F416566

General Info

Members Datasets Scaffolds Average Seq Length
345 168 690 118

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_127781_c1|nmdc:mga0qj67_127781_c1_428_844
Length 138
Sequence VVPGELSAERKFVCVSPEVTMIKRHPEPLLWLLFSAGGILSGMLMPILILVFGIAIPFGWLAPPSRSDLLQVLANPVIRLALVALCVLSLFHWAHRFRHTLYDGLQIKHLNEVIAIGSYGVALFGSVAAMYLLWQLPS

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.74
Rhizosphere 98.26
Stem 0
Stem Tuber 0
Unclassified 19.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_127781_c1 3300050509 Bacteria 2057
2 Ga0065712_10727021 3300005290 Unclassified 537
3 Ga0065715_10158205 3300005293 Bacteria 1655
4 Ga0065707_10011987 3300005295 Bacteria 1968
5 Ga0065707_10099295 3300005295 Bacteria 3016
6 Ga0065707_10949969 3300005295 Unclassified 552
7 Ga0070676_10058092 3300005328 Bacteria 2291
8 Ga0070676_10180665 3300005328 Bacteria 1371
9 Ga0070690_100016860 3300005330 Bacteria 4385
10 Ga0070677_10679053 3300005333 Unclassified 578
11 Ga0068869_100555501 3300005334 Unclassified 965
12 Ga0070666_10858520 3300005335 Unclassified 670
13 Ga0070680_100797719 3300005336 Bacteria 814
14 Ga0070680_100990532 3300005336 Unclassified 726
15 Ga0068868_100186869 3300005338 Unclassified 1722
16 Ga0070689_100029345 3300005340 Bacteria 4162
17 Ga0070689_100131523 3300005340 Bacteria 2007
18 Ga0070689_100225902 3300005340 Bacteria 1537
19 Ga0070661_100239904 3300005344 Bacteria 1395
20 Ga0070692_10067167 3300005345 Bacteria 1903
21 Ga0070668_100031847 3300005347 Bacteria 4013
22 Ga0070668_100104516 3300005347 Bacteria 2248
23 Ga0070668_100871351 3300005347 Bacteria 803
24 Ga0070669_100003121 3300005353 Bacteria 11922
25 Ga0070669_100093161 3300005353 Bacteria 2262
26 Ga0070669_100123722 3300005353 Bacteria 1977
27 Ga0070669_100334256 3300005353 Bacteria 1226
28 Ga0070675_100000359 3300005354 Bacteria 30845
29 Ga0070675_100008632 3300005354 Bacteria 7913
30 Ga0070675_100494392 3300005354 Unclassified 1102
31 Ga0070674_100022163 3300005356 Bacteria 4093
32 Ga0070674_101335678 3300005356 Unclassified 640
33 Ga0070673_100499517 3300005364 Unclassified 1100
34 Ga0070673_101085632 3300005364 Bacteria 747
35 Ga0070688_100215018 3300005365 Bacteria 1352
36 Ga0070688_100458372 3300005365 Unclassified 954
37 Ga0070659_100096073 3300005366 Bacteria 2380
38 Ga0070667_100329118 3300005367 Bacteria 1380
39 Ga0070701_10051445 3300005438 Bacteria 2137
40 Ga0070701_10120062 3300005438 Bacteria 1480
41 Ga0070705_100017050 3300005440 Bacteria 3783
42 Ga0070705_100099709 3300005440 Unclassified 1831
43 Ga0070705_100595181 3300005440 Bacteria 855
44 Ga0070700_100023961 3300005441 Bacteria 3576
45 Ga0070700_100053721 3300005441 Bacteria 2515
46 Ga0070700_101059474 3300005441 Bacteria 670
47 Ga0070694_100000830 3300005444 Bacteria 17335
48 Ga0070694_100819166 3300005444 Unclassified 764
49 Ga0070708_100019210 3300005445 Bacteria 5738
50 Ga0070708_100056848 3300005445 Bacteria 3481
51 Ga0070708_100151361 3300005445 Bacteria 2158
52 Ga0070708_100159890 3300005445 Bacteria 2099
53 Ga0070708_100269521 3300005445 Bacteria 1601
54 Ga0070708_102137489 3300005445 Unclassified 517
55 Ga0070678_100459520 3300005456 Bacteria 1116
56 Ga0070662_100806991 3300005457 Bacteria 798
57 Ga0068867_100011302 3300005459 Bacteria 6298
58 Ga0070685_10045738 3300005466 Bacteria 2511
59 Ga0070685_10077467 3300005466 Bacteria 1985
60 Ga0070685_10620815 3300005466 Unclassified 780
61 Ga0070706_100138617 3300005467 Bacteria 2270
62 Ga0070707_100002670 3300005468 Bacteria 16959
63 Ga0070707_100017537 3300005468 Bacteria 6733
64 Ga0070707_100047494 3300005468 Bacteria 4110
65 Ga0070707_100128345 3300005468 Bacteria 2465
66 Ga0070707_100720992 3300005468 Bacteria 960
67 Ga0070707_101793074 3300005468 Unclassified 581
68 Ga0070698_100007640 3300005471 Bacteria 11700
69 Ga0070698_100027658 3300005471 Bacteria 5896
70 Ga0070698_100056226 3300005471 Bacteria 3988
71 Ga0070698_100679728 3300005471 Unclassified 971
72 Ga0070699_100000176 3300005518 Bacteria 61756
73 Ga0070699_100007603 3300005518 Bacteria 9421
74 Ga0070699_100127223 3300005518 Bacteria 2244
75 Ga0070699_100134084 3300005518 Bacteria 2184
76 Ga0070699_100217706 3300005518 Bacteria 1701
77 Ga0070699_100348030 3300005518 Bacteria 1334
78 Ga0070699_100549395 3300005518 Unclassified 1051
79 Ga0070699_100951317 3300005518 Bacteria 787
80 Ga0070699_101017544 3300005518 Bacteria 760
81 Ga0070684_102063072 3300005535 Bacteria 538
82 Ga0070697_100145774 3300005536 Bacteria 1993
83 Ga0070697_100179235 3300005536 Bacteria 1796
84 Ga0070697_100209663 3300005536 Unclassified 1658
85 Ga0070672_100158254 3300005543 Bacteria 1877
86 Ga0070672_101476532 3300005543 Unclassified 609
87 Ga0070686_100067204 3300005544 Bacteria 2334
88 Ga0070686_100352301 3300005544 Unclassified 1106
89 Ga0070686_100985851 3300005544 Unclassified 690
90 Ga0070695_100804727 3300005545 Bacteria 753
91 Ga0070696_100008934 3300005546 Bacteria 6704
92 Ga0070696_100089961 3300005546 Bacteria 2183
93 Ga0070696_100189974 3300005546 Bacteria 1528
94 Ga0070704_100018059 3300005549 Bacteria 4500
95 Ga0070704_100032673 3300005549 Bacteria 3513
96 Ga0070704_100051425 3300005549 Bacteria 2902
97 Ga0070664_100017097 3300005564 Bacteria 5952
98 Ga0068857_100072347 3300005577 Bacteria 3072
99 Ga0068857_100149369 3300005577 Bacteria 2116
100 Ga0068857_100761395 3300005577 Unclassified 923
101 Ga0068854_100084491 3300005578 Bacteria 2349
102 Ga0068859_100005674 3300005617 Bacteria 12705
103 Ga0068859_100006934 3300005617 Bacteria 11504
104 Ga0068864_100064424 3300005618 Bacteria 3178
105 Ga0068861_100012485 3300005719 Bacteria 5929
106 Ga0068861_100119657 3300005719 Bacteria 2122
107 Ga0068870_10006514 3300005840 Bacteria 5152
108 Ga0068870_10156664 3300005840 Bacteria 1347
109 Ga0068860_100013045 3300005843 Bacteria 8156
110 Ga0068860_100370779 3300005843 Bacteria 1412
111 Ga0068862_100008127 3300005844 Bacteria 8679
112 Ga0068862_101729712 3300005844 Bacteria 634
113 Ga0081455_10066772 3300005937 Unclassified 3001
114 Ga0081538_10025235 3300005981 Bacteria 4199
115 Ga0075432_10038124 3300006058 Bacteria 1674
116 Ga0070712_101631363 3300006175 Unclassified 564
117 Ga0097621_100541683 3300006237 Bacteria 1058
118 Ga0068871_100827596 3300006358 Bacteria 855
119 Ga0075428_100001464 3300006844 Bacteria 25254
120 Ga0075428_100004044 3300006844 Bacteria 16119
121 Ga0075428_100029571 3300006844 Bacteria 6061
122 Ga0075428_100398618 3300006844 Bacteria 1475
123 Ga0075428_100574271 3300006844 Bacteria 1205
124 Ga0075428_100646001 3300006844 Bacteria 1128
125 Ga0075428_100678168 3300006844 Bacteria 1098
126 Ga0075430_100027885 3300006846 Bacteria 4797
127 Ga0075430_100081703 3300006846 Bacteria 2707
128 Ga0075430_100155653 3300006846 Bacteria 1903
129 Ga0075430_100329342 3300006846 Bacteria 1262
130 Ga0075431_100022587 3300006847 Bacteria 6432
131 Ga0075431_100036806 3300006847 Bacteria 5041
132 Ga0075431_100055676 3300006847 Bacteria 4080
133 Ga0075431_100312713 3300006847 Bacteria 1585
134 Ga0075431_100353849 3300006847 Bacteria 1476
135 Ga0075431_100372495 3300006847 Bacteria 1433
136 Ga0075431_100555742 3300006847 Bacteria 1135
137 Ga0075433_10039083 3300006852 Bacteria 4101
138 Ga0075433_10214526 3300006852 Bacteria 1710
139 Ga0075433_10341135 3300006852 Bacteria 1324
140 Ga0075429_100031310 3300006880 Bacteria 4623
141 Ga0075429_100079930 3300006880 Bacteria 2850
142 Ga0075429_100190183 3300006880 Bacteria 1798
143 Ga0075429_100439653 3300006880 Bacteria 1143
144 Ga0075429_100812114 3300006880 Unclassified 819
145 Ga0075429_101003987 3300006880 Unclassified 730
146 Ga0068865_100741913 3300006881 Bacteria 843
147 Ga0068865_100887375 3300006881 Bacteria 775
148 Ga0097620_100005674 3300006931 Bacteria 12705
149 Ga0097620_100006935 3300006931 Bacteria 11504
150 Ga0075435_100205555 3300007076 Bacteria 1669
151 Ga0099794_10014370 3300007265 Bacteria 3468
152 Ga0111539_10082867 3300009094 Bacteria 3772
153 Ga0111539_10159718 3300009094 Bacteria 2636
154 Ga0111539_10246848 3300009094 Bacteria 2078
155 Ga0111539_11584959 3300009094 Bacteria 759
156 Ga0111539_11619727 3300009094 Bacteria 751
157 Ga0105245_11627104 3300009098 Unclassified 698
158 Ga0114129_10013208 3300009147 Bacteria 11764
159 Ga0114129_10014509 3300009147 Bacteria 11229
160 Ga0114129_10050829 3300009147 Bacteria 5821
161 Ga0114129_10113157 3300009147 Bacteria 3743
162 Ga0114129_10113892 3300009147 Bacteria 3729
163 Ga0114129_10163979 3300009147 Bacteria 3034
164 Ga0114129_10733362 3300009147 Unclassified 1267
165 Ga0114129_11063946 3300009147 Bacteria 1015
166 Ga0105243_10690001 3300009148 Unclassified 994
167 Ga0105242_10788466 3300009176 Bacteria 939
168 Ga0105242_12859764 3300009176 Bacteria 533
169 Ga0105248_11846772 3300009177 Bacteria 686
170 Ga0105249_10006070 3300009553 Bacteria 10469
171 Ga0157378_11085616 3300013297 Bacteria 837
172 Ga0163162_11891293 3300013306 Unclassified 683
173 Ga0157375_10163011 3300013308 Bacteria 2373
174 Ga0157375_10454251 3300013308 Bacteria 1447
175 Ga0163163_10937629 3300014325 Unclassified 929
176 Ga0157380_10014516 3300014326 Bacteria 5764
177 Ga0157380_10029481 3300014326 Bacteria 4194
178 Ga0157380_10552088 3300014326 Unclassified 1130
179 Ga0157380_12214900 3300014326 Bacteria 613
180 Ga0157380_13224306 3300014326 Bacteria 521
181 Ga0157377_10011556 3300014745 Bacteria 4412
182 Ga0157377_10119304 3300014745 Bacteria 1596
183 Ga0157376_10368553 3300014969 Bacteria 1380
184 Ga0157376_10407887 3300014969 Bacteria 1316
185 Ga0163161_11699859 3300017792 Unclassified 559
186 Ga0207697_10148396 3300025315 Unclassified 1019
187 Ga0207682_10200474 3300025893 Bacteria 918
188 Ga0207688_10274885 3300025901 Bacteria 1025
189 Ga0207680_10703871 3300025903 Unclassified 724
190 Ga0207645_10044881 3300025907 Bacteria 2827
191 Ga0207643_10020183 3300025908 Bacteria 3656
192 Ga0207643_10075873 3300025908 Bacteria 1941
193 Ga0207643_10240224 3300025908 Bacteria 1113
194 Ga0207684_10034344 3300025910 Bacteria 4309
195 Ga0207684_10064718 3300025910 Bacteria 3104
196 Ga0207684_10140010 3300025910 Bacteria 2079
197 Ga0207660_10043446 3300025917 Bacteria 3158
198 Ga0207660_11249402 3300025917 Unclassified 604
199 Ga0207646_10000959 3300025922 Bacteria 37166
200 Ga0207646_10096453 3300025922 Bacteria 2649
201 Ga0207681_10009028 3300025923 Bacteria 6092
202 Ga0207681_10040254 3300025923 Bacteria 3109
203 Ga0207681_10226714 3300025923 Bacteria 1448
204 Ga0207681_10431587 3300025923 Bacteria 1069
205 Ga0207659_10001803 3300025926 Bacteria 12669
206 Ga0207659_10006313 3300025926 Bacteria 7253
207 Ga0207659_10239510 3300025926 Bacteria 1467
208 Ga0207706_10037703 3300025933 Bacteria 4291
209 Ga0207706_10999893 3300025933 Bacteria 703
210 Ga0207709_10216572 3300025935 Unclassified 1378
211 Ga0207670_10180329 3300025936 Bacteria 1590
212 Ga0207669_10030579 3300025937 Bacteria 2994
213 Ga0207669_10258794 3300025937 Bacteria 1300
214 Ga0207691_10034893 3300025940 Bacteria 4673
215 Ga0207691_10404229 3300025940 Unclassified 1165
216 Ga0207689_10458263 3300025942 Bacteria 1066
217 Ga0207679_10060472 3300025945 Bacteria 2815
218 Ga0207651_10469770 3300025960 Unclassified 1082
219 Ga0207712_10011075 3300025961 Bacteria 5744
220 Ga0207668_10009567 3300025972 Bacteria 5816
221 Ga0207668_10093650 3300025972 Bacteria 2214
222 Ga0207668_12129553 3300025972 Bacteria 505
223 Ga0207640_10057963 3300025981 Bacteria 2550
224 Ga0207677_10250717 3300026023 Unclassified 1437
225 Ga0207678_11345658 3300026067 Bacteria 632
226 Ga0207708_10089336 3300026075 Bacteria 2374
227 Ga0207708_10173612 3300026075 Bacteria 1708
228 Ga0207708_11000297 3300026075 Bacteria 726
229 Ga0207708_11377996 3300026075 Unclassified 619
230 Ga0207708_11822252 3300026075 Unclassified 534
231 Ga0207648_10008240 3300026089 Bacteria 10118
232 Ga0207676_10027607 3300026095 Bacteria 4230
233 Ga0207676_10321115 3300026095 Bacteria 1421
234 Ga0207674_10023829 3300026116 Bacteria 6550
235 Ga0207674_10266388 3300026116 Bacteria 1661
236 Ga0207675_100154104 3300026118 Bacteria 2189
237 Ga0207675_100641222 3300026118 Unclassified 1068
238 Ga0207683_10043064 3300026121 Bacteria 3944
239 Ga0209588_1093498 3300027671 Bacteria 968
240 Ga0209971_1055200 3300027682 Bacteria 960
241 Ga0209974_10122853 3300027876 Bacteria 921
242 Ga0207428_10000510 3300027907 Bacteria 46433
243 Ga0207428_10144243 3300027907 Bacteria 1816
244 Ga0207428_10250825 3300027907 Unclassified 1320
245 Ga0268265_10000767 3300028380 Bacteria 31011
246 Ga0268265_11330481 3300028380 Unclassified 719
247 Ga0268264_10007456 3300028381 Bacteria 9129
248 Ga0316182_1380122 3300030745 Bacteria 1385
249 Ga0307408_100394294 3300031548 Bacteria 1187
250 Ga0307405_10454115 3300031731 Bacteria 1017
251 Ga0307406_11718244 3300031901 Bacteria 556
252 Ga0307407_10975050 3300031903 Bacteria 654
253 Ga0307416_100132104 3300032002 Bacteria 2250
254 Ga0307416_100295308 3300032002 Bacteria 1607
255 Ga0307416_102184783 3300032002 Bacteria 655
256 Ga0307416_102255691 3300032002 Bacteria 645
257 Ga0307416_102380428 3300032002 Bacteria 629
258 Ga0373944_0029998 3300035089 Unclassified 1629
259 Ga0373951_0186652 3300035091 Unclassified 598
260 Ga0373960_0263318 3300035121 Unclassified 630
261 Ga0373946_0726592 3300035171 Unclassified 520
262 Ga0373961_0056837 3300035241 Bacteria 1176
263 Ga0373931_0216777 3300035691 Unclassified 1151
264 Ga0436361_0917681 3300039447 Bacteria 624
265 Ga0439450_079478 3300042008 Bacteria 814
266 Ga0450896_056439 3300042133 Unclassified 633
267 Ga0439434_0096792 3300042435 Archaea 948
268 Ga0439464_0140916 3300042439 Unclassified 751
269 Ga0451577_0000265 3300042876 Bacteria 103615
270 Ga0451577_0035846 3300042876 Bacteria 4468
271 Ga0451577_2037622 3300042876 Unclassified 501
272 Ga0453683_0003575 3300044673 Bacteria 11423
273 Ga0453683_0136147 3300044673 Bacteria 1549
274 Ga0453683_1027912 3300044673 Unclassified 548
275 Ga0466963_0093110 3300044694 Bacteria 2054
276 Ga0453684_0001198 3300044712 Bacteria 80046
277 Ga0453684_0053830 3300044712 Bacteria 5249
278 Ga0451576_0008841 3300045051 Bacteria 11764
279 Ga0451576_0063913 3300045051 Bacteria 3835
280 Ga0451576_0265773 3300045051 Bacteria 1793
281 Ga0451576_0422564 3300045051 Bacteria 1398
282 Ga0451576_1463941 3300045051 Unclassified 710
283 Ga0466967_0008543 3300045976 Bacteria 7518
284 Ga0495580_0151667 3300046472 Bacteria 1606
285 Ga0495580_0171958 3300046472 Bacteria 1498
286 Ga0495642_0124499 3300046528 Bacteria 1107
287 Ga0495665_0175678 3300046531 Bacteria 1114
288 Ga0495598_0077994 3300046537 Bacteria 1057
289 Ga0495598_0452085 3300046537 Unclassified 509
290 Ga0495621_0031982 3300046539 Bacteria 1808
291 Ga0495633_0020997 3300046558 Bacteria 3273
292 Ga0495659_0028976 3300046664 Bacteria 1919
293 Ga0495659_0071556 3300046664 Bacteria 1300
294 Ga0496101_0039175 3300048904 Bacteria 3369
295 Ga0496102_0040143 3300048905 Bacteria 4232
296 Ga0496103_0108069 3300048906 Bacteria 1765
297 Ga0496106_0103909 3300048909 Bacteria 2206
298 Ga0496106_0208312 3300048909 Bacteria 1557
299 Ga0496106_1118105 3300048909 Bacteria 617
300 Ga0501041_0183676 3300049577 Bacteria 1309
301 Ga0501042_0324687 3300049578 Unclassified 1112
302 Ga0501048_0028059 3300049582 Bacteria 4088
303 Ga0501048_0778389 3300049582 Unclassified 687
304 Ga0501072_0045453 3300049588 Bacteria 3453
305 Ga0501075_0044913 3300049591 Bacteria 3315
306 Ga0501076_0268881 3300049592 Bacteria 1396
307 Ga0501077_0642131 3300049593 Unclassified 682
308 Ga0501081_0176779 3300049743 Unclassified 1543
309 nmdc:mga05p37_11385_c1 3300050507 Bacteria 10586
310 nmdc:mga05p37_119344_c1 3300050507 Bacteria 3240
311 nmdc:mga05p37_1333747_c1 3300050507 Unclassified 728
312 nmdc:mga05p37_1831767_c1 3300050507 Bacteria 584
313 nmdc:mga05p37_2691_c1 3300050507 Bacteria 20669
314 nmdc:mga05p37_32178_c1 3300050507 Bacteria 6413
315 nmdc:mga05p37_3604_c1 3300050507 Bacteria 18090
316 nmdc:mga05p37_78941_c1 3300050507 Bacteria 4053
317 nmdc:mga05p37_97316_c1 3300050507 Bacteria 3625
318 nmdc:mga09592_131906_c1 3300050508 Bacteria 2150
319 nmdc:mga09592_485169_c1 3300050508 Unclassified 1065
320 nmdc:mga09592_51825_c1 3300050508 Bacteria 3462
321 nmdc:mga0qj67_1223768_c1 3300050509 Unclassified 584
322 nmdc:mga0qj67_310418_c1 3300050509 Bacteria 1277
323 nmdc:mga0qj67_40979_c1 3300050509 Bacteria 3641
324 nmdc:mga06r32_120215_c1 3300050510 Bacteria 2591
325 nmdc:mga06r32_124592_c1 3300050510 Bacteria 2544
326 nmdc:mga06r32_29046_c1 3300050510 Bacteria 5178
327 nmdc:mga06r32_65122_c1 3300050510 Bacteria 3515
328 nmdc:mga06r32_672599_c1 3300050510 Unclassified 1002
329 nmdc:mga06r32_970853_c1 3300050510 Bacteria 803
330 nmdc:mga08y16_1197370_c1 3300050511 Bacteria 730
331 nmdc:mga08y16_126828_c1 3300050511 Bacteria 2654
332 nmdc:mga08y16_135338_c1 3300050511 Bacteria 2561
333 nmdc:mga08y16_148424_c1 3300050511 Bacteria 2437
334 nmdc:mga08y16_1900333_c1 3300050511 Bacteria 546
335 nmdc:mga08y16_1990_c1 3300050511 Bacteria 20866
336 nmdc:mga0n895_475329_c1 3300050512 Bacteria 1261
337 nmdc:mga0rr50_80750_c1 3300050513 Bacteria 2508
338 nmdc:mga0a205_1243185_c1 3300050515 Unclassified 592
339 nmdc:mga0a205_14335_c1 3300050515 Bacteria 2165
340 nmdc:mga0a205_17063_c2 3300050515 Bacteria 3208
341 nmdc:mga0a205_248514_c1 3300050515 Bacteria 1659
342 nmdc:mga0a205_647907_c1 3300050515 Bacteria 908
343 Ga0501082_0063091 3300060353 Bacteria 3191
344 Ga0530510_0147648 3300061734 Bacteria 1735
345 Ga0530510_0713605 3300061734 Bacteria 764
346 nmdc:mga0qj67_127781_c1
347 Ga0065712_10727021
348 Ga0065715_10158205
349 Ga0065707_10011987
350 Ga0065707_10099295
351 Ga0065707_10949969
352 Ga0070676_10058092
353 Ga0070676_10180665
354 Ga0070690_100016860
355 Ga0070677_10679053
356 Ga0068869_100555501
357 Ga0070666_10858520
358 Ga0070680_100797719
359 Ga0070680_100990532
360 Ga0068868_100186869
361 Ga0070689_100029345
362 Ga0070689_100131523
363 Ga0070689_100225902
364 Ga0070661_100239904
365 Ga0070692_10067167
366 Ga0070668_100031847
367 Ga0070668_100104516
368 Ga0070668_100871351
369 Ga0070669_100003121
370 Ga0070669_100093161
371 Ga0070669_100123722
372 Ga0070669_100334256
373 Ga0070675_100000359
374 Ga0070675_100008632
375 Ga0070675_100494392
376 Ga0070674_100022163
377 Ga0070674_101335678
378 Ga0070673_100499517
379 Ga0070673_101085632
380 Ga0070688_100215018
381 Ga0070688_100458372
382 Ga0070659_100096073
383 Ga0070667_100329118
384 Ga0070701_10051445
385 Ga0070701_10120062
386 Ga0070705_100017050
387 Ga0070705_100099709
388 Ga0070705_100595181
389 Ga0070700_100023961
390 Ga0070700_100053721
391 Ga0070700_101059474
392 Ga0070694_100000830
393 Ga0070694_100819166
394 Ga0070708_100019210
395 Ga0070708_100056848
396 Ga0070708_100151361
397 Ga0070708_100159890
398 Ga0070708_100269521
399 Ga0070708_102137489
400 Ga0070678_100459520
401 Ga0070662_100806991
402 Ga0068867_100011302
403 Ga0070685_10045738
404 Ga0070685_10077467
405 Ga0070685_10620815
406 Ga0070706_100138617
407 Ga0070707_100002670
408 Ga0070707_100017537
409 Ga0070707_100047494
410 Ga0070707_100128345
411 Ga0070707_100720992
412 Ga0070707_101793074
413 Ga0070698_100007640
414 Ga0070698_100027658
415 Ga0070698_100056226
416 Ga0070698_100679728
417 Ga0070699_100000176
418 Ga0070699_100007603
419 Ga0070699_100127223
420 Ga0070699_100134084
421 Ga0070699_100217706
422 Ga0070699_100348030
423 Ga0070699_100549395
424 Ga0070699_100951317
425 Ga0070699_101017544
426 Ga0070684_102063072
427 Ga0070697_100145774
428 Ga0070697_100179235
429 Ga0070697_100209663
430 Ga0070672_100158254
431 Ga0070672_101476532
432 Ga0070686_100067204
433 Ga0070686_100352301
434 Ga0070686_100985851
435 Ga0070695_100804727
436 Ga0070696_100008934
437 Ga0070696_100089961
438 Ga0070696_100189974
439 Ga0070704_100018059
440 Ga0070704_100032673
441 Ga0070704_100051425
442 Ga0070664_100017097
443 Ga0068857_100072347
444 Ga0068857_100149369
445 Ga0068857_100761395
446 Ga0068854_100084491
447 Ga0068859_100005674
448 Ga0068859_100006934
449 Ga0068864_100064424
450 Ga0068861_100012485
451 Ga0068861_100119657
452 Ga0068870_10006514
453 Ga0068870_10156664
454 Ga0068860_100013045
455 Ga0068860_100370779
456 Ga0068862_100008127
457 Ga0068862_101729712
458 Ga0081455_10066772
459 Ga0081538_10025235
460 Ga0075432_10038124
461 Ga0070712_101631363
462 Ga0097621_100541683
463 Ga0068871_100827596
464 Ga0075428_100001464
465 Ga0075428_100004044
466 Ga0075428_100029571
467 Ga0075428_100398618
468 Ga0075428_100574271
469 Ga0075428_100646001
470 Ga0075428_100678168
471 Ga0075430_100027885
472 Ga0075430_100081703
473 Ga0075430_100155653
474 Ga0075430_100329342
475 Ga0075431_100022587
476 Ga0075431_100036806
477 Ga0075431_100055676
478 Ga0075431_100312713
479 Ga0075431_100353849
480 Ga0075431_100372495
481 Ga0075431_100555742
482 Ga0075433_10039083
483 Ga0075433_10214526
484 Ga0075433_10341135
485 Ga0075429_100031310
486 Ga0075429_100079930
487 Ga0075429_100190183
488 Ga0075429_100439653
489 Ga0075429_100812114
490 Ga0075429_101003987
491 Ga0068865_100741913
492 Ga0068865_100887375
493 Ga0097620_100005674
494 Ga0097620_100006935
495 Ga0075435_100205555
496 Ga0099794_10014370
497 Ga0111539_10082867
498 Ga0111539_10159718
499 Ga0111539_10246848
500 Ga0111539_11584959
501 Ga0111539_11619727
502 Ga0105245_11627104
503 Ga0114129_10013208
504 Ga0114129_10014509
505 Ga0114129_10050829
506 Ga0114129_10113157
507 Ga0114129_10113892
508 Ga0114129_10163979
509 Ga0114129_10733362
510 Ga0114129_11063946
511 Ga0105243_10690001
512 Ga0105242_10788466
513 Ga0105242_12859764
514 Ga0105248_11846772
515 Ga0105249_10006070
516 Ga0157378_11085616
517 Ga0163162_11891293
518 Ga0157375_10163011
519 Ga0157375_10454251
520 Ga0163163_10937629
521 Ga0157380_10014516
522 Ga0157380_10029481
523 Ga0157380_10552088
524 Ga0157380_12214900
525 Ga0157380_13224306
526 Ga0157377_10011556
527 Ga0157377_10119304
528 Ga0157376_10368553
529 Ga0157376_10407887
530 Ga0163161_11699859
531 Ga0207697_10148396
532 Ga0207682_10200474
533 Ga0207688_10274885
534 Ga0207680_10703871
535 Ga0207645_10044881
536 Ga0207643_10020183
537 Ga0207643_10075873
538 Ga0207643_10240224
539 Ga0207684_10034344
540 Ga0207684_10064718
541 Ga0207684_10140010
542 Ga0207660_10043446
543 Ga0207660_11249402
544 Ga0207646_10000959
545 Ga0207646_10096453
546 Ga0207681_10009028
547 Ga0207681_10040254
548 Ga0207681_10226714
549 Ga0207681_10431587
550 Ga0207659_10001803
551 Ga0207659_10006313
552 Ga0207659_10239510
553 Ga0207706_10037703
554 Ga0207706_10999893
555 Ga0207709_10216572
556 Ga0207670_10180329
557 Ga0207669_10030579
558 Ga0207669_10258794
559 Ga0207691_10034893
560 Ga0207691_10404229
561 Ga0207689_10458263
562 Ga0207679_10060472
563 Ga0207651_10469770
564 Ga0207712_10011075
565 Ga0207668_10009567
566 Ga0207668_10093650
567 Ga0207668_12129553
568 Ga0207640_10057963
569 Ga0207677_10250717
570 Ga0207678_11345658
571 Ga0207708_10089336
572 Ga0207708_10173612
573 Ga0207708_11000297
574 Ga0207708_11377996
575 Ga0207708_11822252
576 Ga0207648_10008240
577 Ga0207676_10027607
578 Ga0207676_10321115
579 Ga0207674_10023829
580 Ga0207674_10266388
581 Ga0207675_100154104
582 Ga0207675_100641222
583 Ga0207683_10043064
584 Ga0209588_1093498
585 Ga0209971_1055200
586 Ga0209974_10122853
587 Ga0207428_10000510
588 Ga0207428_10144243
589 Ga0207428_10250825
590 Ga0268265_10000767
591 Ga0268265_11330481
592 Ga0268264_10007456
593 Ga0316182_1380122
594 Ga0307408_100394294
595 Ga0307405_10454115
596 Ga0307406_11718244
597 Ga0307407_10975050
598 Ga0307416_100132104
599 Ga0307416_100295308
600 Ga0307416_102184783
601 Ga0307416_102255691
602 Ga0307416_102380428
603 Ga0373944_0029998
604 Ga0373951_0186652
605 Ga0373960_0263318
606 Ga0373946_0726592
607 Ga0373961_0056837
608 Ga0373931_0216777
609 Ga0436361_0917681
610 Ga0439450_079478
611 Ga0450896_056439
612 Ga0439434_0096792
613 Ga0439464_0140916
614 Ga0451577_0000265
615 Ga0451577_0035846
616 Ga0451577_2037622
617 Ga0453683_0003575
618 Ga0453683_0136147
619 Ga0453683_1027912
620 Ga0466963_0093110
621 Ga0453684_0001198
622 Ga0453684_0053830
623 Ga0451576_0008841
624 Ga0451576_0063913
625 Ga0451576_0265773
626 Ga0451576_0422564
627 Ga0451576_1463941
628 Ga0466967_0008543
629 Ga0495580_0151667
630 Ga0495580_0171958
631 Ga0495642_0124499
632 Ga0495665_0175678
633 Ga0495598_0077994
634 Ga0495598_0452085
635 Ga0495621_0031982
636 Ga0495633_0020997
637 Ga0495659_0028976
638 Ga0495659_0071556
639 Ga0496101_0039175
640 Ga0496102_0040143
641 Ga0496103_0108069
642 Ga0496106_0103909
643 Ga0496106_0208312
644 Ga0496106_1118105
645 Ga0501041_0183676
646 Ga0501042_0324687
647 Ga0501048_0028059
648 Ga0501048_0778389
649 Ga0501072_0045453
650 Ga0501075_0044913
651 Ga0501076_0268881
652 Ga0501077_0642131
653 Ga0501081_0176779
654 nmdc:mga05p37_11385_c1
655 nmdc:mga05p37_119344_c1
656 nmdc:mga05p37_1333747_c1
657 nmdc:mga05p37_1831767_c1
658 nmdc:mga05p37_2691_c1
659 nmdc:mga05p37_32178_c1
660 nmdc:mga05p37_3604_c1
661 nmdc:mga05p37_78941_c1
662 nmdc:mga05p37_97316_c1
663 nmdc:mga09592_131906_c1
664 nmdc:mga09592_485169_c1
665 nmdc:mga09592_51825_c1
666 nmdc:mga0qj67_1223768_c1
667 nmdc:mga0qj67_310418_c1
668 nmdc:mga0qj67_40979_c1
669 nmdc:mga06r32_120215_c1
670 nmdc:mga06r32_124592_c1
671 nmdc:mga06r32_29046_c1
672 nmdc:mga06r32_65122_c1
673 nmdc:mga06r32_672599_c1
674 nmdc:mga06r32_970853_c1
675 nmdc:mga08y16_1197370_c1
676 nmdc:mga08y16_126828_c1
677 nmdc:mga08y16_135338_c1
678 nmdc:mga08y16_148424_c1
679 nmdc:mga08y16_1900333_c1
680 nmdc:mga08y16_1990_c1
681 nmdc:mga0n895_475329_c1
682 nmdc:mga0rr50_80750_c1
683 nmdc:mga0a205_1243185_c1
684 nmdc:mga0a205_14335_c1
685 nmdc:mga0a205_17063_c2
686 nmdc:mga0a205_248514_c1
687 nmdc:mga0a205_647907_c1
688 Ga0501082_0063091
689 Ga0530510_0147648
690 Ga0530510_0713605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02313

Fumarate_red_D

Fumarate reductase subunit D

21

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cir-assembly1.cif.gz_D e. coli quinol fumarate reductase frda t234a mutation 0.859 1 115
3cir-assembly1.cif.gz_D e. coli quinol fumarate reductase frda t234a mutation 0.8322 1 115
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.7568 10 115
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.7452 10 115
2wdq-assembly3.cif.gz_H e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound 0.7348 7 115
ID Description Score Start End Superfamily
af_P9WNB5_8_125_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9527 2 115 1.20.1300.10
af_P9WNB5_8_125_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.9216 2 115 1.20.1300.10
1fumD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8625 1 115 1.20.1300.10
af_P0A8Q3_1_119_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8576 1 115 1.20.1300.10
2b76D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8527 1 115 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A511CXY3-F1-model_v4 Fumarate reductase subunit D 0.978 10 113 GO:0005886
GO:0006106
AF-A0A352VPC8-F1-model_v4 Fumarate reductase subunit D 0.9687 2 117 GO:0005886
GO:0006106
AF-A0A7C2U0F8-F1-model_v4 Fumarate reductase subunit D 0.9686 2 115 GO:0005886
GO:0006106
AF-A0A7W8CN67-F1-model_v4 Fumarate reductase subunit D 0.9644 1 115 GO:0005886
GO:0006106
AF-A0A7I7NIN3-F1-model_v4 Fumarate reductase subunit D 0.9622 11 115 GO:0005886
GO:0006106

Map