491 231
146 3300032004 Ga0307414_10122658 Ga0307414_101226582 231
147 3300032004 Ga0307414_10334816 Ga0307414_103348162 231
148 3300037068 Ga0373925_0184367 Ga0373925_0184367_455_1150 231
149 3300037312 Ga0395899_0000286 Ga0395899_0000286_8581_9276 231
150 3300037418 Ga0395900_0000143 Ga0395900_0000143_115447_116142 231
151 3300037466 Ga0395898_0021010 Ga0395898_0021010_5709_6404 231
152 3300037466 Ga0395898_0500190 Ga0395898_0500190_383_1078 231
153 3300037471 Ga0395905_0000045 Ga0395905_0000045_154770_155465 231
154 3300038443 Ga0395901_0002501 Ga0395901_0002501_10571_11266 231
155 3300038443 Ga0395901_0106836 Ga0395901_0106836_580_1275 231
156 3300041512 Ga0451853_2026878 Ga0451853_2026878_2090_2785 231
157 3300042007 Ga0439449_0049857 Ga0439449_0049857_520_1314 231
158 3300044658 Ga0466972_0000049 Ga0466972_0000049_70903_71598 231
159 3300044842 Ga0466957_0002564 Ga0466957_0002564_8759_9454 231
160 3300046660 Ga0495625_0236787 Ga0495625_0236787_121_867 231
161 3300049568 Ga0501031_0007547 Ga0501031_0007547_2879_3574 231
162 3300049572 Ga0501036_0043783 Ga0501036_0043783_3005_3700 231
163 3300049575 Ga0501039_0356838 Ga0501039_0356838_123_818 231
164 3300049579 Ga0501043_0056617 Ga0501043_0056617_1784_2479 231
165 3300050507 nmdc:mga05p37_13430_c1 nmdc:mga05p37_13430_c1_6785_7480 231
166 3300053086 Ga0500578_0000605 Ga0500578_0000605_8400_9095 231
167 3300053092 Ga0500583_0000055 Ga0500583_0000055_41157_41852 231
168 3300053177 Ga0500636_0065896 Ga0500636_0065896_597_1292 231
169 3300053177 Ga0500636_0120039 Ga0500636_0120039_240_935 231
170 3300059624 Ga0587109_037617 Ga0587109_037617_232_927 231
171 3300002077 JGI24744J21845_10010759 JGI24744J21845_100107591 232
172 3300002739 JGI25158J39367_1001972 JGI25158J39367_10019724 232
173 3300003320 rootH2_10002560 rootH2_1000256071 232
174 3300003323 rootH1_10045658 rootH1_100456583 232
175 3300003794 Ga0055531_10000071 Ga0055531_1000007125 232
176 3300005328 Ga0070676_10004515 Ga0070676_100045156 232
177 3300005338 Ga0068868_100081443 Ga0068868_1000814434 232
178 3300005353 Ga0070669_100437515 Ga0070669_1004375151 232
179 3300005355 Ga0070671_100018765 Ga0070671_1000187653 232
180 3300005364 Ga0070673_100206623 Ga0070673_1002066232 232
181 3300005367 Ga0070667_100516094 Ga0070667_1005160942 232
182 3300005456 Ga0070678_100097706 Ga0070678_1000977062 232
183 3300005459 Ga0068867_100023470 Ga0068867_1000234705 232
184 3300005539 Ga0068853_100043402 Ga0068853_1000434024 232
185 3300005616 Ga0068852_100406999 Ga0068852_1004069992 232
186 3300006237 Ga0097621_100000057 Ga0097621_10000005757 232
187 3300006358 Ga0068871_100005032 Ga0068871_1000050325 232
188 3300006358 Ga0068871_100206620 Ga0068871_1002066202 232
189 3300006881 Ga0068865_100001571 Ga0068865_10000157112 232
190 3300009101 Ga0105247_10005677 Ga0105247_100056773 232
191 3300009174 Ga0105241_10080578 Ga0105241_100805782 232
192 3300009176 Ga0105242_10123551 Ga0105242_101235511 232
193 3300009545 Ga0105237_10067808 Ga0105237_100678082 232
194 3300009553 Ga0105249_10140759 Ga0105249_101407593 232
195 3300010375 Ga0105239_10069095 Ga0105239_100690953 232
196 3300010375 Ga0105239_10098351 Ga0105239_100983512 232
197 3300011119 Ga0105246_10066192 Ga0105246_100661922 232
198 3300013102 Ga0157371_10010648 Ga0157371_1001064810 232
199 3300013296 Ga0157374_10050376 Ga0157374_100503763 232
200 3300013297 Ga0157378_10111805 Ga0157378_101118053 232
201 3300013306 Ga0163162_10000446 Ga0163162_1000044633 232
202 3300013307 Ga0157372_10043228 Ga0157372_100432285 232
203 3300014968 Ga0157379_10370655 Ga0157379_103706552 232
204 3300021361 Ga0213872_10004900 Ga0213872_100049001 232
205 3300025208 Ga0209436_103736 Ga0209436_1037363 232
206 3300025284 Ga0209130_1000510 Ga0209130_100051030 232
207 3300025302 Ga0207426_1000024 Ga0207426_100002420 232
208 3300025304 Ga0209257_1000001 Ga0209257_1000001613 232
209 3300025900 Ga0207710_10001225 Ga0207710_1000122511 232
210 3300025907 Ga0207645_10236033 Ga0207645_102360331 232
211 3300025911 Ga0207654_10069934 Ga0207654_100699342 232
212 3300025931 Ga0207644_10015789 Ga0207644_100157894 232
213 3300025934 Ga0207686_10153447 Ga0207686_101534472 232
214 3300025938 Ga0207704_10000052 Ga0207704_1000005267 232
215 3300025960 Ga0207651_10355185 Ga0207651_103551851 232
216 3300026023 Ga0207677_10108733 Ga0207677_101087332 232
217 3300026041 Ga0207639_10278520 Ga0207639_102785202 232
218 3300026089 Ga0207648_10012469 Ga0207648_100124695 232
219 3300026121 Ga0207683_10095076 Ga0207683_100950762 232
220 3300037312 Ga0395899_0000237 Ga0395899_0000237_20582_21280 232
221 3300039447 Ga0436361_0668324 Ga0436361_0668324_467_1165 232
222 3300042005 Ga0439448_0086179 Ga0439448_0086179_148_846 232
223 3300047443 Ga0495687_003195 Ga0495687_003195_10053_10751 232
224 3300048929 Ga0496126_0060042 Ga0496126_0060042_1888_2586 232
225 3300049571 Ga0501034_0135604 Ga0501034_0135604_324_1022 232
226 3300049572 Ga0501036_0003696 Ga0501036_0003696_1420_2118 232
227 3300049574 Ga0501038_0180493 Ga0501038_0180493_893_1591 232
228 3300049575 Ga0501039_0065490 Ga0501039_0065490_1826_2524 232
229 3300049580 Ga0501046_0001780 Ga0501046_0001780_4509_5207 232
230 3300049582 Ga0501048_0006414 Ga0501048_0006414_890_1588 232
231 3300049589 Ga0501073_0085817 Ga0501073_0085817_72_770 232
232 3300049590 Ga0501074_0001010 Ga0501074_0001010_16171_16869 232
233 3300049741 Ga0501079_0266040 Ga0501079_0266040_324_1022 232
234 3300049744 Ga0501083_0004260 Ga0501083_0004260_4718_5416 232
235 3300049822 Ga0501035_0028276 Ga0501035_0028276_2475_3173 232
236 3300049823 Ga0501044_0048035 Ga0501044_0048035_2168_2866 232
237 3300053122 Ga0500608_001592 Ga0500608_001592_3874_4572 232
238 3300054114 Ga0501084_0077745 Ga0501084_0077745_1519_2217 232
239 3300005338 Ga0068868_100398601 Ga0068868_1003986011 233
240 3300005354 Ga0070675_100085651 Ga0070675_1000856513 233
241 3300005364 Ga0070673_100045825 Ga0070673_1000458252 233
242 3300005435 Ga0070714_100003252 Ga0070714_10000325211 233
243 3300005617 Ga0068859_100853246 Ga0068859_1008532462 233
244 3300005841 Ga0068863_100852449 Ga0068863_1008524492 233
245 3300006237 Ga0097621_100224359 Ga0097621_1002243591 233
246 3300006358 Ga0068871_100008780 Ga0068871_10000878011 233
247 3300006881 Ga0068865_100146776 Ga0068865_1001467761 233
248 3300006931 Ga0097620_100853145 Ga0097620_1008531452 233
249 3300009545 Ga0105237_10400847 Ga0105237_104008471 233
250 3300011119 Ga0105246_10004891 Ga0105246_100048912 233
251 3300013297 Ga0157378_10119075 Ga0157378_101190753 233
252 3300014326 Ga0157380_10522278 Ga0157380_105222782 233
253 3300014969 Ga0157376_10000952 Ga0157376_1000095213 233
254 3300025938 Ga0207704_10549554 Ga0207704_105495541 233
255 3300025960 Ga0207651_10048772 Ga0207651_100487722 233
256 3300026116 Ga0207674_10110057 Ga0207674_101100573 233
257 3300030521 Ga0307511_10000263 Ga0307511_1000026343 233
258 3300031507 Ga0307509_10301769 Ga0307509_103017691 233
259 3300032004 Ga0307414_10190815 Ga0307414_101908153 233
260 3300032004 Ga0307414_10887227 Ga0307414_108872271 233
261 3300037471 Ga0395905_0575197 Ga0395905_0575197_212_913 233
262 3300041406 Ga0439439_0012295 Ga0439439_0012295_187_966 233
263 3300046660 Ga0495625_0162540 Ga0495625_0162540_470_1228 233
264 3300047320 Ga0495672_0016079 Ga0495672_0016079_957_1661 233
265 3300047320 Ga0495672_0155386 Ga0495672_0155386_185_886 233
266 3300049668 Ga0501233_037506 Ga0501233_037506_66_767 233
267 3300053088 Ga0500644_0000474 Ga0500644_0000474_10581_11282 233
268 3300053160 Ga0500633_0008188 Ga0500633_0008188_841_1542 233
269 3300003320 rootH2_10316767 rootH2_103167672 234
270 3300003322 rootL2_10190341 rootL2_101903412 234
271 3300003323 rootH1_10171563 rootH1_101715632 234
272 3300005331 Ga0070670_100245427 Ga0070670_1002454272 234
273 3300005334 Ga0068869_100111410 Ga0068869_1001114103 234
274 3300005335 Ga0070666_10000126 Ga0070666_100001267 234
275 3300005338 Ga0068868_100029130 Ga0068868_1000291304 234
276 3300005338 Ga0068868_100083514 Ga0068868_1000835143 234
277 3300005347 Ga0070668_100118861 Ga0070668_1001188612 234
278 3300005355 Ga0070671_100084438 Ga0070671_1000844383 234
279 3300005355 Ga0070671_100374924 Ga0070671_1003749241 234
280 3300005365 Ga0070688_100215227 Ga0070688_1002152272 234
281 3300005365 Ga0070688_100388833 Ga0070688_1003888332 234
282 3300005367 Ga0070667_100013166 Ga0070667_1000131666 234
283 3300005367 Ga0070667_100079839 Ga0070667_1000798393 234
284 3300005466 Ga0070685_10067557 Ga0070685_100675572 234
285 3300005543 Ga0070672_100106412 Ga0070672_1001064122 234
286 3300005548 Ga0070665_100327848 Ga0070665_1003278482 234
287 3300005563 Ga0068855_100140284 Ga0068855_1001402842 234
288 3300005616 Ga0068852_100067239 Ga0068852_1000672392 234
289 3300005617 Ga0068859_100000003 Ga0068859_10000000376 234
290 3300005617 Ga0068859_100168449 Ga0068859_1001684492 234
291 3300005834 Ga0068851_10045672 Ga0068851_100456723 234
292 3300005841 Ga0068863_100011282 Ga0068863_10001128212 234
293 3300005841 Ga0068863_100131720 Ga0068863_1001317203 234
294 3300005843 Ga0068860_100115061 Ga0068860_1001150612 234
295 3300006237 Ga0097621_100025126 Ga0097621_1000251262 234
296 3300006358 Ga0068871_100347572 Ga0068871_1003475722 234
297 3300006931 Ga0097620_100000003 Ga0097620_10000000376 234
298 3300006931 Ga0097620_100168442 Ga0097620_1001684422 234
299 3300009093 Ga0105240_10016067 Ga0105240_100160673 234
300 3300009098 Ga0105245_10026380 Ga0105245_100263802 234
301 3300009101 Ga0105247_10001884 Ga0105247_1000188413 234
302 3300009101 Ga0105247_10180357 Ga0105247_101803572 234
303 3300009174 Ga0105241_10011811 Ga0105241_100118113 234
304 3300009545 Ga0105237_10011680 Ga0105237_100116804 234
305 3300009553 Ga0105249_10004788 Ga0105249_100047882 234
306 3300011119 Ga0105246_10022078 Ga0105246_100220783 234
307 3300013297 Ga0157378_10008645 Ga0157378_1000864512 234
308 3300013306 Ga0163162_10001945 Ga0163162_1000194510 234
309 3300013306 Ga0163162_10337165 Ga0163162_103371652 234
310 3300013308 Ga0157375_10110811 Ga0157375_101108113 234
311 3300013308 Ga0157375_10292639 Ga0157375_102926393 234
312 3300014325 Ga0163163_10079480 Ga0163163_100794802 234
313 3300014969 Ga0157376_10302141 Ga0157376_103021412 234
314 3300017792 Ga0163161_10187300 Ga0163161_101873002 234
315 3300025900 Ga0207710_10134264 Ga0207710_101342642 234
316 3300025903 Ga0207680_10000054 Ga0207680_100000549 234
317 3300025911 Ga0207654_10002228 Ga0207654_1000222811 234
318 3300025913 Ga0207695_10011283 Ga0207695_100112833 234
319 3300025914 Ga0207671_10003032 Ga0207671_100030326 234
320 3300025925 Ga0207650_10061918 Ga0207650_100619182 234
321 3300025927 Ga0207687_10080965 Ga0207687_100809653 234
322 3300025931 Ga0207644_10420008 Ga0207644_104200082 234
323 3300025942 Ga0207689_10003937 Ga0207689_1000393713 234
324 3300025960 Ga0207651_10117662 Ga0207651_101176622 234
325 3300025972 Ga0207668_10217474 Ga0207668_102174742 234
326 3300025986 Ga0207658_10010424 Ga0207658_100104246 234
327 3300026023 Ga0207677_10009524 Ga0207677_100095244 234
328 3300026023 Ga0207677_10052188 Ga0207677_100521882 234
329 3300026088 Ga0207641_10000026 Ga0207641_1000002667 234
330 3300026142 Ga0207698_10142547 Ga0207698_101425472 234
331 3300028379 Ga0268266_10304328 Ga0268266_103043282 234
332 3300028381 Ga0268264_10014235 Ga0268264_100142353 234
333 3300031595 Ga0265313_10067875 Ga0265313_100678751 234
334 3300053090 Ga0500646_0031245 Ga0500646_0031245_531_1235 234
335 3300053109 Ga0500569_000231 Ga0500569_000231_1173_1877 234
336 3300053134 Ga0500658_0001473 Ga0500658_0001473_7558_8262 234
337 3300053142 Ga0500577_0004190 Ga0500577_0004190_1967_2671 234
338 3300053153 Ga0500616_0038507 Ga0500616_0038507_484_1188 234
339 3300053156 Ga0500622_0003105 Ga0500622_0003105_6784_7488 234
340 3300005328 Ga0070676_10162562 Ga0070676_101625621 235
341 3300025907 Ga0207645_10170368 Ga0207645_101703682 235
342 3300026089 Ga0207648_10070437 Ga0207648_100704373 235
343 3300028577 Ga0265318_10070037 Ga0265318_100700372 235
344 3300031595 Ga0265313_10010479 Ga0265313_100104794 235
345 3300053153 Ga0500616_0030480 Ga0500616_0030480_1383_2090 235
346 2162886007 SwRhRL2b_contig_275614 SwRhRL2b_0389.00004760 236
347 3300005289 Ga0065704_10002380 Ga0065704_100023807 236

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.6545 64 234
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.6381 64 234
5e9t-assembly1.cif.gz_A crystal structure of gtfa/b complex 0.5974 59 105
1xnj-assembly1.cif.gz_A aps complex of human paps synthetase 1 0.5869 55 108
4ex4-assembly1.cif.gz_A the structure of glcb from mycobacterium leprae 0.5561 66 110
ID Description Score Start End Superfamily
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7451 64 105 3.90.550.10
af_A0A1D6JHK5_54_270_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7171 80 105 3.40.50.1820
2pd2B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.691 66 234 3.40.1260.10
1l1sA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.687 64 234 3.40.1260.10
af_Q86HR3_48_158_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.6778 68 234 3.40.1260.10
ID Description Score Start End GO Terms
AF-A0A2V8DXG1-F1-model_v4 Uncharacterized protein 0.9561 165 236
AF-A0A2V8E5G9-F1-model_v4 Uncharacterized protein 0.952 165 231
AF-A0A2V8FRS4-F1-model_v4 Uncharacterized protein 0.9486 165 231
AF-A0A1Z8SBY7-F1-model_v4 Tat (Twin-arginine translocation) pathway signal sequence containing protein 0.9145 49 236
AF-A0A362XMX8-F1-model_v4 Tat (Twin-arginine translocation) pathway signal sequence containing protein 0.9131 49 236

Feature Viewer

pLDDT pTM Quality
84.34 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map