F417087

General Info

Members Datasets Scaffolds Average Seq Length
347 245 332 264

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10047786|Ga0081539_100477863
Length 305
Sequence MSTTIRHADLEAASAPSAHDAQEVAHHTAAHDEADAHPPATNEVREARLRGAMSESNRDRIINVISPIALLLVWEIATRTGVLDARFFPAPSQIFDTLITLVKNGSLWSNTWMSLQRLFWGALLGGIPALLLGIAMGLYRPLRAFIDPLVSATYPVPKSAIMPLILLIFGLGEASKIVMVAIGVFYPVLINSVAGVREINKVYLDVGKNFGAGRWQVFRTIALPGALPLIMSGVKLGVXXXLILIAIAEMIGAKSGLGYMIWNAWEVLSVETMYVGLLTIALLGFLFTFILNEVEHVLVPWRTQR

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
4 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
5 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
6 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
7 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
8 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
9 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
10 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
11 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
12 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
13 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
14 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
67 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
68 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
69 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
92 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
175 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
224 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
230 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
237 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
242 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
245 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 0
Isolates 4.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.39
Nodule 2.31
Rhizoplane 4.03
Rhizosphere 65.42
Stem 0
Stem Tuber 0
Unclassified 15.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10152806 3300003323 Bacteria 2082
2 Ga0065165_1052728 3300005262 Bacteria 1148
3 Ga0065707_10126751 3300005295 Bacteria 1997
4 Ga0070683_100005921 3300005329 Bacteria 10233
5 Ga0070690_100057655 3300005330 Bacteria 2493
6 Ga0070670_100378283 3300005331 Bacteria 1247
7 Ga0070680_100241194 3300005336 Bacteria 1528
8 Ga0070675_100258552 3300005354 Bacteria 1525
9 Ga0070671_100222732 3300005355 Bacteria 1600
10 Ga0070671_100339720 3300005355 Bacteria 1281
11 Ga0070659_100388203 3300005366 Bacteria 1177
12 Ga0070713_100727866 3300005436 Unclassified 948
13 Ga0070711_100080160 3300005439 Bacteria 2324
14 Ga0070705_100180891 3300005440 Bacteria 1428
15 Ga0070705_100302427 3300005440 Bacteria 1147
16 Ga0070708_100001176 3300005445 Bacteria 20167
17 Ga0070708_100005957 3300005445 Bacteria 9691
18 Ga0070708_100329229 3300005445 Bacteria 1439
19 Ga0070681_10001127 3300005458 Bacteria 22938
20 Ga0070681_10043901 3300005458 Bacteria 4475
21 Ga0070681_10212599 3300005458 Bacteria 1850
22 Ga0070706_100067894 3300005467 Bacteria 3297
23 Ga0070706_100250772 3300005467 Bacteria 1652
24 Ga0070707_100033482 3300005468 Bacteria 4900
25 Ga0070698_100005654 3300005471 Bacteria 13687
26 Ga0070698_100019592 3300005471 Bacteria 7099
27 Ga0070698_100132023 3300005471 Bacteria 2452
28 Ga0070699_100077069 3300005518 Bacteria 2902
29 Ga0070699_100083905 3300005518 Bacteria 2779
30 Ga0070679_100012721 3300005530 Bacteria 8048
31 Ga0070679_100038119 3300005530 Bacteria 4778
32 Ga0070697_100026016 3300005536 Bacteria 4669
33 Ga0070664_100224326 3300005564 Bacteria 1682
34 Ga0068863_100134594 3300005841 Bacteria 2361
35 Ga0081455_10005331 3300005937 Bacteria 14124
36 Ga0081540_1022425 3300005983 Bacteria 3729
37 Ga0081539_10047786 3300005985 Bacteria 2440
38 Ga0070717_10456504 3300006028 Unclassified 1152
39 Ga0075365_10013847 3300006038 Bacteria 4839
40 Ga0075365_10023983 3300006038 Bacteria 3843
41 Ga0070716_100169729 3300006173 Bacteria 1423
42 Ga0070712_100059047 3300006175 Bacteria 2700
43 Ga0075369_10022770 3300006186 Bacteria 2586
44 Ga0075370_10019569 3300006353 Bacteria 3689
45 Ga0075370_10028825 3300006353 Bacteria 3089
46 Ga0068871_100407969 3300006358 Bacteria 1211
47 Ga0075428_100563222 3300006844 Bacteria 1218
48 Ga0075434_100005107 3300006871 Bacteria 11917
49 Ga0075434_100203762 3300006871 Bacteria 1999
50 Ga0099823_1002062 3300006944 Bacteria 17748
51 Ga0075435_100128833 3300007076 Bacteria 2117
52 Ga0099794_10013714 3300007265 Bacteria 3535
53 Ga0099795_10039732 3300007788 Bacteria 1667
54 Ga0105240_10064259 3300009093 Bacteria 4561
55 Ga0105240_10162311 3300009093 Unclassified 2653
56 Ga0111539_10146280 3300009094 Bacteria 2767
57 Ga0111539_10691540 3300009094 Bacteria 1187
58 Ga0114129_10009943 3300009147 Bacteria 13559
59 Ga0114129_10033343 3300009147 Bacteria 7277
60 Ga0114129_10130711 3300009147 Bacteria 3448
61 Ga0114129_10432928 3300009147 Bacteria 1728
62 Ga0114129_11225428 3300009147 Bacteria 933
63 Ga0105242_10001560 3300009176 Bacteria 18038
64 Ga0105242_10327054 3300009176 Bacteria 1408
65 Ga0105248_10367107 3300009177 Bacteria 1620
66 Ga0105248_10635108 3300009177 Bacteria 1205
67 Ga0105035_100248 3300009988 Bacteria 3567
68 Ga0157378_10467395 3300013297 Bacteria 1255
69 Ga0157372_10081325 3300013307 Bacteria 3667
70 Ga0157375_10436131 3300013308 Bacteria 1476
71 Ga0157515_148128 3300013875 Bacteria 3420
72 Ga0182008_10025447 3300014497 Bacteria 3005
73 Ga0157379_10442048 3300014968 Bacteria 1199
74 Ga0214544_1000290 3300021320 Bacteria 84995
75 Ga0214542_1000142 3300021321 Bacteria 104366
76 Ga0214543_1000118 3300021327 Bacteria 104984
77 Ga0213873_10000002 3300021358 Bacteria 1164195
78 Ga0213874_10010071 3300021377 Bacteria 2357
79 Ga0213876_10000001 3300021384 Bacteria 1186326
80 Ga0213876_10001675 3300021384 Bacteria 13508
81 Ga0213876_10077750 3300021384 Bacteria 1753
82 Ga0213875_10001246 3300021388 Bacteria 17179
83 Ga0209677_100102 3300025253 Bacteria 91491
84 Ga0209455_1024019 3300025272 Bacteria 1132
85 Ga0207684_10042634 3300025910 Bacteria 3847
86 Ga0207707_10010182 3300025912 Bacteria 8160
87 Ga0207707_10358397 3300025912 Bacteria 1256
88 Ga0207695_10392898 3300025913 Bacteria 1272
89 Ga0207693_10011644 3300025915 Bacteria 7116
90 Ga0207663_10124580 3300025916 Bacteria 1770
91 Ga0207660_10063559 3300025917 Bacteria 2662
92 Ga0207660_10093251 3300025917 Bacteria 2237
93 Ga0207652_10020148 3300025921 Bacteria 5491
94 Ga0207652_10494822 3300025921 Bacteria 1101
95 Ga0207646_10021363 3300025922 Bacteria 5981
96 Ga0207646_10464749 3300025922 Unclassified 1141
97 Ga0207650_10300831 3300025925 Bacteria 1310
98 Ga0207700_10019001 3300025928 Bacteria 4633
99 Ga0207644_10176036 3300025931 Bacteria 1674
100 Ga0207686_10055554 3300025934 Bacteria 2485
101 Ga0207665_10019715 3300025939 Bacteria 4432
102 Ga0207661_10005263 3300025944 Bacteria 9104
103 Ga0207667_10183695 3300025949 Bacteria 2147
104 Ga0207678_10122560 3300026067 Bacteria 2218
105 Ga0209389_1000093 3300027296 Bacteria 82436
106 Ga0209489_105055 3300027361 Bacteria 23462
107 Ga0207428_10159592 3300027907 Bacteria 1713
108 Ga0265338_10208866 3300028800 Bacteria 1467
109 Ga0307508_10151914 3300031616 Bacteria 1920
110 Ga0265314_10045846 3300031711 Bacteria 3088
111 Ga0307411_10397861 3300032005 Bacteria 1138
112 Ga0316215_1001644 3300033544 Bacteria 2132
113 Ga0373939_0061329 3300035114 Bacteria 1198
114 Ga0373941_0069121 3300035115 Bacteria 1168
115 Ga0373953_0047963 3300035117 Bacteria 1719
116 Ga0373954_0078714 3300035118 Bacteria 1573
117 Ga0373955_0034575 3300035172 Bacteria 2671
118 Ga0373931_0019194 3300035691 Bacteria 3410
119 Ga0373931_0039489 3300035691 Bacteria 2473
120 Ga0373937_0015496 3300036401 Bacteria 6742
121 Ga0395905_0001763 3300037471 Bacteria 25156
122 Ga0395905_0126992 3300037471 Bacteria 2398
123 Ga0436364_0535229 3300037853 Bacteria 15468
124 Ga0436364_0922732 3300037853 Bacteria 1690
125 Ga0436365_0624968 3300039437 Bacteria 39516
126 Ga0436365_1157919 3300039437 Unclassified 2327
127 Ga0436365_1534647 3300039437 Bacteria 210477
128 Ga0436360_1284024 3300039438 Bacteria 2534
129 Ga0436363_1256953 3300039450 Bacteria 1229
130 Ga0436362_0458594 3300039453 Bacteria 172608
131 Ga0436362_0557345 3300039453 Bacteria 1315
132 Ga0466957_0107528 3300044842 Bacteria 1766
133 Ga0466960_0092144 3300044901 Bacteria 1547
134 Ga0495592_0081973 3300046454 Bacteria 2332
135 Ga0495603_0000970 3300046455 Bacteria 16522
136 Ga0495629_0020938 3300046459 Bacteria 4667
137 Ga0495638_0000035 3300046460 Bacteria 276385
138 Ga0495638_0036187 3300046460 Bacteria 3145
139 Ga0495638_0083941 3300046460 Bacteria 1928
140 Ga0495641_0015339 3300046461 Bacteria 4096
141 Ga0495653_0015077 3300046463 Bacteria 6299
142 Ga0495653_0174913 3300046463 Bacteria 1478
143 Ga0495580_0000089 3300046472 Bacteria 59573
144 Ga0495582_0000440 3300046473 Bacteria 22722
145 Ga0495582_0150133 3300046473 Bacteria 1323
146 Ga0495639_0185675 3300046475 Bacteria 1013
147 Ga0495662_0001678 3300046476 Bacteria 11045
148 Ga0495664_0013722 3300046477 Bacteria 4594
149 Ga0495584_0085060 3300046491 Bacteria 1593
150 Ga0495584_0093582 3300046491 Bacteria 1517
151 Ga0495585_0000512 3300046492 Bacteria 36666
152 Ga0495585_0007079 3300046492 Bacteria 6897
153 Ga0495596_0017746 3300046500 Bacteria 2942
154 Ga0495583_0000134 3300046506 Bacteria 124077
155 Ga0495583_0052836 3300046506 Bacteria 1846
156 Ga0495583_0169436 3300046506 Bacteria 898
157 Ga0495610_0056772 3300046512 Bacteria 1881
158 Ga0495610_0070775 3300046512 Bacteria 1628
159 Ga0495616_0071510 3300046513 Bacteria 1677
160 Ga0495618_0006297 3300046514 Bacteria 7205
161 Ga0495618_0117520 3300046514 Bacteria 1703
162 Ga0495620_0005200 3300046515 Bacteria 7281
163 Ga0495628_0011029 3300046516 Bacteria 7652
164 Ga0495630_0005477 3300046517 Bacteria 8959
165 Ga0495631_0012653 3300046518 Bacteria 4115
166 Ga0495643_0018217 3300046522 Bacteria 4087
167 Ga0495644_0017575 3300046523 Bacteria 2734
168 Ga0495648_0002987 3300046524 Bacteria 15171
169 Ga0495648_0003407 3300046524 Bacteria 13970
170 Ga0495648_0005740 3300046524 Bacteria 10241
171 Ga0495648_0067974 3300046524 Bacteria 2082
172 Ga0495666_0000484 3300046526 Bacteria 17697
173 Ga0495652_0049154 3300046529 Bacteria 3611
174 Ga0495654_0056766 3300046530 Bacteria 1892
175 Ga0495654_0073832 3300046530 Bacteria 1612
176 Ga0495665_0013499 3300046531 Bacteria 4414
177 Ga0495665_0164787 3300046531 Bacteria 1155
178 Ga0495640_0005488 3300046533 Bacteria 10085
179 Ga0495586_0023144 3300046535 Bacteria 3317
180 Ga0495587_0001336 3300046536 Bacteria 16383
181 Ga0495609_0003474 3300046538 Bacteria 9011
182 Ga0495609_0027307 3300046538 Bacteria 2609
183 Ga0495621_0016994 3300046539 Bacteria 2344
184 Ga0495645_0015885 3300046543 Bacteria 5362
185 Ga0495668_0175477 3300046616 Bacteria 1174
186 Ga0495634_0005387 3300046642 Bacteria 9858
187 Ga0495611_0032404 3300046648 Bacteria 2302
188 Ga0495625_0046334 3300046660 Bacteria 3138
189 Ga0495635_0004204 3300046663 Bacteria 9986
190 Ga0495659_0004068 3300046664 Bacteria 4626
191 Ga0495659_0039062 3300046664 Bacteria 1687
192 Ga0495661_0005399 3300046665 Bacteria 9087
193 Ga0495661_0021393 3300046665 Bacteria 4217
194 Ga0495661_0025615 3300046665 Bacteria 3808
195 Ga0495588_0147346 3300046674 Bacteria 1244
196 Ga0495599_0011049 3300046678 Bacteria 5541
197 Ga0495623_0005232 3300046679 Bacteria 8509
198 Ga0495646_0005838 3300046680 Bacteria 7809
199 Ga0495658_0152101 3300046683 Bacteria 1422
200 Ga0495669_0123378 3300046684 Bacteria 1216
201 Ga0495613_0012980 3300046689 Bacteria 6189
202 Ga0495624_0048298 3300046690 Bacteria 2701
203 Ga0495649_0153050 3300046694 Bacteria 1211
204 Ga0495660_0154826 3300046810 Bacteria 1129
205 Ga0495581_0000472 3300047315 Bacteria 20527
206 Ga0495604_0038161 3300047317 Bacteria 3780
207 Ga0495674_0052983 3300047319 Bacteria 3568
208 Ga0495674_0066371 3300047319 Bacteria 3131
209 Ga0495672_0024415 3300047320 Bacteria 3894
210 Ga0495676_0007998 3300047321 Bacteria 9696
211 Ga0495676_0044935 3300047321 Bacteria 3600
212 Ga0495680_0003884 3300047322 Bacteria 14459
213 Ga0495683_0041772 3300047323 Bacteria 2313
214 Ga0495675_0007533 3300047444 Bacteria 6710
215 Ga0495675_0072476 3300047444 Bacteria 2173
216 Ga0495679_005810 3300047446 Bacteria 5428
217 Ga0495673_0061095 3300047469 Bacteria 1614
218 Ga0495686_0031092 3300047472 Bacteria 3464
219 Ga0495686_0151891 3300047472 Bacteria 1359
220 Ga0495593_0004322 3300047673 Bacteria 8454
221 Ga0495593_0012130 3300047673 Bacteria 4931
222 Ga0495602_0091784 3300048088 Bacteria 2517
223 Ga0495602_0105886 3300048088 Bacteria 2297
224 Ga0495614_0005391 3300048089 Bacteria 5770
225 Ga0495626_0011825 3300048091 Bacteria 4597
226 Ga0495626_0052123 3300048091 Bacteria 1886
227 Ga0496102_0177209 3300048905 Bacteria 2008
228 Ga0496104_0148379 3300048907 Bacteria 2252
229 Ga0496105_0053361 3300048908 Bacteria 3339
230 Ga0496107_0109072 3300048910 Bacteria 2033
231 Ga0496109_0206507 3300048912 Bacteria 1847
232 Ga0496109_0275934 3300048912 Bacteria 1584
233 Ga0496110_0212263 3300048913 Bacteria 1760
234 Ga0496112_0006758 3300048915 Bacteria 10106
235 Ga0496112_0198391 3300048915 Bacteria 1967
236 Ga0496113_0227126 3300048916 Bacteria 1488
237 Ga0496113_0336888 3300048916 Bacteria 1210
238 Ga0496115_0005031 3300048918 Bacteria 9602
239 Ga0496115_0284861 3300048918 Bacteria 1356
240 Ga0496116_0002148 3300048919 Bacteria 20984
241 Ga0496117_0016013 3300048920 Bacteria 6351
242 Ga0496117_0019801 3300048920 Bacteria 5513
243 Ga0496117_0109428 3300048920 Bacteria 1725
244 Ga0496118_0013058 3300048921 Bacteria 7897
245 Ga0496118_0022856 3300048921 Bacteria 5452
246 Ga0496121_0000188 3300048924 Bacteria 138221
247 Ga0496121_0003317 3300048924 Bacteria 23119
248 Ga0496121_0008449 3300048924 Bacteria 12103
249 Ga0496121_0016036 3300048924 Bacteria 7767
250 Ga0496121_0059796 3300048924 Bacteria 3140
251 Ga0496121_0068927 3300048924 Bacteria 2858
252 Ga0496121_0242217 3300048924 Bacteria 1256
253 Ga0496122_0012667 3300048925 Bacteria 8358
254 Ga0496122_0100832 3300048925 Bacteria 1931
255 Ga0496123_0013358 3300048926 Bacteria 6903
256 Ga0496123_0065341 3300048926 Bacteria 2313
257 Ga0496124_0263767 3300048927 Bacteria 1266
258 Ga0496125_0001923 3300048928 Bacteria 28409
259 Ga0496125_0011771 3300048928 Bacteria 8719
260 Ga0496125_0030783 3300048928 Bacteria 4794
261 Ga0496126_0000783 3300048929 Bacteria 57293
262 Ga0496126_0008684 3300048929 Bacteria 10915
263 Ga0496126_0010831 3300048929 Bacteria 9508
264 Ga0496126_0060836 3300048929 Bacteria 3395
265 Ga0496126_0070563 3300048929 Bacteria 3112
266 Ga0496126_0076874 3300048929 Bacteria 2961
267 Ga0496126_0109037 3300048929 Bacteria 2413
268 Ga0496126_0167773 3300048929 Bacteria 1872
269 Ga0496126_0403353 3300048929 Bacteria 1108
270 Ga0495682_0028754 3300049460 Bacteria 2059
271 Ga0501032_0257286 3300049569 Bacteria 1132
272 Ga0501033_0129975 3300049570 Bacteria 1825
273 Ga0501033_0143467 3300049570 Bacteria 1726
274 Ga0501034_0062355 3300049571 Bacteria 3743
275 Ga0501036_0117302 3300049572 Bacteria 2248
276 Ga0501038_0027551 3300049574 Bacteria 5055
277 Ga0501038_0213129 3300049574 Bacteria 1544
278 Ga0501068_0048122 3300049584 Bacteria 2574
279 Ga0501070_0026085 3300049586 Bacteria 4903
280 Ga0501070_0475362 3300049586 Bacteria 1006
281 Ga0501073_0063584 3300049589 Bacteria 2574
282 Ga0501074_0161215 3300049590 Bacteria 1602
283 Ga0501080_0056233 3300049742 Bacteria 3665
284 Ga0501035_0274133 3300049822 Bacteria 1427
285 Ga0501044_0012768 3300049823 Bacteria 9096
286 Ga0501044_0020728 3300049823 Bacteria 7017
287 nmdc:mga00v17_1553_c1 3300050491 Bacteria 11985
288 nmdc:mga0yw44_1867_c1 3300050492 Bacteria 8654
289 nmdc:mga0yw44_45881_c1 3300050492 Bacteria 2622
290 nmdc:mga07m45_14897_c1 3300050496 Bacteria 4152
291 nmdc:mga07m45_26994_c1 3300050496 Bacteria 3159
292 nmdc:mga05p37_297806_c1 3300050507 Bacteria 1918
293 nmdc:mga05p37_357681_c1 3300050507 Bacteria 1717
294 nmdc:mga05p37_424698_c1 3300050507 Bacteria 1546
295 nmdc:mga05p37_6447_c1 3300050507 Bacteria 13837
296 nmdc:mga05p37_7119_c1 3300050507 Bacteria 13186
297 nmdc:mga0n895_91098_c1 3300050512 Bacteria 3051
298 nmdc:mga0rr50_154206_c1 3300050513 Bacteria 1859
299 nmdc:mga0rr50_386456_c1 3300050513 Bacteria 1181
300 nmdc:mga08x19_111450_c1 3300050514 Bacteria 1826
301 nmdc:mga0a205_110138_c1 3300050515 Bacteria 2652
302 Ga0495601_0038383 3300053077 Bacteria 2996
303 Ga0500651_0029846 3300053093 Bacteria 3430
304 Ga0500651_0239696 3300053093 Bacteria 1058
305 Ga0500566_0003502 3300053094 Bacteria 9362
306 Ga0500641_0086444 3300053096 Bacteria 1335
307 Ga0500650_0004710 3300053098 Bacteria 4975
308 Ga0500556_0000003 3300053104 Bacteria 679379
309 Ga0500562_021353 3300053108 Bacteria 1684
310 Ga0500569_003520 3300053109 Bacteria 3209
311 Ga0500595_003268 3300053119 Bacteria 7655
312 Ga0500595_060396 3300053119 Bacteria 1147
313 Ga0500607_192123 3300053121 Bacteria 890
314 Ga0500642_0000085 3300053130 Bacteria 48934
315 Ga0500652_000039 3300053131 Bacteria 68895
316 Ga0500652_001330 3300053131 Bacteria 7770
317 Ga0500658_0147287 3300053134 Bacteria 1059
318 Ga0500559_0000328 3300053136 Bacteria 35822
319 Ga0500568_0000113 3300053139 Bacteria 73458
320 Ga0500568_0003271 3300053139 Bacteria 9147
321 Ga0500577_0000201 3300053142 Bacteria 15765
322 Ga0500586_005741 3300053145 Bacteria 3165
323 Ga0500590_027511 3300053148 Bacteria 2950
324 Ga0500604_0002787 3300053151 Bacteria 4748
325 Ga0500616_0000041 3300053153 Bacteria 359328
326 Ga0500616_0000199 3300053153 Bacteria 97974
327 Ga0500622_0000658 3300053156 Bacteria 30749
328 Ga0500622_0014969 3300053156 Bacteria 4159
329 Ga0500627_0212278 3300053158 Bacteria 865
330 Ga0500633_0013784 3300053160 Bacteria 2276
331 Ga0500636_0001353 3300053177 Bacteria 13300
332 Ga0500611_033658 3300053727 Bacteria 1080

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10464749 Ga0207646_104647491 212
2 iso_pu_bacteria 2885270888 2885277859 226
3 3300021384 Ga0213876_10001675 Ga0213876_1000167515 230
4 3300039437 Ga0436365_0624968 Ga0436365_0624968_24383_25243 230
5 3300039453 Ga0436362_0557345 Ga0436362_0557345_224_1084 230
6 3300047319 Ga0495674_0066371 Ga0495674_0066371_826_1554 230
7 3300047320 Ga0495672_0024415 Ga0495672_0024415_662_1390 230
8 3300005436 Ga0070713_100727866 Ga0070713_1007278661 232
9 3300006028 Ga0070717_10456504 Ga0070717_104565041 232
10 3300046514 Ga0495618_0117520 Ga0495618_0117520_318_1118 232
11 3300046463 Ga0495653_0174913 Ga0495653_0174913_28_765 233
12 3300021384 Ga0213876_10077750 Ga0213876_100777501 234
13 3300039437 Ga0436365_1157919 Ga0436365_1157919_891_1760 234
14 3300005467 Ga0070706_100250772 Ga0070706_1002507722 235
15 3300005471 Ga0070698_100132023 Ga0070698_1001320233 235
16 3300009176 Ga0105242_10001560 Ga0105242_1000156012 235
17 3300025934 Ga0207686_10055554 Ga0207686_100555541 235
18 3300053142 Ga0500577_0000201 Ga0500577_0000201_2008_2772 235
19 3300044842 Ga0466957_0107528 Ga0466957_0107528_358_1125 237
20 iso_pu_bacteria 2602042107 2603859928 237
21 iso_pu_bacteria 2857524615 2857524920 237
22 iso_pu_bacteria 2893066018 2893071149 237
23 iso_pu_bacteria 2919073203 2919078808 237
24 3300053131 Ga0500652_000039 Ga0500652_000039_45679_46434 238
25 iso_pu_bacteria 2828305725 2828306439 238
26 3300005336 Ga0070680_100241194 Ga0070680_1002411942 239
27 3300021358 Ga0213873_10000002 Ga0213873_1000000259 239
28 3300021384 Ga0213876_10000001 Ga0213876_10000001142 239
29 3300025917 Ga0207660_10063559 Ga0207660_100635592 239
30 3300039437 Ga0436365_1534647 Ga0436365_1534647_81300_82058 239
31 3300039453 Ga0436362_0458594 Ga0436362_0458594_81199_81957 239
32 iso_pu_bacteria 2508501128 2509149497 239
33 iso_pu_bacteria 2513237098 2513675712 239
34 iso_pu_bacteria 2885383462 2885386986 239
35 iso_pu_bacteria 2903768456 2903770133 239
36 3300005329 Ga0070683_100005921 Ga0070683_10000592111 240
37 3300046506 Ga0495583_0169436 Ga0495583_0169436_105_875 240
38 3300046539 Ga0495621_0016994 Ga0495621_0016994_403_1218 240
39 3300048929 Ga0496126_0109037 Ga0496126_0109037_737_1495 240
40 3300005262 Ga0065165_1052728 Ga0065165_10527282 241
41 3300006038 Ga0075365_10023983 Ga0075365_100239833 241
42 3300006186 Ga0075369_10022770 Ga0075369_100227702 241
43 3300006353 Ga0075370_10019569 Ga0075370_100195693 241
44 3300006353 Ga0075370_10028825 Ga0075370_100288252 241
45 3300026067 Ga0207678_10122560 Ga0207678_101225603 241
46 3300046460 Ga0495638_0036187 Ga0495638_0036187_1453_2226 241
47 3300046460 Ga0495638_0083941 Ga0495638_0083941_1074_1847 241
48 3300046512 Ga0495610_0056772 Ga0495610_0056772_466_1239 241
49 3300046512 Ga0495610_0070775 Ga0495610_0070775_822_1595 241
50 3300046515 Ga0495620_0005200 Ga0495620_0005200_6430_7203 241
51 3300046524 Ga0495648_0067974 Ga0495648_0067974_530_1303 241
52 3300046530 Ga0495654_0056766 Ga0495654_0056766_981_1754 241
53 3300046530 Ga0495654_0073832 Ga0495654_0073832_319_1092 241
54 3300046660 Ga0495625_0046334 Ga0495625_0046334_1569_2342 241
55 3300046665 Ga0495661_0025615 Ga0495661_0025615_2698_3471 241
56 3300046810 Ga0495660_0154826 Ga0495660_0154826_343_1116 241
57 3300047472 Ga0495686_0031092 Ga0495686_0031092_172_945 241
58 3300048919 Ga0496116_0002148 Ga0496116_0002148_6134_6907 241
59 3300048920 Ga0496117_0016013 Ga0496117_0016013_4510_5283 241
60 3300048920 Ga0496117_0019801 Ga0496117_0019801_2046_2819 241
61 3300048920 Ga0496117_0109428 Ga0496117_0109428_889_1662 241
62 3300048921 Ga0496118_0013058 Ga0496118_0013058_1641_2414 241
63 3300048921 Ga0496118_0022856 Ga0496118_0022856_1892_2665 241
64 3300048924 Ga0496121_0003317 Ga0496121_0003317_15587_16360 241
65 3300048924 Ga0496121_0016036 Ga0496121_0016036_5318_6094 241
66 3300048924 Ga0496121_0059796 Ga0496121_0059796_1541_2314 241
67 3300048925 Ga0496122_0012667 Ga0496122_0012667_6532_7305 241
68 3300048925 Ga0496122_0100832 Ga0496122_0100832_794_1567 241
69 3300048926 Ga0496123_0013358 Ga0496123_0013358_3213_3986 241
70 3300048926 Ga0496123_0065341 Ga0496123_0065341_1338_2111 241
71 3300048927 Ga0496124_0263767 Ga0496124_0263767_475_1248 241
72 3300048928 Ga0496125_0001923 Ga0496125_0001923_17530_18303 241
73 3300048928 Ga0496125_0011771 Ga0496125_0011771_2672_3445 241
74 3300048929 Ga0496126_0070563 Ga0496126_0070563_1377_2150 241
75 3300048929 Ga0496126_0076874 Ga0496126_0076874_1741_2556 241
76 3300048929 Ga0496126_0167773 Ga0496126_0167773_186_959 241
77 3300050491 nmdc:mga00v17_1553_c1 nmdc:mga00v17_1553_c1_4666_5439 241
78 3300050492 nmdc:mga0yw44_45881_c1 nmdc:mga0yw44_45881_c1_845_1618 241
79 3300050496 nmdc:mga07m45_14897_c1 nmdc:mga07m45_14897_c1_1578_2351 241
80 3300050496 nmdc:mga07m45_26994_c1 nmdc:mga07m45_26994_c1_871_1803 241
81 3300053093 Ga0500651_0239696 Ga0500651_0239696_164_937 241
82 3300053094 Ga0500566_0003502 Ga0500566_0003502_5297_6070 241
83 3300053096 Ga0500641_0086444 Ga0500641_0086444_50_823 241
84 3300053098 Ga0500650_0004710 Ga0500650_0004710_951_1724 241
85 3300053104 Ga0500556_0000003 Ga0500556_0000003_590534_591307 241
86 3300053109 Ga0500569_003520 Ga0500569_003520_650_1423 241
87 3300053121 Ga0500607_192123 Ga0500607_192123_30_803 241
88 3300053130 Ga0500642_0000085 Ga0500642_0000085_14379_15152 241
89 3300053131 Ga0500652_001330 Ga0500652_001330_5011_5784 241
90 3300053134 Ga0500658_0147287 Ga0500658_0147287_97_870 241
91 3300053136 Ga0500559_0000328 Ga0500559_0000328_32287_33060 241
92 3300053139 Ga0500568_0003271 Ga0500568_0003271_3160_3933 241
93 3300053145 Ga0500586_005741 Ga0500586_005741_153_926 241
94 3300053148 Ga0500590_027511 Ga0500590_027511_511_1284 241
95 3300053151 Ga0500604_0002787 Ga0500604_0002787_73_846 241
96 3300053153 Ga0500616_0000041 Ga0500616_0000041_320709_321482 241
97 3300053156 Ga0500622_0000658 Ga0500622_0000658_21167_21940 241
98 3300053158 Ga0500627_0212278 Ga0500627_0212278_10_783 241
99 3300053160 Ga0500633_0013784 Ga0500633_0013784_485_1258 241
100 3300053177 Ga0500636_0001353 Ga0500636_0001353_11186_11959 241
101 3300053727 Ga0500611_033658 Ga0500611_033658_16_789 241
102 3300005355 Ga0070671_100339720 Ga0070671_1003397202 242
103 3300046524 Ga0495648_0002987 Ga0495648_0002987_3667_4443 242
104 3300005330 Ga0070690_100057655 Ga0070690_1000576552 243
105 3300005439 Ga0070711_100080160 Ga0070711_1000801602 243
106 3300005440 Ga0070705_100302427 Ga0070705_1003024271 243
107 3300005445 Ga0070708_100005957 Ga0070708_1000059572 243
108 3300005467 Ga0070706_100067894 Ga0070706_1000678943 243
109 3300005468 Ga0070707_100033482 Ga0070707_1000334823 243
110 3300005471 Ga0070698_100005654 Ga0070698_1000056549 243
111 3300005518 Ga0070699_100083905 Ga0070699_1000839052 243
112 3300005536 Ga0070697_100026016 Ga0070697_1000260162 243
113 3300006173 Ga0070716_100169729 Ga0070716_1001697292 243
114 3300006175 Ga0070712_100059047 Ga0070712_1000590472 243
115 3300006871 Ga0075434_100203762 Ga0075434_1002037622 243
116 3300006944 Ga0099823_1002062 Ga0099823_10020629 243
117 3300007076 Ga0075435_100128833 Ga0075435_1001288332 243
118 3300007265 Ga0099794_10013714 Ga0099794_100137142 243
119 3300009093 Ga0105240_10162311 Ga0105240_101623113 243
120 3300013308 Ga0157375_10436131 Ga0157375_104361312 243
121 3300014497 Ga0182008_10025447 Ga0182008_100254472 243
122 3300025910 Ga0207684_10042634 Ga0207684_100426341 243
123 3300025912 Ga0207707_10358397 Ga0207707_103583972 243
124 3300025915 Ga0207693_10011644 Ga0207693_100116444 243
125 3300025916 Ga0207663_10124580 Ga0207663_101245802 243
126 3300025922 Ga0207646_10021363 Ga0207646_100213635 243
127 3300025928 Ga0207700_10019001 Ga0207700_100190013 243
128 3300025939 Ga0207665_10019715 Ga0207665_100197153 243
129 3300025949 Ga0207667_10183695 Ga0207667_101836952 243
130 3300027296 Ga0209389_1000093 Ga0209389_100009331 243
131 3300027361 Ga0209489_105055 Ga0209489_1050559 243
132 3300031616 Ga0307508_10151914 Ga0307508_101519142 243
133 3300033544 Ga0316215_1001644 Ga0316215_10016443 243
134 3300035691 Ga0373931_0019194 Ga0373931_0019194_1678_2445 243
135 3300037471 Ga0395905_0126992 Ga0395905_0126992_460_1227 243
136 3300048907 Ga0496104_0148379 Ga0496104_0148379_348_1115 243
137 3300048915 Ga0496112_0006758 Ga0496112_0006758_1036_1803 243
138 3300048916 Ga0496113_0227126 Ga0496113_0227126_569_1336 243
139 3300048924 Ga0496121_0008449 Ga0496121_0008449_10791_11558 243
140 3300048929 Ga0496126_0060836 Ga0496126_0060836_2374_3141 243
141 3300048929 Ga0496126_0403353 Ga0496126_0403353_111_878 243
142 3300049586 Ga0501070_0026085 Ga0501070_0026085_2543_3370 243
143 3300049742 Ga0501080_0056233 Ga0501080_0056233_1198_2025 243
144 3300049823 Ga0501044_0012768 Ga0501044_0012768_2907_3734 243
145 3300050513 nmdc:mga0rr50_386456_c1 nmdc:mga0rr50_386456_c1_179_946 243
146 3300050514 nmdc:mga08x19_111450_c1 nmdc:mga08x19_111450_c1_65_832 243
147 3300053093 Ga0500651_0029846 Ga0500651_0029846_1321_2088 243
148 3300053119 Ga0500595_003268 Ga0500595_003268_5257_6024 243
149 3300053119 Ga0500595_060396 Ga0500595_060396_13_780 243
150 3300025944 Ga0207661_10005263 Ga0207661_100052635 244
151 3300047472 Ga0495686_0151891 Ga0495686_0151891_190_960 244
152 3300049570 Ga0501033_0143467 Ga0501033_0143467_478_1311 244
153 3300049574 Ga0501038_0213129 Ga0501038_0213129_697_1524 244
154 3300049823 Ga0501044_0020728 Ga0501044_0020728_2668_3501 244
155 iso_pu_bacteria 2884693830 2884694724 246
156 iso_pu_bacteria 2895442618 2895447155 246
157 3300009176 Ga0105242_10327054 Ga0105242_103270542 247
158 3300046491 Ga0495584_0085060 Ga0495584_0085060_33_818 248
159 3300005355 Ga0070671_100222732 Ga0070671_1002227322 249
160 3300009177 Ga0105248_10367107 Ga0105248_103671072 249
161 3300025931 Ga0207644_10176036 Ga0207644_101760362 249
162 3300044901 Ga0466960_0092144 Ga0466960_0092144_44_829 249
163 3300009988 Ga0105035_100248 Ga0105035_1002482 250
164 3300013875 Ga0157515_148128 Ga0157515_1481285 250
165 3300046506 Ga0495583_0000134 Ga0495583_0000134_122783_123574 250
166 3300046506 Ga0495583_0052836 Ga0495583_0052836_552_1343 250
167 3300009147 Ga0114129_11225428 Ga0114129_112254281 251
168 3300037471 Ga0395905_0001763 Ga0395905_0001763_13159_13956 252
169 3300037853 Ga0436364_0922732 Ga0436364_0922732_401_1201 252
170 3300039438 Ga0436360_1284024 Ga0436360_1284024_922_1722 252
171 3300048905 Ga0496102_0177209 Ga0496102_0177209_966_1766 252
172 3300048912 Ga0496109_0275934 Ga0496109_0275934_114_914 252
173 3300048915 Ga0496112_0198391 Ga0496112_0198391_845_1645 252
174 3300048916 Ga0496113_0336888 Ga0496113_0336888_98_898 252
175 3300048924 Ga0496121_0000188 Ga0496121_0000188_83685_84479 252
176 3300048929 Ga0496126_0000783 Ga0496126_0000783_37075_37869 252
177 3300005458 Ga0070681_10001127 Ga0070681_1000112721 254
178 3300005458 Ga0070681_10212599 Ga0070681_102125992 254
179 3300005530 Ga0070679_100012721 Ga0070679_1000127215 254
180 3300009093 Ga0105240_10064259 Ga0105240_100642594 254
181 3300025913 Ga0207695_10392898 Ga0207695_103928982 254
182 3300025917 Ga0207660_10093251 Ga0207660_100932512 254
183 3300025921 Ga0207652_10020148 Ga0207652_100201482 254
184 3300046475 Ga0495639_0185675 Ga0495639_0185675_151_960 254
185 3300046491 Ga0495584_0093582 Ga0495584_0093582_262_1071 254
186 3300046664 Ga0495659_0039062 Ga0495659_0039062_478_1287 254
187 3300049586 Ga0501070_0475362 Ga0501070_0475362_19_828 254
188 iso_pu_bacteria 3005445848 3005452580 255
189 3300005295 Ga0065707_10126751 Ga0065707_101267513 256
190 3300005366 Ga0070659_100388203 Ga0070659_1003882031 256
191 3300005445 Ga0070708_100001176 Ga0070708_10000117615 256
192 3300005445 Ga0070708_100329229 Ga0070708_1003292292 256
193 3300005471 Ga0070698_100019592 Ga0070698_1000195922 256
194 3300005518 Ga0070699_100077069 Ga0070699_1000770692 256
195 3300005530 Ga0070679_100038119 Ga0070679_1000381191 256
196 3300005564 Ga0070664_100224326 Ga0070664_1002243262 256
197 3300006038 Ga0075365_10013847 Ga0075365_100138473 256
198 3300009147 Ga0114129_10033343 Ga0114129_100333436 256
199 3300009147 Ga0114129_10130711 Ga0114129_101307114 256
200 3300013307 Ga0157372_10081325 Ga0157372_100813253 256
201 3300021320 Ga0214544_1000290 Ga0214544_100029033 256
202 3300021321 Ga0214542_1000142 Ga0214542_100014233 256
203 3300021327 Ga0214543_1000118 Ga0214543_100011833 256
204 3300021377 Ga0213874_10010071 Ga0213874_100100711 256
205 3300021388 Ga0213875_10001246 Ga0213875_100012464 256
206 3300025253 Ga0209677_100102 Ga0209677_10010287 256
207 3300025272 Ga0209455_1024019 Ga0209455_10240192 256
208 3300025921 Ga0207652_10494822 Ga0207652_104948222 256
209 3300037853 Ga0436364_0535229 Ga0436364_0535229_13928_14752 256
210 3300048924 Ga0496121_0242217 Ga0496121_0242217_211_1044 256
211 3300048929 Ga0496126_0008684 Ga0496126_0008684_6640_7473 256
212 3300048929 Ga0496126_0010831 Ga0496126_0010831_2767_3600 256
213 3300049569 Ga0501032_0257286 Ga0501032_0257286_295_1104 256
214 3300049572 Ga0501036_0117302 Ga0501036_0117302_260_1069 256
215 3300049574 Ga0501038_0027551 Ga0501038_0027551_2265_3074 256
216 3300049584 Ga0501068_0048122 Ga0501068_0048122_1005_1814 256
217 3300049590 Ga0501074_0161215 Ga0501074_0161215_589_1398 256
218 3300050492 nmdc:mga0yw44_1867_c1 nmdc:mga0yw44_1867_c1_2813_3634 256
219 3300050507 nmdc:mga05p37_297806_c1 nmdc:mga05p37_297806_c1_368_1189 256
220 3300050507 nmdc:mga05p37_7119_c1 nmdc:mga05p37_7119_c1_4961_5782 256
221 3300053108 Ga0500562_021353 Ga0500562_021353_433_1257 256
222 iso_pu_bacteria 8055172936 8055177657 256
223 3300035117 Ga0373953_0047963 Ga0373953_0047963_507_1346 258
224 3300035118 Ga0373954_0078714 Ga0373954_0078714_284_1123 258
225 3300035172 Ga0373955_0034575 Ga0373955_0034575_1734_2573 258
226 3300036401 Ga0373937_0015496 Ga0373937_0015496_2886_3725 258
227 iso_pu_bacteria 3005409236 3005416239 258
228 3300039450 Ga0436363_1256953 Ga0436363_1256953_80_916 259
229 3300046492 Ga0495585_0000512 Ga0495585_0000512_23148_23966 259
230 3300046492 Ga0495585_0007079 Ga0495585_0007079_171_989 259
231 3300046500 Ga0495596_0017746 Ga0495596_0017746_1563_2381 259
232 3300046513 Ga0495616_0071510 Ga0495616_0071510_106_924 259
233 3300046518 Ga0495631_0012653 Ga0495631_0012653_2085_2903 259
234 3300046522 Ga0495643_0018217 Ga0495643_0018217_67_885 259
235 3300046523 Ga0495644_0017575 Ga0495644_0017575_43_861 259
236 3300046538 Ga0495609_0003474 Ga0495609_0003474_1474_2292 259
237 3300046538 Ga0495609_0027307 Ga0495609_0027307_1139_1957 259
238 3300046616 Ga0495668_0175477 Ga0495668_0175477_105_923 259
239 3300046648 Ga0495611_0032404 Ga0495611_0032404_224_1042 259
240 3300046665 Ga0495661_0005399 Ga0495661_0005399_6877_7695 259
241 3300047321 Ga0495676_0044935 Ga0495676_0044935_270_1088 259
242 3300047323 Ga0495683_0041772 Ga0495683_0041772_56_874 259
243 3300047469 Ga0495673_0061095 Ga0495673_0061095_171_989 259
244 3300048091 Ga0495626_0011825 Ga0495626_0011825_1230_2048 259
245 3300048091 Ga0495626_0052123 Ga0495626_0052123_119_937 259
246 3300048918 Ga0496115_0005031 Ga0496115_0005031_4709_5527 259
247 3300048924 Ga0496121_0068927 Ga0496121_0068927_1533_2354 259
248 3300048928 Ga0496125_0030783 Ga0496125_0030783_3236_4057 259
249 3300049460 Ga0495682_0028754 Ga0495682_0028754_980_1798 259
250 3300049570 Ga0501033_0129975 Ga0501033_0129975_781_1608 262
251 3300049571 Ga0501034_0062355 Ga0501034_0062355_878_1705 262
252 3300049589 Ga0501073_0063584 Ga0501073_0063584_652_1479 262
253 3300049822 Ga0501035_0274133 Ga0501035_0274133_556_1383 262
254 3300005841 Ga0068863_100134594 Ga0068863_1001345943 263
255 3300005985 Ga0081539_10047786 Ga0081539_100477863 263
256 3300006358 Ga0068871_100407969 Ga0068871_1004079692 263
257 3300009177 Ga0105248_10635108 Ga0105248_106351082 263
258 3300013297 Ga0157378_10467395 Ga0157378_104673952 263
259 3300014968 Ga0157379_10442048 Ga0157379_104420482 263
260 3300032005 Ga0307411_10397861 Ga0307411_103978612 263
261 3300035114 Ga0373939_0061329 Ga0373939_0061329_109_954 263
262 3300035115 Ga0373941_0069121 Ga0373941_0069121_161_1006 263
263 3300035691 Ga0373931_0039489 Ga0373931_0039489_120_965 263
264 3300046473 Ga0495582_0150133 Ga0495582_0150133_216_1061 263
265 3300046524 Ga0495648_0005740 Ga0495648_0005740_3145_3972 263
266 3300046531 Ga0495665_0164787 Ga0495665_0164787_209_1054 263
267 3300046683 Ga0495658_0152101 Ga0495658_0152101_370_1215 263
268 3300048910 Ga0496107_0109072 Ga0496107_0109072_1051_1896 263
269 3300003323 rootH1_10152806 rootH1_101528062 264
270 3300005331 Ga0070670_100378283 Ga0070670_1003782832 264
271 3300005354 Ga0070675_100258552 Ga0070675_1002585522 264
272 3300005440 Ga0070705_100180891 Ga0070705_1001808912 264
273 3300005458 Ga0070681_10043901 Ga0070681_100439014 264
274 3300005937 Ga0081455_10005331 Ga0081455_1000533110 264
275 3300005983 Ga0081540_1022425 Ga0081540_10224253 264
276 3300006844 Ga0075428_100563222 Ga0075428_1005632222 264
277 3300006871 Ga0075434_100005107 Ga0075434_1000051075 264
278 3300007788 Ga0099795_10039732 Ga0099795_100397322 264
279 3300009094 Ga0111539_10146280 Ga0111539_101462802 264
280 3300009094 Ga0111539_10691540 Ga0111539_106915401 264
281 3300009147 Ga0114129_10009943 Ga0114129_100099434 264
282 3300009147 Ga0114129_10432928 Ga0114129_104329282 264
283 3300025912 Ga0207707_10010182 Ga0207707_100101828 264
284 3300025925 Ga0207650_10300831 Ga0207650_103008312 264
285 3300027907 Ga0207428_10159592 Ga0207428_101595922 264
286 3300028800 Ga0265338_10208866 Ga0265338_102088662 264
287 3300031711 Ga0265314_10045846 Ga0265314_100458462 264
288 3300046454 Ga0495592_0081973 Ga0495592_0081973_1478_2320 264
289 3300046455 Ga0495603_0000970 Ga0495603_0000970_13134_13976 264
290 3300046459 Ga0495629_0020938 Ga0495629_0020938_3219_4061 264
291 3300046460 Ga0495638_0000035 Ga0495638_0000035_57817_58650 264
292 3300046461 Ga0495641_0015339 Ga0495641_0015339_1573_2415 264
293 3300046463 Ga0495653_0015077 Ga0495653_0015077_1854_2696 264
294 3300046472 Ga0495580_0000089 Ga0495580_0000089_28519_29361 264
295 3300046473 Ga0495582_0000440 Ga0495582_0000440_16009_16851 264
296 3300046476 Ga0495662_0001678 Ga0495662_0001678_7124_7966 264
297 3300046477 Ga0495664_0013722 Ga0495664_0013722_3360_4202 264
298 3300046514 Ga0495618_0006297 Ga0495618_0006297_5758_6600 264
299 3300046516 Ga0495628_0011029 Ga0495628_0011029_1835_2677 264
300 3300046517 Ga0495630_0005477 Ga0495630_0005477_3142_3984 264
301 3300046524 Ga0495648_0003407 Ga0495648_0003407_11362_12204 264
302 3300046526 Ga0495666_0000484 Ga0495666_0000484_12636_13478 264
303 3300046529 Ga0495652_0049154 Ga0495652_0049154_1514_2356 264
304 3300046531 Ga0495665_0013499 Ga0495665_0013499_898_1740 264
305 3300046533 Ga0495640_0005488 Ga0495640_0005488_7070_7912 264
306 3300046535 Ga0495586_0023144 Ga0495586_0023144_1386_2228 264
307 3300046536 Ga0495587_0001336 Ga0495587_0001336_5851_6693 264
308 3300046543 Ga0495645_0015885 Ga0495645_0015885_1710_2552 264
309 3300046642 Ga0495634_0005387 Ga0495634_0005387_5879_6721 264
310 3300046663 Ga0495635_0004204 Ga0495635_0004204_1452_2294 264
311 3300046664 Ga0495659_0004068 Ga0495659_0004068_2413_3243 264
312 3300046665 Ga0495661_0021393 Ga0495661_0021393_1862_2704 264
313 3300046674 Ga0495588_0147346 Ga0495588_0147346_377_1219 264
314 3300046678 Ga0495599_0011049 Ga0495599_0011049_3998_4840 264
315 3300046679 Ga0495623_0005232 Ga0495623_0005232_4132_4974 264
316 3300046680 Ga0495646_0005838 Ga0495646_0005838_3830_4672 264
317 3300046684 Ga0495669_0123378 Ga0495669_0123378_31_879 264
318 3300046689 Ga0495613_0012980 Ga0495613_0012980_1128_1970 264
319 3300046690 Ga0495624_0048298 Ga0495624_0048298_898_1740 264
320 3300046694 Ga0495649_0153050 Ga0495649_0153050_72_905 264
321 3300047315 Ga0495581_0000472 Ga0495581_0000472_16035_16877 264
322 3300047317 Ga0495604_0038161 Ga0495604_0038161_2547_3389 264
323 3300047319 Ga0495674_0052983 Ga0495674_0052983_1701_2543 264
324 3300047321 Ga0495676_0007998 Ga0495676_0007998_1670_2512 264
325 3300047322 Ga0495680_0003884 Ga0495680_0003884_11211_12053 264
326 3300047444 Ga0495675_0007533 Ga0495675_0007533_2098_2940 264
327 3300047444 Ga0495675_0072476 Ga0495675_0072476_415_1248 264
328 3300047446 Ga0495679_005810 Ga0495679_005810_2939_3781 264
329 3300047673 Ga0495593_0004322 Ga0495593_0004322_597_1439 264
330 3300047673 Ga0495593_0012130 Ga0495593_0012130_3068_3901 264
331 3300048088 Ga0495602_0091784 Ga0495602_0091784_1197_2039 264
332 3300048088 Ga0495602_0105886 Ga0495602_0105886_725_1558 264
333 3300048089 Ga0495614_0005391 Ga0495614_0005391_4227_5069 264
334 3300048908 Ga0496105_0053361 Ga0496105_0053361_2365_3240 264
335 3300048912 Ga0496109_0206507 Ga0496109_0206507_855_1730 264
336 3300048913 Ga0496110_0212263 Ga0496110_0212263_372_1247 264
337 3300048918 Ga0496115_0284861 Ga0496115_0284861_411_1286 264
338 3300050507 nmdc:mga05p37_357681_c1 nmdc:mga05p37_357681_c1_466_1317 264
339 3300050507 nmdc:mga05p37_424698_c1 nmdc:mga05p37_424698_c1_297_1148 264
340 3300050507 nmdc:mga05p37_6447_c1 nmdc:mga05p37_6447_c1_9515_10366 264
341 3300050512 nmdc:mga0n895_91098_c1 nmdc:mga0n895_91098_c1_1946_2794 264
342 3300050513 nmdc:mga0rr50_154206_c1 nmdc:mga0rr50_154206_c1_910_1758 264
343 3300050515 nmdc:mga0a205_110138_c1 nmdc:mga0a205_110138_c1_1655_2503 264
344 3300053077 Ga0495601_0038383 Ga0495601_0038383_343_1218 264
345 3300053139 Ga0500568_0000113 Ga0500568_0000113_47842_48675 264
346 3300053153 Ga0500616_0000199 Ga0500616_0000199_73394_74227 264
347 3300053156 Ga0500622_0014969 Ga0500622_0014969_1635_2468 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

129

302

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7715 81 246
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7577 39 254
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7556 64 257
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7336 85 248
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7265 77 257
ID Description Score Start End Superfamily
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8912 76 255 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8848 75 257 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8782 74 255 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.869 81 254 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8557 81 255 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5C5SFA5-F1-model_v4 ABC transporter permease 0.9293 27 262 GO:0005886
GO:0010438
GO:0055085
AF-A0A1W2BMX3-F1-model_v4 NitT/TauT family transport system permease protein 0.9273 30 264 GO:0005886
GO:0055085
AF-A0A7Y0QQP2-F1-model_v4 ABC transporter permease 0.9264 34 261 GO:0005886
GO:0010438
GO:0055085
AF-A0A2Z3ILN1-F1-model_v4 ABC transporter permease 0.926 26 260 GO:0005886
GO:0010438
GO:0055085
AF-A0A5M9Z9Z5-F1-model_v4 ABC transporter permease subunit 0.9227 27 261 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
76.63 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map