F416771

General Info

Members Datasets Scaffolds Average Seq Length
346 216 692 253

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10201730|Ga0213876_102017301
Length 257
Sequence MGRFDGKVALVTGASRGIGRGIALRLAAEGADVVVNFLGYPEEAAEVAALIEQHGRRALVVEADTADRAALTAMFEQAVATLGRLDIAVANAATSIREAVVDADWEHVQRTIAVAQFGVFHTCQLAAQQMVRQGAGGKIVIIGSVHAEIAVPRSAAYNMAKAAVNHLGATLAAELAPHHINVNIVNPGWIDTPGERRFASEEDIRQGGKRIPWGRLGTPEDIAGVVAFLVSDDADYVTGATLRADGGFKLGLRLPDP

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
120 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
148 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.69
Metatranscriptomes 2.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 5.49
Rhizosphere 90.46
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10201730 3300021384 Bacteria 1057
2 ARCol0yngRDRAFT_1004050 3300000652 Bacteria 1066
3 Ga0065707_10138158 3300005295 Bacteria 1810
4 Ga0070658_10038136 3300005327 Bacteria 3875
5 Ga0070676_10014904 3300005328 Bacteria 4279
6 Ga0070676_10100732 3300005328 Bacteria 1784
7 Ga0070670_100032534 3300005331 Bacteria 4492
8 Ga0070670_100077865 3300005331 Bacteria 2849
9 Ga0070670_100272014 3300005331 Bacteria 1478
10 Ga0070666_10016599 3300005335 Bacteria 4711
11 Ga0070666_10263393 3300005335 Bacteria 1222
12 Ga0070660_100335695 3300005339 Bacteria 1243
13 Ga0070691_10020212 3300005341 Bacteria 3076
14 Ga0070668_100063192 3300005347 Bacteria 2869
15 Ga0070668_100086972 3300005347 Bacteria 2459
16 Ga0070668_100304334 3300005347 Bacteria 1338
17 Ga0070668_100352922 3300005347 Bacteria 1245
18 Ga0070669_100141114 3300005353 Bacteria 1858
19 Ga0070675_100007471 3300005354 Bacteria 8444
20 Ga0070671_100312414 3300005355 Bacteria 1339
21 Ga0070674_100051418 3300005356 Bacteria 2840
22 Ga0070674_100405530 3300005356 Bacteria 1115
23 Ga0070673_100115558 3300005364 Bacteria 2231
24 Ga0070673_100208092 3300005364 Bacteria 1688
25 Ga0070673_100460639 3300005364 Bacteria 1145
26 Ga0070667_100031704 3300005367 Bacteria 4406
27 Ga0070667_100087802 3300005367 Bacteria 2669
28 Ga0070700_100001775 3300005441 Bacteria 10865
29 Ga0070694_100005410 3300005444 Bacteria 7728
30 Ga0070662_100108324 3300005457 Bacteria 2113
31 Ga0070706_100009175 3300005467 Bacteria 9209
32 Ga0070707_100086756 3300005468 Bacteria 3027
33 Ga0070698_100057749 3300005471 Bacteria 3926
34 Ga0070698_100071221 3300005471 Bacteria 3487
35 Ga0070684_100352368 3300005535 Bacteria 1354
36 Ga0070697_100091762 3300005536 Bacteria 2512
37 Ga0070672_100008199 3300005543 Bacteria 7139
38 Ga0070672_100028756 3300005543 Bacteria 4160
39 Ga0070672_100129425 3300005543 Bacteria 2073
40 Ga0070695_100002487 3300005545 Bacteria 10606
41 Ga0070665_100000005 3300005548 Bacteria 734905
42 Ga0070665_100067810 3300005548 Bacteria 3577
43 Ga0070664_100272889 3300005564 Bacteria 1524
44 Ga0068857_100473561 3300005577 Bacteria 1173
45 Ga0068859_100216413 3300005617 Bacteria 2003
46 Ga0068866_10280129 3300005718 Bacteria 1033
47 Ga0068861_100052509 3300005719 Bacteria 3098
48 Ga0068863_100036463 3300005841 Bacteria 4684
49 Ga0068863_100062147 3300005841 Bacteria 3532
50 Ga0068858_100007168 3300005842 Bacteria 10815
51 Ga0068858_100179561 3300005842 Bacteria 1998
52 Ga0068858_100368775 3300005842 Bacteria 1377
53 Ga0068860_100149752 3300005843 Bacteria 2247
54 Ga0068862_100197281 3300005844 Bacteria 1813
55 Ga0081538_10059789 3300005981 Bacteria 2198
56 Ga0075364_10000669 3300006051 Bacteria 17760
57 Ga0075362_10000002 3300006177 Bacteria 198286
58 Ga0075428_100013098 3300006844 Bacteria 9222
59 Ga0075428_100116852 3300006844 Bacteria 2905
60 Ga0075428_100462463 3300006844 Bacteria 1358
61 Ga0075430_100180510 3300006846 Bacteria 1756
62 Ga0075430_100282192 3300006846 Bacteria 1374
63 Ga0075430_100345047 3300006846 Bacteria 1230
64 Ga0075431_100173303 3300006847 Bacteria 2216
65 Ga0075431_100329313 3300006847 Unclassified 1538
66 Ga0075433_10002597 3300006852 Bacteria 13772
67 Ga0075433_10120698 3300006852 Bacteria 2327
68 Ga0075434_100026096 3300006871 Bacteria 5722
69 Ga0075429_100031789 3300006880 Bacteria 4587
70 Ga0075429_100544995 3300006880 Unclassified 1017
71 Ga0068865_100129216 3300006881 Bacteria 1891
72 Ga0075436_100007545 3300006914 Bacteria 7430
73 Ga0075436_100060715 3300006914 Bacteria 2611
74 Ga0075436_100397361 3300006914 Bacteria 998
75 Ga0097620_100216424 3300006931 Bacteria 2003
76 Ga0075435_100040350 3300007076 Bacteria 3727
77 Ga0075435_100565561 3300007076 Bacteria 985
78 Ga0105240_10001591 3300009093 Bacteria 38580
79 Ga0105240_10047975 3300009093 Bacteria 5401
80 Ga0111539_10033616 3300009094 Bacteria 6226
81 Ga0111539_10137247 3300009094 Bacteria 2864
82 Ga0111539_10177925 3300009094 Bacteria 2485
83 Ga0105247_10049237 3300009101 Bacteria 2591
84 Ga0105247_10071645 3300009101 Bacteria 2168
85 Ga0114129_10007027 3300009147 Bacteria 16028
86 Ga0114129_10039509 3300009147 Bacteria 6653
87 Ga0114129_10161886 3300009147 Bacteria 3056
88 Ga0114129_10742466 3300009147 Bacteria 1257
89 Ga0105248_10371535 3300009177 Bacteria 1610
90 Ga0105248_10492078 3300009177 Bacteria 1382
91 Ga0105237_10005647 3300009545 Bacteria 14085
92 Ga0105237_10207993 3300009545 Bacteria 1957
93 Ga0105238_10025732 3300009551 Bacteria 6000
94 Ga0157374_10019080 3300013296 Bacteria 6068
95 Ga0157374_10255192 3300013296 Bacteria 1726
96 Ga0163162_10033196 3300013306 Bacteria 5128
97 Ga0163162_10607294 3300013306 Bacteria 1220
98 Ga0163162_10647759 3300013306 Bacteria 1180
99 Ga0163162_10991333 3300013306 Bacteria 950
100 Ga0157375_10005915 3300013308 Bacteria 10661
101 Ga0157375_10039742 3300013308 Bacteria 4530
102 Ga0163163_10010864 3300014325 Bacteria 8222
103 Ga0163163_10101265 3300014325 Bacteria 2903
104 Ga0182008_10011761 3300014497 Bacteria 4644
105 Ga0157376_10224262 3300014969 Bacteria 1742
106 Ga0182006_1083159 3300015261 Bacteria 1165
107 Ga0182007_10000186 3300015262 Bacteria 41884
108 Ga0182005_1032752 3300015265 Bacteria 1415
109 Ga0163161_10086068 3300017792 Bacteria 2320
110 Ga0163161_10372371 3300017792 Bacteria 1140
111 Ga0197907_11480131 3300020069 Bacteria 3921
112 Ga0206355_1336761 3300020076 Bacteria 1218
113 Ga0206351_10361201 3300020077 Bacteria 1262
114 Ga0206350_10524937 3300020080 Bacteria 953
115 Ga0206353_10636034 3300020082 Bacteria 1042
116 Ga0154015_1363063 3300020610 Bacteria 926
117 Ga0213876_10000945 3300021384 Bacteria 19137
118 Ga0213875_10008140 3300021388 Bacteria 5384
119 Ga0224712_10002397 3300022467 Bacteria 4617
120 Ga0224572_1035067 3300024225 Bacteria 952
121 Ga0207697_10010348 3300025315 Bacteria 3992
122 Ga0207710_10032131 3300025900 Bacteria 2299
123 Ga0207710_10204817 3300025900 Bacteria 975
124 Ga0207688_10281638 3300025901 Bacteria 1013
125 Ga0207680_10085876 3300025903 Bacteria 1989
126 Ga0207685_10046115 3300025905 Bacteria 1657
127 Ga0207645_10030728 3300025907 Bacteria 3461
128 Ga0207645_10153671 3300025907 Bacteria 1503
129 Ga0207705_10074007 3300025909 Bacteria 2472
130 Ga0207684_10051373 3300025910 Bacteria 3497
131 Ga0207695_10006836 3300025913 Bacteria 14689
132 Ga0207671_10007277 3300025914 Bacteria 9628
133 Ga0207663_10272554 3300025916 Bacteria 1254
134 Ga0207657_10206462 3300025919 Bacteria 1578
135 Ga0207646_10138738 3300025922 Bacteria 2189
136 Ga0207681_10071029 3300025923 Bacteria 2427
137 Ga0207681_10104874 3300025923 Bacteria 2046
138 Ga0207650_10041212 3300025925 Bacteria 3382
139 Ga0207650_10085964 3300025925 Bacteria 2393
140 Ga0207650_10326628 3300025925 Bacteria 1257
141 Ga0207650_10432419 3300025925 Bacteria 1093
142 Ga0207659_10126292 3300025926 Bacteria 1968
143 Ga0207644_10284765 3300025931 Bacteria 1328
144 Ga0207644_10487328 3300025931 Bacteria 1016
145 Ga0207706_10099141 3300025933 Bacteria 2563
146 Ga0207706_10103650 3300025933 Bacteria 2503
147 Ga0207665_10031170 3300025939 Unclassified 3527
148 Ga0207691_10007853 3300025940 Bacteria 10277
149 Ga0207691_10033771 3300025940 Bacteria 4762
150 Ga0207691_10107717 3300025940 Bacteria 2481
151 Ga0207711_10195810 3300025941 Bacteria 1843
152 Ga0207712_10120091 3300025961 Bacteria 1987
153 Ga0207668_10336151 3300025972 Bacteria 1258
154 Ga0207658_10044588 3300025986 Bacteria 3229
155 Ga0207658_10373923 3300025986 Bacteria 1246
156 Ga0207677_10649826 3300026023 Bacteria 931
157 Ga0207703_10044796 3300026035 Bacteria 3557
158 Ga0207703_10549600 3300026035 Bacteria 1089
159 Ga0207703_10672932 3300026035 Bacteria 983
160 Ga0207708_10025409 3300026075 Bacteria 4480
161 Ga0207708_10266537 3300026075 Bacteria 1384
162 Ga0207702_10247145 3300026078 Bacteria 1674
163 Ga0207641_10005443 3300026088 Bacteria 10865
164 Ga0207641_10054168 3300026088 Bacteria 3403
165 Ga0207648_10227333 3300026089 Bacteria 1659
166 Ga0207648_10375974 3300026089 Bacteria 1284
167 Ga0207674_10155757 3300026116 Bacteria 2240
168 Ga0207675_100072550 3300026118 Bacteria 3220
169 Ga0207675_100657486 3300026118 Bacteria 1054
170 Ga0207683_10166321 3300026121 Bacteria 1996
171 Ga0207683_10198090 3300026121 Bacteria 1825
172 Ga0207428_10087762 3300027907 Unclassified 2420
173 Ga0207428_10404831 3300027907 Unclassified 999
174 Ga0268266_10000012 3300028379 Bacteria 734912
175 Ga0268266_10051604 3300028379 Bacteria 3531
176 Ga0268266_10122607 3300028379 Bacteria 2315
177 Ga0268265_10168386 3300028380 Bacteria 1870
178 Ga0265337_1022856 3300028556 Bacteria 1931
179 Ga0265338_10000016 3300028800 Bacteria 347424
180 Ga0265338_10040860 3300028800 Bacteria 4349
181 Ga0265327_10005079 3300031251 Bacteria 11216
182 Ga0316575_10115028 3300031665 Bacteria 1098
183 Ga0316579_10047930 3300031691 Bacteria 1995
184 Ga0316576_10125751 3300031727 Bacteria 1927
185 Ga0316578_10014189 3300031728 Bacteria 4248
186 Ga0316578_10067930 3300031728 Bacteria 2107
187 Ga0316578_10180379 3300031728 Bacteria 1273
188 Ga0316577_10023284 3300031733 Bacteria 3439
189 Ga0316593_10011324 3300032168 Bacteria 2589
190 Ga0373948_0001781 3300034817 Bacteria 3063
191 Ga0373950_0011030 3300034818 Bacteria 1470
192 Ga0373958_0001545 3300034819 Bacteria 3110
193 Ga0373938_0002729 3300034957 Bacteria 2853
194 Ga0373926_0021684 3300035083 Bacteria 2225
195 Ga0373929_0005963 3300035085 Bacteria 2200
196 Ga0373940_0031250 3300035088 Bacteria 1420
197 Ga0373944_0070912 3300035089 Unclassified 1135
198 Ga0373951_0006826 3300035091 Bacteria 2607
199 Ga0373936_0053669 3300035113 Unclassified 1635
200 Ga0373936_0131537 3300035113 Bacteria 1076
201 Ga0373939_0006033 3300035114 Bacteria 2908
202 Ga0373939_0018228 3300035114 Bacteria 1877
203 Ga0373941_0014911 3300035115 Bacteria 2086
204 Ga0373943_0028412 3300035170 Bacteria 2635
205 Ga0373961_0003716 3300035241 Bacteria 3734
206 Ga0373962_0006163 3300035242 Bacteria 2899
207 Ga0316574_0002850 3300035398 Bacteria 8777
208 Ga0316574_0003049 3300035398 Bacteria 8539
209 Ga0316574_0006302 3300035398 Bacteria 6399
210 Ga0373931_0002823 3300035691 Bacteria 7738
211 Ga0373931_0031256 3300035691 Bacteria 2747
212 Ga0373927_0159040 3300035695 Bacteria 1480
213 Ga0373927_0198039 3300035695 Bacteria 1318
214 Ga0373947_0000657 3300035725 Bacteria 20479
215 Ga0373947_0041902 3300035725 Unclassified 2732
216 Ga0316582_0037844 3300036647 Bacteria 2994
217 Ga0316582_0075182 3300036647 Bacteria 2194
218 Ga0316582_0075476 3300036647 Bacteria 2190
219 Ga0316582_0144948 3300036647 Unclassified 1603
220 Ga0316584_0001301 3300036712 Bacteria 14742
221 Ga0316584_0006704 3300036712 Bacteria 7810
222 Ga0316584_0091573 3300036712 Bacteria 2276
223 Ga0373925_0000345 3300037068 Bacteria 48292
224 Ga0436364_0165131 3300037853 Bacteria 1664
225 Ga0400489_61378 3300039093 Bacteria 66826
226 Ga0436365_0589113 3300039437 Bacteria 36773
227 Ga0436365_1231988 3300039437 Bacteria 1807
228 Ga0436365_1925276 3300039437 Bacteria 2478
229 Ga0436361_0747274 3300039447 Bacteria 879
230 Ga0439451_030740 3300042009 Bacteria 1080
231 Ga0439444_0048558 3300042437 Bacteria 856
232 Ga0453684_0005273 3300044712 Bacteria 25836
233 Ga0453684_0423440 3300044712 Bacteria 1487
234 Ga0451576_0012688 3300045051 Bacteria 9461
235 Ga0495592_0101734 3300046454 Bacteria 2047
236 Ga0495651_0071425 3300046462 Bacteria 2639
237 Ga0495653_0079313 3300046463 Bacteria 2432
238 Ga0495580_0052393 3300046472 Bacteria 2882
239 Ga0495639_0092103 3300046475 Bacteria 1423
240 Ga0495639_0181817 3300046475 Unclassified 1024
241 Ga0495662_0005907 3300046476 Bacteria 6122
242 Ga0495662_0139705 3300046476 Bacteria 1192
243 Ga0495664_0090604 3300046477 Bacteria 1838
244 Ga0495594_0020170 3300046499 Bacteria 3550
245 Ga0495594_0073790 3300046499 Bacteria 1900
246 Ga0495608_0042244 3300046511 Bacteria 3049
247 Ga0495628_0099401 3300046516 Bacteria 2247
248 Ga0495628_0218895 3300046516 Bacteria 1430
249 Ga0495630_0048507 3300046517 Bacteria 3178
250 Ga0495630_0303280 3300046517 Bacteria 1221
251 Ga0495640_0095656 3300046533 Bacteria 1955
252 Ga0495621_0003686 3300046539 Bacteria 4239
253 Ga0495621_0069588 3300046539 Bacteria 1294
254 Ga0495645_0001288 3300046543 Bacteria 17094
255 Ga0495645_0024719 3300046543 Bacteria 4359
256 Ga0495633_0149085 3300046558 Unclassified 1081
257 Ga0495667_0040815 3300046559 Bacteria 3079
258 Ga0495667_0072696 3300046559 Bacteria 2241
259 Ga0495656_0045929 3300046615 Bacteria 1846
260 Ga0495656_0054432 3300046615 Bacteria 1722
261 Ga0495635_0035666 3300046663 Bacteria 3448
262 Ga0495635_0166221 3300046663 Bacteria 1501
263 Ga0495659_0014120 3300046664 Bacteria 2611
264 Ga0495657_0121200 3300046675 Bacteria 1647
265 Ga0495599_0147053 3300046678 Bacteria 1461
266 Ga0495599_0153863 3300046678 Bacteria 1423
267 Ga0495623_0024403 3300046679 Bacteria 3896
268 Ga0495623_0217354 3300046679 Bacteria 1091
269 Ga0495646_0027127 3300046680 Bacteria 3594
270 Ga0495658_0099210 3300046683 Bacteria 1736
271 Ga0495624_0018431 3300046690 Bacteria 4669
272 Ga0495670_0198563 3300046691 Archaea 1062
273 Ga0495600_0055364 3300046809 Bacteria 2590
274 Ga0495604_0014332 3300047317 Bacteria 6323
275 Ga0495636_0162885 3300047318 Bacteria 1006
276 Ga0495674_0004215 3300047319 Bacteria 13842
277 Ga0495680_0213660 3300047322 Bacteria 1380
278 Ga0495675_0000425 3300047444 Bacteria 28334
279 Ga0495675_0089318 3300047444 Bacteria 1935
280 Ga0495684_0001608 3300047471 Bacteria 18114
281 Ga0495684_0178697 3300047471 Bacteria 1574
282 Ga0495602_0198564 3300048088 Bacteria 1532
283 Ga0495602_0313493 3300048088 Bacteria 1144
284 Ga0495614_0175444 3300048089 Bacteria 963
285 Ga0495615_0006635 3300048090 Bacteria 2156
286 Ga0496100_0023548 3300048903 Bacteria 3743
287 Ga0496101_0008198 3300048904 Bacteria 6823
288 Ga0496102_0144616 3300048905 Bacteria 2231
289 Ga0496103_0010019 3300048906 Bacteria 5604
290 Ga0496103_0073624 3300048906 Bacteria 2140
291 Ga0496104_0011631 3300048907 Bacteria 7888
292 Ga0496105_0003070 3300048908 Bacteria 12272
293 Ga0496105_0090065 3300048908 Bacteria 2534
294 Ga0496108_0059955 3300048911 Bacteria 3201
295 Ga0496108_0259417 3300048911 Bacteria 1513
296 Ga0496108_0403235 3300048911 Bacteria 1194
297 Ga0496110_0005485 3300048913 Bacteria 9949
298 Ga0496110_0053503 3300048913 Bacteria 3549
299 Ga0496110_0203391 3300048913 Bacteria 1799
300 Ga0496111_0002617 3300048914 Bacteria 10910
301 Ga0496111_0058462 3300048914 Bacteria 2791
302 Ga0496114_0045539 3300048917 Bacteria 3645
303 Ga0496114_0359164 3300048917 Bacteria 1289
304 Ga0496114_0495374 3300048917 Bacteria 1081
305 Ga0501031_0000100 3300049568 Bacteria 45684
306 Ga0501033_0020073 3300049570 Bacteria 5051
307 Ga0501034_0094857 3300049571 Unclassified 2980
308 Ga0501077_0013818 3300049593 Bacteria 5063
309 Ga0501035_0001785 3300049822 Bacteria 21747
310 Ga0501044_0000549 3300049823 Bacteria 45670
311 Ga0501044_0213130 3300049823 Bacteria 1885
312 nmdc:mga03683_4_c1 3300050489 Bacteria 176024
313 nmdc:mga00v17_747_c1 3300050491 Bacteria 17713
314 nmdc:mga07m45_263758_c1 3300050496 Bacteria 1002
315 nmdc:mga05p37_131344_c1 3300050507 Bacteria 3073
316 nmdc:mga05p37_15072_c1 3300050507 Bacteria 9281
317 nmdc:mga05p37_183445_c1 3300050507 Bacteria 2545
318 nmdc:mga05p37_309465_c1 3300050507 Bacteria 1873
319 nmdc:mga05p37_31003_c1 3300050507 Bacteria 6529
320 nmdc:mga09592_41097_c1 3300050508 Bacteria 3887
321 nmdc:mga09592_58225_c1 3300050508 Bacteria 3268
322 nmdc:mga09592_69403_c1 3300050508 Bacteria 2990
323 nmdc:mga09592_728645_c1 3300050508 Bacteria 842
324 nmdc:mga0qj67_199452_c1 3300050509 Bacteria 1626
325 nmdc:mga0qj67_7939_c1 3300050509 Bacteria 7842
326 nmdc:mga06r32_60586_c1 3300050510 Bacteria 3643
327 nmdc:mga06r32_84767_c1 3300050510 Bacteria 3089
328 nmdc:mga06r32_91521_c1 3300050510 Bacteria 2973
329 nmdc:mga08y16_624993_c1 3300050511 Unclassified 1084
330 nmdc:mga08y16_71710_c1 3300050511 Bacteria 3610
331 nmdc:mga0n895_22739_c1 3300050512 Bacteria 5880
332 nmdc:mga0n895_42349_c1 3300050512 Bacteria 4430
333 nmdc:mga0n895_6327_c1 3300050512 Bacteria 10040
334 nmdc:mga0n895_6906_c1 3300050512 Bacteria 9698
335 nmdc:mga0rr50_178_c1 3300050513 Bacteria 34254
336 nmdc:mga0rr50_295013_c1 3300050513 Bacteria 1355
337 nmdc:mga08x19_334_c1 3300050514 Bacteria 33957
338 nmdc:mga08x19_370001_c1 3300050514 Bacteria 1003
339 nmdc:mga08x19_41560_c1 3300050514 Bacteria 2928
340 nmdc:mga0a205_45138_c1 3300050515 Bacteria 4249
341 nmdc:mga0a205_480718_c1 3300050515 Unclassified 1100
342 nmdc:mga0a205_51924_c1 3300050515 Bacteria 3958
343 nmdc:mga0a205_585591_c1 3300050515 Bacteria 969
344 Ga0500595_055424 3300053119 Bacteria 1214
345 Ga0530510_0203446 3300061734 Bacteria 1471
346 Ga0530510_0244393 3300061734 Bacteria 1337
347 Ga0213876_10201730
348 ARCol0yngRDRAFT_1004050
349 Ga0065707_10138158
350 Ga0070658_10038136
351 Ga0070676_10014904
352 Ga0070676_10100732
353 Ga0070670_100032534
354 Ga0070670_100077865
355 Ga0070670_100272014
356 Ga0070666_10016599
357 Ga0070666_10263393
358 Ga0070660_100335695
359 Ga0070691_10020212
360 Ga0070668_100063192
361 Ga0070668_100086972
362 Ga0070668_100304334
363 Ga0070668_100352922
364 Ga0070669_100141114
365 Ga0070675_100007471
366 Ga0070671_100312414
367 Ga0070674_100051418
368 Ga0070674_100405530
369 Ga0070673_100115558
370 Ga0070673_100208092
371 Ga0070673_100460639
372 Ga0070667_100031704
373 Ga0070667_100087802
374 Ga0070700_100001775
375 Ga0070694_100005410
376 Ga0070662_100108324
377 Ga0070706_100009175
378 Ga0070707_100086756
379 Ga0070698_100057749
380 Ga0070698_100071221
381 Ga0070684_100352368
382 Ga0070697_100091762
383 Ga0070672_100008199
384 Ga0070672_100028756
385 Ga0070672_100129425
386 Ga0070695_100002487
387 Ga0070665_100000005
388 Ga0070665_100067810
389 Ga0070664_100272889
390 Ga0068857_100473561
391 Ga0068859_100216413
392 Ga0068866_10280129
393 Ga0068861_100052509
394 Ga0068863_100036463
395 Ga0068863_100062147
396 Ga0068858_100007168
397 Ga0068858_100179561
398 Ga0068858_100368775
399 Ga0068860_100149752
400 Ga0068862_100197281
401 Ga0081538_10059789
402 Ga0075364_10000669
403 Ga0075362_10000002
404 Ga0075428_100013098
405 Ga0075428_100116852
406 Ga0075428_100462463
407 Ga0075430_100180510
408 Ga0075430_100282192
409 Ga0075430_100345047
410 Ga0075431_100173303
411 Ga0075431_100329313
412 Ga0075433_10002597
413 Ga0075433_10120698
414 Ga0075434_100026096
415 Ga0075429_100031789
416 Ga0075429_100544995
417 Ga0068865_100129216
418 Ga0075436_100007545
419 Ga0075436_100060715
420 Ga0075436_100397361
421 Ga0097620_100216424
422 Ga0075435_100040350
423 Ga0075435_100565561
424 Ga0105240_10001591
425 Ga0105240_10047975
426 Ga0111539_10033616
427 Ga0111539_10137247
428 Ga0111539_10177925
429 Ga0105247_10049237
430 Ga0105247_10071645
431 Ga0114129_10007027
432 Ga0114129_10039509
433 Ga0114129_10161886
434 Ga0114129_10742466
435 Ga0105248_10371535
436 Ga0105248_10492078
437 Ga0105237_10005647
438 Ga0105237_10207993
439 Ga0105238_10025732
440 Ga0157374_10019080
441 Ga0157374_10255192
442 Ga0163162_10033196
443 Ga0163162_10607294
444 Ga0163162_10647759
445 Ga0163162_10991333
446 Ga0157375_10005915
447 Ga0157375_10039742
448 Ga0163163_10010864
449 Ga0163163_10101265
450 Ga0182008_10011761
451 Ga0157376_10224262
452 Ga0182006_1083159
453 Ga0182007_10000186
454 Ga0182005_1032752
455 Ga0163161_10086068
456 Ga0163161_10372371
457 Ga0197907_11480131
458 Ga0206355_1336761
459 Ga0206351_10361201
460 Ga0206350_10524937
461 Ga0206353_10636034
462 Ga0154015_1363063
463 Ga0213876_10000945
464 Ga0213875_10008140
465 Ga0224712_10002397
466 Ga0224572_1035067
467 Ga0207697_10010348
468 Ga0207710_10032131
469 Ga0207710_10204817
470 Ga0207688_10281638
471 Ga0207680_10085876
472 Ga0207685_10046115
473 Ga0207645_10030728
474 Ga0207645_10153671
475 Ga0207705_10074007
476 Ga0207684_10051373
477 Ga0207695_10006836
478 Ga0207671_10007277
479 Ga0207663_10272554
480 Ga0207657_10206462
481 Ga0207646_10138738
482 Ga0207681_10071029
483 Ga0207681_10104874
484 Ga0207650_10041212
485 Ga0207650_10085964
486 Ga0207650_10326628
487 Ga0207650_10432419
488 Ga0207659_10126292
489 Ga0207644_10284765
490 Ga0207644_10487328
491 Ga0207706_10099141
492 Ga0207706_10103650
493 Ga0207665_10031170
494 Ga0207691_10007853
495 Ga0207691_10033771
496 Ga0207691_10107717
497 Ga0207711_10195810
498 Ga0207712_10120091
499 Ga0207668_10336151
500 Ga0207658_10044588
501 Ga0207658_10373923
502 Ga0207677_10649826
503 Ga0207703_10044796
504 Ga0207703_10549600
505 Ga0207703_10672932
506 Ga0207708_10025409
507 Ga0207708_10266537
508 Ga0207702_10247145
509 Ga0207641_10005443
510 Ga0207641_10054168
511 Ga0207648_10227333
512 Ga0207648_10375974
513 Ga0207674_10155757
514 Ga0207675_100072550
515 Ga0207675_100657486
516 Ga0207683_10166321
517 Ga0207683_10198090
518 Ga0207428_10087762
519 Ga0207428_10404831
520 Ga0268266_10000012
521 Ga0268266_10051604
522 Ga0268266_10122607
523 Ga0268265_10168386
524 Ga0265337_1022856
525 Ga0265338_10000016
526 Ga0265338_10040860
527 Ga0265327_10005079
528 Ga0316575_10115028
529 Ga0316579_10047930
530 Ga0316576_10125751
531 Ga0316578_10014189
532 Ga0316578_10067930
533 Ga0316578_10180379
534 Ga0316577_10023284
535 Ga0316593_10011324
536 Ga0373948_0001781
537 Ga0373950_0011030
538 Ga0373958_0001545
539 Ga0373938_0002729
540 Ga0373926_0021684
541 Ga0373929_0005963
542 Ga0373940_0031250
543 Ga0373944_0070912
544 Ga0373951_0006826
545 Ga0373936_0053669
546 Ga0373936_0131537
547 Ga0373939_0006033
548 Ga0373939_0018228
549 Ga0373941_0014911
550 Ga0373943_0028412
551 Ga0373961_0003716
552 Ga0373962_0006163
553 Ga0316574_0002850
554 Ga0316574_0003049
555 Ga0316574_0006302
556 Ga0373931_0002823
557 Ga0373931_0031256
558 Ga0373927_0159040
559 Ga0373927_0198039
560 Ga0373947_0000657
561 Ga0373947_0041902
562 Ga0316582_0037844
563 Ga0316582_0075182
564 Ga0316582_0075476
565 Ga0316582_0144948
566 Ga0316584_0001301
567 Ga0316584_0006704
568 Ga0316584_0091573
569 Ga0373925_0000345
570 Ga0436364_0165131
571 Ga0400489_61378
572 Ga0436365_0589113
573 Ga0436365_1231988
574 Ga0436365_1925276
575 Ga0436361_0747274
576 Ga0439451_030740
577 Ga0439444_0048558
578 Ga0453684_0005273
579 Ga0453684_0423440
580 Ga0451576_0012688
581 Ga0495592_0101734
582 Ga0495651_0071425
583 Ga0495653_0079313
584 Ga0495580_0052393
585 Ga0495639_0092103
586 Ga0495639_0181817
587 Ga0495662_0005907
588 Ga0495662_0139705
589 Ga0495664_0090604
590 Ga0495594_0020170
591 Ga0495594_0073790
592 Ga0495608_0042244
593 Ga0495628_0099401
594 Ga0495628_0218895
595 Ga0495630_0048507
596 Ga0495630_0303280
597 Ga0495640_0095656
598 Ga0495621_0003686
599 Ga0495621_0069588
600 Ga0495645_0001288
601 Ga0495645_0024719
602 Ga0495633_0149085
603 Ga0495667_0040815
604 Ga0495667_0072696
605 Ga0495656_0045929
606 Ga0495656_0054432
607 Ga0495635_0035666
608 Ga0495635_0166221
609 Ga0495659_0014120
610 Ga0495657_0121200
611 Ga0495599_0147053
612 Ga0495599_0153863
613 Ga0495623_0024403
614 Ga0495623_0217354
615 Ga0495646_0027127
616 Ga0495658_0099210
617 Ga0495624_0018431
618 Ga0495670_0198563
619 Ga0495600_0055364
620 Ga0495604_0014332
621 Ga0495636_0162885
622 Ga0495674_0004215
623 Ga0495680_0213660
624 Ga0495675_0000425
625 Ga0495675_0089318
626 Ga0495684_0001608
627 Ga0495684_0178697
628 Ga0495602_0198564
629 Ga0495602_0313493
630 Ga0495614_0175444
631 Ga0495615_0006635
632 Ga0496100_0023548
633 Ga0496101_0008198
634 Ga0496102_0144616
635 Ga0496103_0010019
636 Ga0496103_0073624
637 Ga0496104_0011631
638 Ga0496105_0003070
639 Ga0496105_0090065
640 Ga0496108_0059955
641 Ga0496108_0259417
642 Ga0496108_0403235
643 Ga0496110_0005485
644 Ga0496110_0053503
645 Ga0496110_0203391
646 Ga0496111_0002617
647 Ga0496111_0058462
648 Ga0496114_0045539
649 Ga0496114_0359164
650 Ga0496114_0495374
651 Ga0501031_0000100
652 Ga0501033_0020073
653 Ga0501034_0094857
654 Ga0501077_0013818
655 Ga0501035_0001785
656 Ga0501044_0000549
657 Ga0501044_0213130
658 nmdc:mga03683_4_c1
659 nmdc:mga00v17_747_c1
660 nmdc:mga07m45_263758_c1
661 nmdc:mga05p37_131344_c1
662 nmdc:mga05p37_15072_c1
663 nmdc:mga05p37_183445_c1
664 nmdc:mga05p37_309465_c1
665 nmdc:mga05p37_31003_c1
666 nmdc:mga09592_41097_c1
667 nmdc:mga09592_58225_c1
668 nmdc:mga09592_69403_c1
669 nmdc:mga09592_728645_c1
670 nmdc:mga0qj67_199452_c1
671 nmdc:mga0qj67_7939_c1
672 nmdc:mga06r32_60586_c1
673 nmdc:mga06r32_84767_c1
674 nmdc:mga06r32_91521_c1
675 nmdc:mga08y16_624993_c1
676 nmdc:mga08y16_71710_c1
677 nmdc:mga0n895_22739_c1
678 nmdc:mga0n895_42349_c1
679 nmdc:mga0n895_6327_c1
680 nmdc:mga0n895_6906_c1
681 nmdc:mga0rr50_178_c1
682 nmdc:mga0rr50_295013_c1
683 nmdc:mga08x19_334_c1
684 nmdc:mga08x19_370001_c1
685 nmdc:mga08x19_41560_c1
686 nmdc:mga0a205_45138_c1
687 nmdc:mga0a205_480718_c1
688 nmdc:mga0a205_51924_c1
689 nmdc:mga0a205_585591_c1
690 Ga0500595_055424
691 Ga0530510_0203446
692 Ga0530510_0244393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

203

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

249

0.95

PF08659

KR

KR domain

7

186

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jro-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.957 1 243
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9516 6 243
4iin-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with nad+ 0.9508 6 243
3edm-assembly1.cif.gz_C crystal structure of a short chain dehydrogenase from agrobacterium tumefaciens 0.9493 1 243
4iin-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with nad+ 0.9485 6 243
ID Description Score Start End Superfamily
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9516 6 243 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9508 6 243 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9503 3 187 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9446 1 243 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 92 192 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G4ZTI1-F1-model_v4 Glucose 1-dehydrogenase B (EC 1.1.1.47) 0.992 1 162 GO:0047936
AF-C2MN91-F1-model_v4 deleted 0.9863 3 183
AF-A0A6L8JCR3-F1-model_v4 deleted 0.98 1 169
AF-A0A6G4ZTI1-F1-model_v4 Glucose 1-dehydrogenase B (EC 1.1.1.47) 0.9799 1 162 GO:0047936
AF-A0A2V6CTJ2-F1-model_v4 Glucose-1-dehydrogenase (EC 1.1.1.47) 0.975 1 188 GO:0047936

Map