F416813

General Info

Members Datasets Scaffolds Average Seq Length
346 196 692 170

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10373370|Ga0316576_103733703
Length 198
Sequence MPRREVGSQLTRHAPAGRVESAPGGSGGRPGHRYGCAVELRLARPDDAEATRDIYNAEVTGSTVTFDMVPRSLREQRAWIDARSGAMAVVVAEHEGEVVGFASLSSYRDRPAYSTTVEDSVYVRGDQRGTGVGRLLLAEVVDVASTRGFHTVMARIVGGHDASINLHRSLGFEMVGIEREVGRKFGRWLDVVVMQRLL

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
97 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
98 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
99 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
100 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
101 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.91
Nodule 0
Rhizoplane 3.76
Rhizosphere 88.73
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10373370 3300031727 Bacteria 1059
2 JGI25407J50210_10000672 3300003373 Bacteria 7089
3 JGI25407J50210_10093565 3300003373 Bacteria 744
4 Ga0070676_10169318 3300005328 Bacteria 1412
5 Ga0070676_10877716 3300005328 Bacteria 667
6 Ga0070690_100679158 3300005330 Bacteria 789
7 Ga0070666_10386521 3300005335 Bacteria 1005
8 Ga0068868_101069368 3300005338 Unclassified 741
9 Ga0070660_100797344 3300005339 Bacteria 794
10 Ga0070661_100198499 3300005344 Bacteria 1532
11 Ga0070675_100311678 3300005354 Bacteria 1388
12 Ga0070671_101512920 3300005355 Unclassified 594
13 Ga0070674_100505587 3300005356 Bacteria 1007
14 Ga0070674_101064481 3300005356 Bacteria 713
15 Ga0070659_100374114 3300005366 Bacteria 1199
16 Ga0070714_100057309 3300005435 Bacteria 3334
17 Ga0070701_10279905 3300005438 Bacteria 1018
18 Ga0070700_100664816 3300005441 Bacteria 824
19 Ga0070708_100076106 3300005445 Bacteria 3030
20 Ga0070678_100292393 3300005456 Bacteria 1382
21 Ga0070678_101069365 3300005456 Bacteria 744
22 Ga0070685_11220794 3300005466 Bacteria 572
23 Ga0070706_100084815 3300005467 Bacteria 2935
24 Ga0068855_100176612 3300005563 Bacteria 2416
25 Ga0068864_101663428 3300005618 Bacteria 643
26 Ga0068861_101821265 3300005719 Unclassified 604
27 Ga0081455_10004404 3300005937 Bacteria 15825
28 Ga0081455_10107660 3300005937 Bacteria 2222
29 Ga0081455_10118668 3300005937 Bacteria 2088
30 Ga0081538_10001047 3300005981 Bacteria 29464
31 Ga0081538_10026914 3300005981 Bacteria 4004
32 Ga0081538_10029592 3300005981 Bacteria 3738
33 Ga0081538_10060139 3300005981 Bacteria 2188
34 Ga0081539_10174962 3300005985 Bacteria 1011
35 Ga0070717_11279141 3300006028 Bacteria 667
36 Ga0075365_10025447 3300006038 Bacteria 3747
37 Ga0075365_10364438 3300006038 Bacteria 1019
38 Ga0075365_10379372 3300006038 Bacteria 997
39 Ga0075363_100014660 3300006048 Bacteria 3838
40 Ga0075363_100206604 3300006048 Bacteria 1123
41 Ga0075364_10030841 3300006051 Bacteria 3442
42 Ga0075367_10218178 3300006178 Bacteria 1193
43 Ga0075428_100000536 3300006844 Bacteria 38651
44 Ga0075428_100016017 3300006844 Bacteria 8292
45 Ga0075428_100075476 3300006844 Bacteria 3681
46 Ga0075428_101267680 3300006844 Bacteria 776
47 Ga0075428_101273957 3300006844 Bacteria 774
48 Ga0075430_100074325 3300006846 Bacteria 2850
49 Ga0075430_100147363 3300006846 Bacteria 1960
50 Ga0075431_100020602 3300006847 Bacteria 6739
51 Ga0075431_100067240 3300006847 Bacteria 3699
52 Ga0075431_100075648 3300006847 Bacteria 3474
53 Ga0075431_100146846 3300006847 Bacteria 2430
54 Ga0075431_100156372 3300006847 Bacteria 2345
55 Ga0075433_10732562 3300006852 Bacteria 865
56 Ga0075429_100009679 3300006880 Bacteria 8357
57 Ga0075429_100045696 3300006880 Bacteria 3810
58 Ga0075429_100089473 3300006880 Bacteria 2683
59 Ga0075429_100408592 3300006880 Bacteria 1189
60 Ga0075429_100676067 3300006880 Bacteria 905
61 Ga0068865_101317359 3300006881 Bacteria 643
62 Ga0075435_100254699 3300007076 Bacteria 1495
63 Ga0075435_101052329 3300007076 Bacteria 711
64 Ga0111539_10013079 3300009094 Bacteria 10382
65 Ga0111539_10821634 3300009094 Unclassified 1081
66 Ga0111539_11582454 3300009094 Bacteria 760
67 Ga0105245_10000432 3300009098 Bacteria 38771
68 Ga0105245_10012595 3300009098 Bacteria 7362
69 Ga0105245_10327262 3300009098 Bacteria 1511
70 Ga0105245_10371754 3300009098 Bacteria 1421
71 Ga0105245_10562667 3300009098 Bacteria 1163
72 Ga0114129_10017697 3300009147 Bacteria 10146
73 Ga0114129_10082860 3300009147 Bacteria 4456
74 Ga0114129_10093728 3300009147 Bacteria 4159
75 Ga0114129_10571604 3300009147 Bacteria 1468
76 Ga0114129_11049789 3300009147 Bacteria 1023
77 Ga0105243_10687199 3300009148 Bacteria 996
78 Ga0105242_11770042 3300009176 Bacteria 656
79 Ga0105249_10518186 3300009553 Bacteria 1239
80 Ga0105239_10338925 3300010375 Bacteria 1696
81 Ga0105246_10748817 3300011119 Bacteria 861
82 Ga0157369_10749044 3300013105 Bacteria 1005
83 Ga0157378_10217814 3300013297 Bacteria 1814
84 Ga0157378_10269658 3300013297 Bacteria 1637
85 Ga0157378_10562749 3300013297 Bacteria 1147
86 Ga0163162_10497458 3300013306 Bacteria 1350
87 Ga0163162_10671682 3300013306 Bacteria 1159
88 Ga0163162_11262589 3300013306 Bacteria 839
89 Ga0163163_12378514 3300014325 Unclassified 588
90 Ga0157380_10798252 3300014326 Bacteria 961
91 Ga0157376_10329752 3300014969 Bacteria 1454
92 Ga0163161_11792019 3300017792 Bacteria 545
93 Ga0213876_10003286 3300021384 Bacteria 9282
94 Ga0224712_10330239 3300022467 Bacteria 718
95 Ga0207645_10162358 3300025907 Bacteria 1462
96 Ga0207684_10068686 3300025910 Bacteria 3011
97 Ga0207663_10689859 3300025916 Bacteria 808
98 Ga0207660_10612227 3300025917 Bacteria 887
99 Ga0207649_10183608 3300025920 Bacteria 1466
100 Ga0207652_11070656 3300025921 Bacteria 706
101 Ga0207646_11337932 3300025922 Bacteria 625
102 Ga0207659_10537435 3300025926 Bacteria 992
103 Ga0207659_10945355 3300025926 Bacteria 741
104 Ga0207687_10001228 3300025927 Bacteria 17549
105 Ga0207687_10011259 3300025927 Bacteria 5844
106 Ga0207664_10159136 3300025929 Bacteria 1925
107 Ga0207709_10669911 3300025935 Bacteria 828
108 Ga0207669_10513467 3300025937 Bacteria 961
109 Ga0207703_11242217 3300026035 Bacteria 716
110 Ga0207675_101134313 3300026118 Bacteria 802
111 Ga0207683_10407497 3300026121 Bacteria 1251
112 Ga0207428_10033921 3300027907 Bacteria 4186
113 Ga0207428_10318093 3300027907 Bacteria 1150
114 Ga0265334_10084444 3300028573 Unclassified 1166
115 Ga0265328_10001196 3300031239 Bacteria 12014
116 Ga0265327_10036257 3300031251 Bacteria 2713
117 Ga0265316_10053577 3300031344 Bacteria 3160
118 Ga0316579_10051304 3300031691 Bacteria 1930
119 Ga0316579_10127402 3300031691 Bacteria 1225
120 Ga0316576_10178638 3300031727 Bacteria 1601
121 Ga0316576_10192629 3300031727 Bacteria 1537
122 Ga0316578_10246781 3300031728 Bacteria 1071
123 Ga0307405_10183469 3300031731 Bacteria 1505
124 Ga0316577_10058600 3300031733 Bacteria 2150
125 Ga0307413_10254446 3300031824 Bacteria 1305
126 Ga0307410_10145535 3300031852 Bacteria 1758
127 Ga0307407_10011498 3300031903 Bacteria 4216
128 Ga0307409_100078785 3300031995 Bacteria 2652
129 Ga0373948_0099385 3300034817 Bacteria 684
130 Ga0316574_0004367 3300035398 Bacteria 7395
131 Ga0316574_0018872 3300035398 Bacteria 4061
132 Ga0316574_0265822 3300035398 Bacteria 1094
133 Ga0373937_0066628 3300036401 Bacteria 3317
134 Ga0316582_0547352 3300036647 Bacteria 797
135 Ga0316584_0000507 3300036712 Bacteria 20573
136 Ga0436364_0075163 3300037853 Bacteria 1154
137 Ga0436364_1370074 3300037853 Bacteria 4783
138 Ga0436364_1481355 3300037853 Bacteria 2577
139 Ga0436365_1032635 3300039437 Bacteria 2779
140 Ga0436365_1224969 3300039437 Bacteria 2154
141 Ga0436360_0714837 3300039438 Bacteria 692
142 Ga0436361_0566957 3300039447 Bacteria 947
143 Ga0436362_0796209 3300039453 Bacteria 1515
144 Ga0436362_1110502 3300039453 Bacteria 1983
145 Ga0439448_0016593 3300042005 Bacteria 2242
146 Ga0439450_024363 3300042008 Bacteria 1319
147 Ga0439452_060986 3300042010 Bacteria 845
148 Ga0439454_020299 3300042011 Bacteria 973
149 Ga0439455_0015295 3300042012 Bacteria 1763
150 Ga0439463_001797 3300042016 Bacteria 5582
151 Ga0450902_020834 3300042137 Bacteria 1082
152 Ga0439446_0040622 3300042156 Bacteria 1370
153 Ga0450908_024137 3300042184 Bacteria 1064
154 Ga0439434_0013411 3300042435 Bacteria 2433
155 Ga0439460_0000853 3300042461 Bacteria 6956
156 Ga0451577_0001387 3300042876 Bacteria 32416
157 Ga0439440_0046732 3300042993 Bacteria 1070
158 Ga0466965_0227586 3300044683 Bacteria 995
159 Ga0466966_0096966 3300044684 Bacteria 1826
160 Ga0466961_0518220 3300044693 Bacteria 719
161 Ga0453684_0040172 3300044712 Bacteria 6360
162 Ga0466967_0328816 3300045976 Bacteria 1476
163 Ga0466967_2081669 3300045976 Bacteria 564
164 Ga0495629_0111647 3300046459 Bacteria 1906
165 Ga0495629_0685210 3300046459 Bacteria 681
166 Ga0495629_0826643 3300046459 Bacteria 610
167 Ga0495653_0481594 3300046463 Unclassified 776
168 Ga0495582_0114257 3300046473 Bacteria 1518
169 Ga0495639_0021550 3300046475 Bacteria 2822
170 Ga0495664_0471662 3300046477 Bacteria 751
171 Ga0495618_0128944 3300046514 Bacteria 1619
172 Ga0495628_0648485 3300046516 Bacteria 750
173 Ga0495630_0511304 3300046517 Bacteria 921
174 Ga0495621_0012716 3300046539 Bacteria 2629
175 Ga0495667_0339423 3300046559 Bacteria 950
176 Ga0495634_0002061 3300046642 Bacteria 16998
177 Ga0495635_0356126 3300046663 Bacteria 976
178 Ga0495657_0365460 3300046675 Unclassified 852
179 Ga0495646_0340385 3300046680 Unclassified 787
180 Ga0495647_0216536 3300046681 Bacteria 844
181 Ga0495658_0066947 3300046683 Bacteria 2076
182 Ga0495658_0227912 3300046683 Bacteria 1168
183 Ga0495658_0491769 3300046683 Bacteria 784
184 Ga0495613_0033830 3300046689 Bacteria 3796
185 Ga0495613_0077330 3300046689 Bacteria 2421
186 Ga0495613_0457497 3300046689 Bacteria 864
187 Ga0495624_0775395 3300046690 Bacteria 567
188 Ga0495581_0030008 3300047315 Bacteria 3152
189 Ga0495676_0981945 3300047321 Bacteria 539
190 Ga0495680_0320456 3300047322 Bacteria 1085
191 Ga0495680_0496904 3300047322 Unclassified 828
192 Ga0495684_0402601 3300047471 Bacteria 960
193 Ga0495614_0024894 3300048089 Bacteria 2583
194 Ga0495614_0064712 3300048089 Bacteria 1573
195 Ga0496100_1251127 3300048903 Unclassified 586
196 Ga0496102_0634641 3300048905 Bacteria 991
197 Ga0496108_0358941 3300048911 Bacteria 1272
198 Ga0496108_0597075 3300048911 Bacteria 962
199 Ga0496110_0722715 3300048913 Bacteria 898
200 Ga0496111_0349805 3300048914 Bacteria 1094
201 Ga0496111_1089348 3300048914 Bacteria 570
202 Ga0496113_0638331 3300048916 Bacteria 852
203 Ga0496114_0298482 3300048917 Bacteria 1422
204 Ga0496114_0334590 3300048917 Bacteria 1339
205 Ga0496114_0373532 3300048917 Bacteria 1262
206 Ga0496114_1319509 3300048917 Bacteria 608
207 Ga0496114_1474726 3300048917 Bacteria 568
208 Ga0496119_0130953 3300048922 Bacteria 1367
209 Ga0496120_0368610 3300048923 Bacteria 641
210 Ga0496121_0002861 3300048924 Bacteria 25436
211 Ga0501031_0063019 3300049568 Bacteria 2416
212 Ga0501031_0129051 3300049568 Bacteria 1651
213 Ga0501031_0691095 3300049568 Bacteria 655
214 Ga0501032_0066888 3300049569 Bacteria 2401
215 Ga0501033_0014236 3300049570 Bacteria 6046
216 Ga0501033_0099246 3300049570 Unclassified 2126
217 Ga0501034_0000981 3300049571 Bacteria 41010
218 Ga0501034_0092837 3300049571 Bacteria 3015
219 Ga0501036_0010845 3300049572 Bacteria 7528
220 Ga0501036_0058433 3300049572 Bacteria 3267
221 Ga0501036_0142670 3300049572 Bacteria 2021
222 Ga0501036_0201044 3300049572 Bacteria 1676
223 Ga0501037_0476802 3300049573 Bacteria 849
224 Ga0501037_0508965 3300049573 Bacteria 816
225 Ga0501038_0042313 3300049574 Bacteria 3967
226 Ga0501038_0153479 3300049574 Bacteria 1876
227 Ga0501039_0004007 3300049575 Bacteria 11071
228 Ga0501039_0006999 3300049575 Bacteria 8587
229 Ga0501039_0220737 3300049575 Bacteria 1490
230 Ga0501039_0888524 3300049575 Unclassified 694
231 Ga0501040_0006678 3300049576 Bacteria 7487
232 Ga0501040_0021881 3300049576 Bacteria 4275
233 Ga0501040_0162569 3300049576 Bacteria 1579
234 Ga0501041_0003973 3300049577 Bacteria 8533
235 Ga0501041_0012010 3300049577 Bacteria 5125
236 Ga0501041_0813712 3300049577 Bacteria 599
237 Ga0501042_0020951 3300049578 Bacteria 4552
238 Ga0501043_0052676 3300049579 Bacteria 3196
239 Ga0501043_0108441 3300049579 Bacteria 2181
240 Ga0501046_0003011 3300049580 Bacteria 15578
241 Ga0501046_0023315 3300049580 Bacteria 5093
242 Ga0501046_0088690 3300049580 Bacteria 2382
243 Ga0501047_0529003 3300049581 Bacteria 1004
244 Ga0501048_0007282 3300049582 Bacteria 8389
245 Ga0501048_0009534 3300049582 Bacteria 7288
246 Ga0501067_0014511 3300049583 Bacteria 4362
247 Ga0501068_0016012 3300049584 Bacteria 4319
248 Ga0501068_0027903 3300049584 Bacteria 3336
249 Ga0501068_0033562 3300049584 Bacteria 3056
250 Ga0501068_0085463 3300049584 Bacteria 1941
251 Ga0501068_0169313 3300049584 Bacteria 1378
252 Ga0501069_0003807 3300049585 Bacteria 7760
253 Ga0501069_0631468 3300049585 Bacteria 644
254 Ga0501070_0003905 3300049586 Bacteria 12861
255 Ga0501070_0136043 3300049586 Bacteria 2029
256 Ga0501070_0298362 3300049586 Bacteria 1313
257 Ga0501071_0008766 3300049587 Bacteria 6699
258 Ga0501071_0010251 3300049587 Bacteria 6273
259 Ga0501071_0014709 3300049587 Bacteria 5355
260 Ga0501071_0027176 3300049587 Bacteria 4024
261 Ga0501071_1009387 3300049587 Bacteria 643
262 Ga0501072_0003940 3300049588 Bacteria 11232
263 Ga0501072_0013533 3300049588 Bacteria 6243
264 Ga0501072_0027773 3300049588 Bacteria 4415
265 Ga0501072_0073997 3300049588 Bacteria 2693
266 Ga0501072_0104645 3300049588 Bacteria 2250
267 Ga0501072_0355479 3300049588 Bacteria 1163
268 Ga0501073_0000123 3300049589 Bacteria 50179
269 Ga0501073_0014599 3300049589 Bacteria 5707
270 Ga0501073_0059623 3300049589 Bacteria 2665
271 Ga0501073_0088679 3300049589 Bacteria 2151
272 Ga0501073_0117382 3300049589 Bacteria 1844
273 Ga0501074_0004568 3300049590 Bacteria 9909
274 Ga0501074_0010731 3300049590 Bacteria 6656
275 Ga0501074_0039575 3300049590 Bacteria 3415
276 Ga0501074_0044968 3300049590 Bacteria 3195
277 Ga0501074_0106390 3300049590 Bacteria 2008
278 Ga0501074_0305494 3300049590 Unclassified 1130
279 Ga0501075_0004105 3300049591 Bacteria 9834
280 Ga0501075_0004226 3300049591 Bacteria 9704
281 Ga0501075_0327780 3300049591 Bacteria 1167
282 Ga0501076_0006986 3300049592 Bacteria 8204
283 Ga0501076_0062721 3300049592 Bacteria 2960
284 Ga0501077_0008975 3300049593 Bacteria 6202
285 Ga0501077_0009261 3300049593 Bacteria 6114
286 Ga0501079_0083606 3300049741 Bacteria 2469
287 Ga0501079_0097006 3300049741 Bacteria 2285
288 Ga0501079_0121278 3300049741 Bacteria 2033
289 Ga0501079_0127681 3300049741 Bacteria 1978
290 Ga0501080_0061036 3300049742 Bacteria 3510
291 Ga0501080_0077290 3300049742 Bacteria 3095
292 Ga0501080_0511106 3300049742 Bacteria 1073
293 Ga0501080_0552758 3300049742 Bacteria 1025
294 Ga0501081_0283518 3300049743 Bacteria 1213
295 Ga0501083_0039077 3300049744 Bacteria 3223
296 Ga0501083_0069783 3300049744 Bacteria 2338
297 Ga0501083_0394363 3300049744 Bacteria 900
298 Ga0501035_0148763 3300049822 Bacteria 2033
299 Ga0501045_0004970 3300049824 Bacteria 9215
300 Ga0501045_0009738 3300049824 Bacteria 6722
301 Ga0501045_0314191 3300049824 Bacteria 1166
302 nmdc:mga03n38_32920_c1 3300050490 Bacteria 2201
303 nmdc:mga03n38_402206_c1 3300050490 Bacteria 754
304 nmdc:mga00v17_65354_c1 3300050491 Bacteria 2244
305 nmdc:mga0yw44_237_c1 3300050492 Bacteria 18844
306 nmdc:mga05p37_155625_c1 3300050507 Bacteria 2794
307 nmdc:mga05p37_247906_c1 3300050507 Bacteria 2138
308 nmdc:mga05p37_25247_c1 3300050507 Bacteria 7226
309 nmdc:mga05p37_332690_c1 3300050507 Bacteria 1793
310 nmdc:mga05p37_637337_c1 3300050507 Bacteria 1196
311 nmdc:mga09592_41212_c1 3300050508 Bacteria 3882
312 nmdc:mga09592_71288_c1 3300050508 Bacteria 2950
313 nmdc:mga0qj67_128255_c1 3300050509 Bacteria 2053
314 nmdc:mga0qj67_36157_c1 3300050509 Bacteria 3864
315 nmdc:mga06r32_121420_c1 3300050510 Bacteria 2578
316 nmdc:mga06r32_14563_c1 3300050510 Bacteria 7140
317 nmdc:mga06r32_294274_c1 3300050510 Bacteria 1610
318 nmdc:mga06r32_87180_c1 3300050510 Bacteria 3046
319 nmdc:mga08y16_47964_c1 3300050511 Bacteria 4471
320 nmdc:mga08y16_56310_c1 3300050511 Bacteria 4110
321 nmdc:mga0n895_593581_c1 3300050512 Bacteria 1110
322 nmdc:mga0n895_807034_c1 3300050512 Bacteria 928
323 nmdc:mga0rr50_1143176_c1 3300050513 Bacteria 662
324 Ga0500635_0008697 3300053080 Bacteria 2793
325 Ga0495595_0007560 3300053084 Bacteria 4448
326 Ga0495595_0384835 3300053084 Bacteria 710
327 Ga0495619_0010029 3300053085 Bacteria 5963
328 Ga0495619_0141712 3300053085 Bacteria 1656
329 Ga0500566_0324122 3300053094 Bacteria 716
330 Ga0500554_062696 3300053102 Bacteria 1196
331 Ga0500595_001601 3300053119 Bacteria 11923
332 Ga0500568_0000029 3300053139 Bacteria 159927
333 Ga0500603_000523 3300053150 Bacteria 9711
334 Ga0501084_0020935 3300054114 Bacteria 5454
335 Ga0501084_0040719 3300054114 Bacteria 3887
336 Ga0501084_0994045 3300054114 Bacteria 705
337 Ga0501082_0016297 3300060353 Bacteria 6397
338 Ga0501082_0019562 3300060353 Bacteria 5839
339 Ga0501082_0383411 3300060353 Bacteria 1227
340 Ga0501082_0477355 3300060353 Bacteria 1090
341 Ga0501082_1115425 3300060353 Bacteria 690
342 Ga0530510_0003778 3300061734 Bacteria 10427
343 Ga0530510_0010660 3300061734 Bacteria 6448
344 Ga0530510_0032612 3300061734 Bacteria 3748
345 Ga0530510_0562433 3300061734 Bacteria 866
346 Ga0530510_0565561 3300061734 Bacteria 864
347 Ga0316576_10373370
348 JGI25407J50210_10000672
349 JGI25407J50210_10093565
350 Ga0070676_10169318
351 Ga0070676_10877716
352 Ga0070690_100679158
353 Ga0070666_10386521
354 Ga0068868_101069368
355 Ga0070660_100797344
356 Ga0070661_100198499
357 Ga0070675_100311678
358 Ga0070671_101512920
359 Ga0070674_100505587
360 Ga0070674_101064481
361 Ga0070659_100374114
362 Ga0070714_100057309
363 Ga0070701_10279905
364 Ga0070700_100664816
365 Ga0070708_100076106
366 Ga0070678_100292393
367 Ga0070678_101069365
368 Ga0070685_11220794
369 Ga0070706_100084815
370 Ga0068855_100176612
371 Ga0068864_101663428
372 Ga0068861_101821265
373 Ga0081455_10004404
374 Ga0081455_10107660
375 Ga0081455_10118668
376 Ga0081538_10001047
377 Ga0081538_10026914
378 Ga0081538_10029592
379 Ga0081538_10060139
380 Ga0081539_10174962
381 Ga0070717_11279141
382 Ga0075365_10025447
383 Ga0075365_10364438
384 Ga0075365_10379372
385 Ga0075363_100014660
386 Ga0075363_100206604
387 Ga0075364_10030841
388 Ga0075367_10218178
389 Ga0075428_100000536
390 Ga0075428_100016017
391 Ga0075428_100075476
392 Ga0075428_101267680
393 Ga0075428_101273957
394 Ga0075430_100074325
395 Ga0075430_100147363
396 Ga0075431_100020602
397 Ga0075431_100067240
398 Ga0075431_100075648
399 Ga0075431_100146846
400 Ga0075431_100156372
401 Ga0075433_10732562
402 Ga0075429_100009679
403 Ga0075429_100045696
404 Ga0075429_100089473
405 Ga0075429_100408592
406 Ga0075429_100676067
407 Ga0068865_101317359
408 Ga0075435_100254699
409 Ga0075435_101052329
410 Ga0111539_10013079
411 Ga0111539_10821634
412 Ga0111539_11582454
413 Ga0105245_10000432
414 Ga0105245_10012595
415 Ga0105245_10327262
416 Ga0105245_10371754
417 Ga0105245_10562667
418 Ga0114129_10017697
419 Ga0114129_10082860
420 Ga0114129_10093728
421 Ga0114129_10571604
422 Ga0114129_11049789
423 Ga0105243_10687199
424 Ga0105242_11770042
425 Ga0105249_10518186
426 Ga0105239_10338925
427 Ga0105246_10748817
428 Ga0157369_10749044
429 Ga0157378_10217814
430 Ga0157378_10269658
431 Ga0157378_10562749
432 Ga0163162_10497458
433 Ga0163162_10671682
434 Ga0163162_11262589
435 Ga0163163_12378514
436 Ga0157380_10798252
437 Ga0157376_10329752
438 Ga0163161_11792019
439 Ga0213876_10003286
440 Ga0224712_10330239
441 Ga0207645_10162358
442 Ga0207684_10068686
443 Ga0207663_10689859
444 Ga0207660_10612227
445 Ga0207649_10183608
446 Ga0207652_11070656
447 Ga0207646_11337932
448 Ga0207659_10537435
449 Ga0207659_10945355
450 Ga0207687_10001228
451 Ga0207687_10011259
452 Ga0207664_10159136
453 Ga0207709_10669911
454 Ga0207669_10513467
455 Ga0207703_11242217
456 Ga0207675_101134313
457 Ga0207683_10407497
458 Ga0207428_10033921
459 Ga0207428_10318093
460 Ga0265334_10084444
461 Ga0265328_10001196
462 Ga0265327_10036257
463 Ga0265316_10053577
464 Ga0316579_10051304
465 Ga0316579_10127402
466 Ga0316576_10178638
467 Ga0316576_10192629
468 Ga0316578_10246781
469 Ga0307405_10183469
470 Ga0316577_10058600
471 Ga0307413_10254446
472 Ga0307410_10145535
473 Ga0307407_10011498
474 Ga0307409_100078785
475 Ga0373948_0099385
476 Ga0316574_0004367
477 Ga0316574_0018872
478 Ga0316574_0265822
479 Ga0373937_0066628
480 Ga0316582_0547352
481 Ga0316584_0000507
482 Ga0436364_0075163
483 Ga0436364_1370074
484 Ga0436364_1481355
485 Ga0436365_1032635
486 Ga0436365_1224969
487 Ga0436360_0714837
488 Ga0436361_0566957
489 Ga0436362_0796209
490 Ga0436362_1110502
491 Ga0439448_0016593
492 Ga0439450_024363
493 Ga0439452_060986
494 Ga0439454_020299
495 Ga0439455_0015295
496 Ga0439463_001797
497 Ga0450902_020834
498 Ga0439446_0040622
499 Ga0450908_024137
500 Ga0439434_0013411
501 Ga0439460_0000853
502 Ga0451577_0001387
503 Ga0439440_0046732
504 Ga0466965_0227586
505 Ga0466966_0096966
506 Ga0466961_0518220
507 Ga0453684_0040172
508 Ga0466967_0328816
509 Ga0466967_2081669
510 Ga0495629_0111647
511 Ga0495629_0685210
512 Ga0495629_0826643
513 Ga0495653_0481594
514 Ga0495582_0114257
515 Ga0495639_0021550
516 Ga0495664_0471662
517 Ga0495618_0128944
518 Ga0495628_0648485
519 Ga0495630_0511304
520 Ga0495621_0012716
521 Ga0495667_0339423
522 Ga0495634_0002061
523 Ga0495635_0356126
524 Ga0495657_0365460
525 Ga0495646_0340385
526 Ga0495647_0216536
527 Ga0495658_0066947
528 Ga0495658_0227912
529 Ga0495658_0491769
530 Ga0495613_0033830
531 Ga0495613_0077330
532 Ga0495613_0457497
533 Ga0495624_0775395
534 Ga0495581_0030008
535 Ga0495676_0981945
536 Ga0495680_0320456
537 Ga0495680_0496904
538 Ga0495684_0402601
539 Ga0495614_0024894
540 Ga0495614_0064712
541 Ga0496100_1251127
542 Ga0496102_0634641
543 Ga0496108_0358941
544 Ga0496108_0597075
545 Ga0496110_0722715
546 Ga0496111_0349805
547 Ga0496111_1089348
548 Ga0496113_0638331
549 Ga0496114_0298482
550 Ga0496114_0334590
551 Ga0496114_0373532
552 Ga0496114_1319509
553 Ga0496114_1474726
554 Ga0496119_0130953
555 Ga0496120_0368610
556 Ga0496121_0002861
557 Ga0501031_0063019
558 Ga0501031_0129051
559 Ga0501031_0691095
560 Ga0501032_0066888
561 Ga0501033_0014236
562 Ga0501033_0099246
563 Ga0501034_0000981
564 Ga0501034_0092837
565 Ga0501036_0010845
566 Ga0501036_0058433
567 Ga0501036_0142670
568 Ga0501036_0201044
569 Ga0501037_0476802
570 Ga0501037_0508965
571 Ga0501038_0042313
572 Ga0501038_0153479
573 Ga0501039_0004007
574 Ga0501039_0006999
575 Ga0501039_0220737
576 Ga0501039_0888524
577 Ga0501040_0006678
578 Ga0501040_0021881
579 Ga0501040_0162569
580 Ga0501041_0003973
581 Ga0501041_0012010
582 Ga0501041_0813712
583 Ga0501042_0020951
584 Ga0501043_0052676
585 Ga0501043_0108441
586 Ga0501046_0003011
587 Ga0501046_0023315
588 Ga0501046_0088690
589 Ga0501047_0529003
590 Ga0501048_0007282
591 Ga0501048_0009534
592 Ga0501067_0014511
593 Ga0501068_0016012
594 Ga0501068_0027903
595 Ga0501068_0033562
596 Ga0501068_0085463
597 Ga0501068_0169313
598 Ga0501069_0003807
599 Ga0501069_0631468
600 Ga0501070_0003905
601 Ga0501070_0136043
602 Ga0501070_0298362
603 Ga0501071_0008766
604 Ga0501071_0010251
605 Ga0501071_0014709
606 Ga0501071_0027176
607 Ga0501071_1009387
608 Ga0501072_0003940
609 Ga0501072_0013533
610 Ga0501072_0027773
611 Ga0501072_0073997
612 Ga0501072_0104645
613 Ga0501072_0355479
614 Ga0501073_0000123
615 Ga0501073_0014599
616 Ga0501073_0059623
617 Ga0501073_0088679
618 Ga0501073_0117382
619 Ga0501074_0004568
620 Ga0501074_0010731
621 Ga0501074_0039575
622 Ga0501074_0044968
623 Ga0501074_0106390
624 Ga0501074_0305494
625 Ga0501075_0004105
626 Ga0501075_0004226
627 Ga0501075_0327780
628 Ga0501076_0006986
629 Ga0501076_0062721
630 Ga0501077_0008975
631 Ga0501077_0009261
632 Ga0501079_0083606
633 Ga0501079_0097006
634 Ga0501079_0121278
635 Ga0501079_0127681
636 Ga0501080_0061036
637 Ga0501080_0077290
638 Ga0501080_0511106
639 Ga0501080_0552758
640 Ga0501081_0283518
641 Ga0501083_0039077
642 Ga0501083_0069783
643 Ga0501083_0394363
644 Ga0501035_0148763
645 Ga0501045_0004970
646 Ga0501045_0009738
647 Ga0501045_0314191
648 nmdc:mga03n38_32920_c1
649 nmdc:mga03n38_402206_c1
650 nmdc:mga00v17_65354_c1
651 nmdc:mga0yw44_237_c1
652 nmdc:mga05p37_155625_c1
653 nmdc:mga05p37_247906_c1
654 nmdc:mga05p37_25247_c1
655 nmdc:mga05p37_332690_c1
656 nmdc:mga05p37_637337_c1
657 nmdc:mga09592_41212_c1
658 nmdc:mga09592_71288_c1
659 nmdc:mga0qj67_128255_c1
660 nmdc:mga0qj67_36157_c1
661 nmdc:mga06r32_121420_c1
662 nmdc:mga06r32_14563_c1
663 nmdc:mga06r32_294274_c1
664 nmdc:mga06r32_87180_c1
665 nmdc:mga08y16_47964_c1
666 nmdc:mga08y16_56310_c1
667 nmdc:mga0n895_593581_c1
668 nmdc:mga0n895_807034_c1
669 nmdc:mga0rr50_1143176_c1
670 Ga0500635_0008697
671 Ga0495595_0007560
672 Ga0495595_0384835
673 Ga0495619_0010029
674 Ga0495619_0141712
675 Ga0500566_0324122
676 Ga0500554_062696
677 Ga0500595_001601
678 Ga0500568_0000029
679 Ga0500603_000523
680 Ga0501084_0020935
681 Ga0501084_0040719
682 Ga0501084_0994045
683 Ga0501082_0016297
684 Ga0501082_0019562
685 Ga0501082_0383411
686 Ga0501082_0477355
687 Ga0501082_1115425
688 Ga0530510_0003778
689 Ga0530510_0010660
690 Ga0530510_0032612
691 Ga0530510_0562433
692 Ga0530510_0565561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

40

193

0.95

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

56

195

0.87

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

37

173

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

85

174

0.81

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

49

172

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9558 6 166
1yvo-assembly1.cif.gz_A hypothetical acetyltransferase from p.aeruginosa pa01 0.9485 6 165
1yr0-assembly2.cif.gz_D crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens 0.9473 4 166
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.9456 3 165
4j3g-assembly2.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis 0.9444 6 166
ID Description Score Start End Superfamily
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9564 4 165 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9472 6 165 3.40.630.30
4mbuB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9303 6 165 3.40.630.30
3dr6B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9254 6 171 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9112 65 146 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6I3WL77-F1-model_v4 GNAT family N-acetyltransferase 0.9793 3 167 GO:0016747
AF-A0A116NE95-F1-model_v4 Sortase and related acyltransferase (EC 2.3.1.183) 0.9711 4 141 GO:0102971
AF-A0A4P7VRK3-F1-model_v4 N-acetyltransferase family protein 0.9707 6 134 GO:0016747
AF-A0A537ZHR3-F1-model_v4 N-acetyltransferase family protein 0.9657 22 166 GO:0016747
AF-A0A2D6FS58-F1-model_v4 GNAT family N-acetyltransferase 0.9654 5 169 GO:0016747

Map