F416360

General Info

Members Datasets Scaffolds Average Seq Length
345 188 690 93

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11791830|Ga0105248_117918302
Length 97
Sequence MTWIKTIPMAEADDKLKRACEKQRELYPSEYAESVPAAEIRRDGEMSGVVGAHSLIPDALYHAFATFGVLMSPELPLTRRQHEMITTVVSAVNRCVY

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 2.9
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 9.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_11791830 3300009177 Bacteria 696
2 JGI26145J50221_1005361 3300003371 Bacteria 1053
3 JGI26143J51219_1001953 3300003502 Bacteria 876
4 Ga0058859_10601949 3300004798 Bacteria 504
5 Ga0058863_10528036 3300004799 Bacteria 572
6 Ga0065704_10251193 3300005289 Bacteria 989
7 Ga0065704_10649529 3300005289 Bacteria 583
8 Ga0065715_10397590 3300005293 Unclassified 886
9 Ga0065715_10426918 3300005293 Bacteria 835
10 Ga0065715_10449706 3300005293 Bacteria 827
11 Ga0065715_10516458 3300005293 Bacteria 767
12 Ga0065715_10717228 3300005293 Bacteria 645
13 Ga0065707_10100894 3300005295 Bacteria 2872
14 Ga0065707_10282636 3300005295 Bacteria 1044
15 Ga0065707_10320663 3300005295 Bacteria 964
16 Ga0065707_10625306 3300005295 Bacteria 676
17 Ga0070683_100681722 3300005329 Bacteria 984
18 Ga0070670_101091578 3300005331 Bacteria 727
19 Ga0070670_101504791 3300005331 Bacteria 618
20 Ga0068869_100934885 3300005334 Bacteria 752
21 Ga0068869_101041484 3300005334 Bacteria 714
22 Ga0070689_100715006 3300005340 Bacteria 875
23 Ga0070692_10525868 3300005345 Unclassified 771
24 Ga0070668_101509114 3300005347 Bacteria 614
25 Ga0070669_100782702 3300005353 Bacteria 810
26 Ga0070675_100332536 3300005354 Bacteria 1344
27 Ga0070674_100912514 3300005356 Bacteria 766
28 Ga0070688_100102589 3300005365 Bacteria 1888
29 Ga0070709_10000339 3300005434 Bacteria 29052
30 Ga0070709_10777736 3300005434 Bacteria 750
31 Ga0070709_11166181 3300005434 Bacteria 618
32 Ga0070714_100801763 3300005435 Bacteria 912
33 Ga0070713_100000590 3300005436 Bacteria 23065
34 Ga0070713_100460973 3300005436 Bacteria 1195
35 Ga0070713_100926859 3300005436 Bacteria 838
36 Ga0070713_102350143 3300005436 Bacteria 516
37 Ga0070710_10006114 3300005437 Bacteria 5761
38 Ga0070710_10285056 3300005437 Bacteria 1073
39 Ga0070710_10581776 3300005437 Unclassified 777
40 Ga0070711_100013948 3300005439 Bacteria 5055
41 Ga0070711_100147467 3300005439 Bacteria 1771
42 Ga0070705_100523699 3300005440 Bacteria 904
43 Ga0070705_101576259 3300005440 Unclassified 552
44 Ga0070705_101899160 3300005440 Unclassified 507
45 Ga0070694_100002596 3300005444 Bacteria 10679
46 Ga0070694_100066298 3300005444 Bacteria 2476
47 Ga0070694_100079620 3300005444 Bacteria 2275
48 Ga0070694_101015888 3300005444 Bacteria 689
49 Ga0070708_100023332 3300005445 Bacteria 5261
50 Ga0070708_100089480 3300005445 Bacteria 2801
51 Ga0070708_100127867 3300005445 Bacteria 2350
52 Ga0070708_101367165 3300005445 Bacteria 661
53 Ga0070708_101382143 3300005445 Bacteria 657
54 Ga0070708_101730744 3300005445 Unclassified 581
55 Ga0070708_102112107 3300005445 Unclassified 521
56 Ga0070678_100374880 3300005456 Bacteria 1230
57 Ga0070678_100696262 3300005456 Bacteria 915
58 Ga0070662_100574575 3300005457 Bacteria 946
59 Ga0068867_101090478 3300005459 Bacteria 728
60 Ga0070706_100005640 3300005467 Bacteria 11908
61 Ga0070706_100076014 3300005467 Bacteria 3109
62 Ga0070707_100003169 3300005468 Bacteria 15565
63 Ga0070707_100016265 3300005468 Bacteria 6983
64 Ga0070707_100391834 3300005468 Bacteria 1349
65 Ga0070707_100542683 3300005468 Bacteria 1125
66 Ga0070698_100000589 3300005471 Bacteria 39008
67 Ga0070698_100000808 3300005471 Bacteria 34171
68 Ga0070698_100062637 3300005471 Bacteria 3752
69 Ga0070698_100441755 3300005471 Bacteria 1236
70 Ga0070699_100000115 3300005518 Bacteria 73841
71 Ga0070699_100352527 3300005518 Bacteria 1326
72 Ga0070699_101014261 3300005518 Unclassified 761
73 Ga0070697_100004181 3300005536 Bacteria 11063
74 Ga0070697_100091622 3300005536 Bacteria 2514
75 Ga0070697_100519869 3300005536 Bacteria 1042
76 Ga0070697_100598466 3300005536 Bacteria 969
77 Ga0068853_102295552 3300005539 Bacteria 523
78 Ga0070672_101030393 3300005543 Bacteria 730
79 Ga0070695_100015430 3300005545 Bacteria 4613
80 Ga0070695_100741660 3300005545 Unclassified 783
81 Ga0070695_100929979 3300005545 Bacteria 704
82 Ga0070696_100110766 3300005546 Bacteria 1977
83 Ga0070693_100050642 3300005547 Bacteria 2375
84 Ga0070665_100466392 3300005548 Bacteria 1273
85 Ga0070704_100052165 3300005549 Bacteria 2884
86 Ga0070704_100052517 3300005549 Unclassified 2876
87 Ga0070704_100675991 3300005549 Bacteria 913
88 Ga0068854_100014207 3300005578 Bacteria 5243
89 Ga0068856_101471902 3300005614 Bacteria 695
90 Ga0068859_100602627 3300005617 Unclassified 1191
91 Ga0068859_100893263 3300005617 Bacteria 973
92 Ga0068866_10469976 3300005718 Bacteria 826
93 Ga0068861_100383441 3300005719 Bacteria 1242
94 Ga0068858_100327840 3300005842 Bacteria 1464
95 Ga0068858_100399179 3300005842 Unclassified 1321
96 Ga0068860_100628866 3300005843 Unclassified 1080
97 Ga0068860_101158781 3300005843 Bacteria 793
98 Ga0081539_10257703 3300005985 Bacteria 771
99 Ga0070717_10174531 3300006028 Bacteria 1871
100 Ga0070717_10429576 3300006028 Unclassified 1189
101 Ga0070715_10020593 3300006163 Bacteria 2546
102 Ga0070716_100000010 3300006173 Bacteria 157261
103 Ga0070716_100001215 3300006173 Bacteria 11339
104 Ga0070716_100078288 3300006173 Bacteria 1965
105 Ga0070716_100470248 3300006173 Unclassified 921
106 Ga0070712_100000340 3300006175 Bacteria 26355
107 Ga0070712_100916947 3300006175 Bacteria 756
108 Ga0075362_10500537 3300006177 Bacteria 621
109 Ga0097621_100010854 3300006237 Bacteria 6685
110 Ga0097621_101815918 3300006237 Bacteria 581
111 Ga0068871_100489799 3300006358 Bacteria 1107
112 Ga0075428_100449471 3300006844 Bacteria 1380
113 Ga0075428_100525503 3300006844 Bacteria 1265
114 Ga0075433_10005388 3300006852 Bacteria 10052
115 Ga0075433_10010692 3300006852 Bacteria 7380
116 Ga0075433_10251729 3300006852 Bacteria 1567
117 Ga0075433_10657116 3300006852 Bacteria 919
118 Ga0075433_10758070 3300006852 Unclassified 849
119 Ga0075434_100000144 3300006871 Bacteria 43403
120 Ga0075434_100007262 3300006871 Bacteria 10250
121 Ga0075434_100016548 3300006871 Bacteria 7090
122 Ga0075434_102269536 3300006871 Unclassified 546
123 Ga0075429_101493219 3300006880 Bacteria 588
124 Ga0097620_100602634 3300006931 Unclassified 1191
125 Ga0097620_100893344 3300006931 Bacteria 973
126 Ga0075435_100000208 3300007076 Bacteria 35592
127 Ga0075435_100150852 3300007076 Bacteria 1954
128 Ga0075435_101809248 3300007076 Bacteria 536
129 Ga0075435_101866963 3300007076 Bacteria 527
130 Ga0099794_10002748 3300007265 Bacteria 6571
131 Ga0099794_10005662 3300007265 Bacteria 5032
132 Ga0099794_10019350 3300007265 Bacteria 3066
133 Ga0099794_10024830 3300007265 Bacteria 2755
134 Ga0099794_10039718 3300007265 Bacteria 2235
135 Ga0099794_10117575 3300007265 Unclassified 1335
136 Ga0099795_10156736 3300007788 Unclassified 936
137 Ga0099795_10157487 3300007788 Bacteria 935
138 Ga0111539_10534578 3300009094 Bacteria 1366
139 Ga0111539_10560072 3300009094 Bacteria 1331
140 Ga0114129_10065808 3300009147 Bacteria 5057
141 Ga0114129_10156658 3300009147 Bacteria 3114
142 Ga0114129_10333332 3300009147 Bacteria 2014
143 Ga0114129_10416580 3300009147 Bacteria 1768
144 Ga0114129_10494140 3300009147 Bacteria 1599
145 Ga0114129_10751461 3300009147 Bacteria 1248
146 Ga0114129_10815345 3300009147 Bacteria 1189
147 Ga0114129_12917037 3300009147 Bacteria 565
148 Ga0114129_12972085 3300009147 Bacteria 558
149 Ga0105243_10000349 3300009148 Bacteria 49476
150 Ga0105241_10324711 3300009174 Bacteria 1328
151 Ga0105241_11657584 3300009174 Bacteria 620
152 Ga0105242_10001635 3300009176 Bacteria 17680
153 Ga0105242_11012233 3300009176 Bacteria 839
154 Ga0105242_12401142 3300009176 Bacteria 575
155 Ga0105248_10014647 3300009177 Bacteria 8629
156 Ga0105248_10107608 3300009177 Bacteria 3144
157 Ga0105249_10076691 3300009553 Bacteria 3099
158 Ga0105249_12848208 3300009553 Bacteria 555
159 Ga0099796_10155468 3300010159 Bacteria 903
160 Ga0099796_10162187 3300010159 Bacteria 887
161 Ga0099796_10227087 3300010159 Unclassified 767
162 Ga0099796_10319794 3300010159 Bacteria 662
163 Ga0105246_11115750 3300011119 Bacteria 721
164 Ga0105246_11253422 3300011119 Bacteria 685
165 Ga0157378_10000094 3300013297 Bacteria 84481
166 Ga0157378_10001559 3300013297 Bacteria 20702
167 Ga0157378_10926037 3300013297 Bacteria 903
168 Ga0157378_11663318 3300013297 Bacteria 685
169 Ga0157375_10000943 3300013308 Bacteria 25210
170 Ga0157375_10500561 3300013308 Bacteria 1379
171 Ga0157380_10773980 3300014326 Bacteria 974
172 Ga0157380_12040288 3300014326 Bacteria 636
173 Ga0157377_10304399 3300014745 Bacteria 1053
174 Ga0157379_10006906 3300014968 Bacteria 9817
175 Ga0157379_10136616 3300014968 Bacteria 2209
176 Ga0157376_10000032 3300014969 Bacteria 167294
177 Ga0157376_11478483 3300014969 Unclassified 712
178 Ga0213876_10000076 3300021384 Bacteria 116109
179 Ga0213875_10021193 3300021388 Bacteria 3115
180 Ga0213871_10306125 3300021441 Bacteria 514
181 Ga0224572_1011611 3300024225 Unclassified 1667
182 Ga0207653_10019299 3300025885 Unclassified 2149
183 Ga0207692_10339034 3300025898 Unclassified 924
184 Ga0207692_10341077 3300025898 Bacteria 922
185 Ga0207692_10561785 3300025898 Unclassified 730
186 Ga0207692_10925936 3300025898 Bacteria 574
187 Ga0207642_10278279 3300025899 Bacteria 961
188 Ga0207685_10092188 3300025905 Bacteria 1278
189 Ga0207685_10127375 3300025905 Bacteria 1126
190 Ga0207699_10014376 3300025906 Bacteria 4078
191 Ga0207699_10298542 3300025906 Bacteria 1124
192 Ga0207645_10708630 3300025907 Bacteria 684
193 Ga0207684_10001916 3300025910 Bacteria 21577
194 Ga0207684_10012858 3300025910 Bacteria 7249
195 Ga0207654_10481019 3300025911 Bacteria 874
196 Ga0207693_10000182 3300025915 Bacteria 57166
197 Ga0207693_10027652 3300025915 Bacteria 4483
198 Ga0207663_10062188 3300025916 Bacteria 2372
199 Ga0207663_10403449 3300025916 Bacteria 1046
200 Ga0207657_10601012 3300025919 Bacteria 858
201 Ga0207646_10001452 3300025922 Bacteria 29352
202 Ga0207646_10035522 3300025922 Unclassified 4502
203 Ga0207646_10035628 3300025922 Bacteria 4494
204 Ga0207646_10337074 3300025922 Bacteria 1362
205 Ga0207646_10838838 3300025922 Bacteria 817
206 Ga0207646_11019125 3300025922 Bacteria 731
207 Ga0207681_10756456 3300025923 Bacteria 810
208 Ga0207650_10196631 3300025925 Bacteria 1613
209 Ga0207700_10000217 3300025928 Bacteria 34284
210 Ga0207700_10784944 3300025928 Bacteria 852
211 Ga0207664_10498358 3300025929 Bacteria 1090
212 Ga0207664_10694586 3300025929 Bacteria 915
213 Ga0207706_11439858 3300025933 Bacteria 564
214 Ga0207686_10002127 3300025934 Bacteria 10910
215 Ga0207686_10338340 3300025934 Bacteria 1130
216 Ga0207709_10000896 3300025935 Bacteria 22507
217 Ga0207669_10832460 3300025937 Bacteria 767
218 Ga0207665_10000010 3300025939 Bacteria 157219
219 Ga0207665_10055141 3300025939 Bacteria 2681
220 Ga0207665_10275850 3300025939 Unclassified 1250
221 Ga0207665_11096963 3300025939 Bacteria 634
222 Ga0207691_10994329 3300025940 Bacteria 700
223 Ga0207711_10542379 3300025941 Bacteria 1085
224 Ga0207711_11518612 3300025941 Bacteria 613
225 Ga0207689_10438666 3300025942 Bacteria 1091
226 Ga0207651_10681230 3300025960 Bacteria 904
227 Ga0207712_10649835 3300025961 Bacteria 916
228 Ga0207703_10332726 3300026035 Bacteria 1394
229 Ga0207702_11389728 3300026078 Bacteria 696
230 Ga0207648_10841589 3300026089 Bacteria 855
231 Ga0207676_10550453 3300026095 Unclassified 1102
232 Ga0207674_10364579 3300026116 Bacteria 1397
233 Ga0207675_102383496 3300026118 Bacteria 542
234 Ga0209973_1015523 3300027252 Bacteria 962
235 Ga0209969_1022447 3300027360 Bacteria 944
236 Ga0209967_1002634 3300027364 Bacteria 2335
237 Ga0209981_1010461 3300027378 Bacteria 1272
238 Ga0209996_1029587 3300027395 Bacteria 793
239 Ga0209984_1009060 3300027424 Bacteria 1260
240 Ga0209179_1052853 3300027512 Unclassified 874
241 Ga0209968_1044910 3300027526 Bacteria 760
242 Ga0209999_1007567 3300027543 Bacteria 1955
243 Ga0209970_1003733 3300027614 Bacteria 2547
244 Ga0210002_1012900 3300027617 Bacteria 1301
245 Ga0209983_1006090 3300027665 Bacteria 2485
246 Ga0209588_1002439 3300027671 Bacteria 5040
247 Ga0209588_1005784 3300027671 Bacteria 3559
248 Ga0209588_1005788 3300027671 Bacteria 3558
249 Ga0209588_1009117 3300027671 Bacteria 2958
250 Ga0209588_1012245 3300027671 Bacteria 2600
251 Ga0209588_1029927 3300027671 Bacteria 1738
252 Ga0209971_1000378 3300027682 Bacteria 12213
253 Ga0209998_10004652 3300027717 Bacteria 2906
254 Ga0209974_10003477 3300027876 Bacteria 5678
255 Ga0307511_10110167 3300030521 Bacteria 1756
256 Ga0265762_1075401 3300030760 Bacteria 714
257 Ga0307410_10506707 3300031852 Bacteria 994
258 Ga0373940_0182854 3300035088 Bacteria 682
259 Ga0373923_0538307 3300035111 Bacteria 572
260 Ga0373955_0536850 3300035172 Bacteria 715
261 Ga0373931_0382608 3300035691 Bacteria 887
262 Ga0373935_1205927 3300035692 Bacteria 564
263 Ga0373927_0886875 3300035695 Bacteria 589
264 Ga0373927_1147259 3300035695 Bacteria 513
265 Ga0373937_1281780 3300036401 Bacteria 681
266 Ga0373937_1674037 3300036401 Bacteria 583
267 Ga0395899_0392517 3300037312 Bacteria 920
268 Ga0395900_0329896 3300037418 Bacteria 1504
269 Ga0395900_0596873 3300037418 Bacteria 1045
270 Ga0395900_0878635 3300037418 Bacteria 821
271 Ga0395900_1482900 3300037418 Bacteria 590
272 Ga0395900_1804302 3300037418 Bacteria 522
273 Ga0395898_0053908 3300037466 Bacteria 3926
274 Ga0395898_0747672 3300037466 Bacteria 919
275 Ga0395905_1027805 3300037471 Bacteria 727
276 Ga0436364_0652626 3300037853 Bacteria 850
277 Ga0436364_1291609 3300037853 Bacteria 13114
278 Ga0395901_0674586 3300038443 Bacteria 1034
279 Ga0395901_1841206 3300038443 Bacteria 554
280 Ga0436365_0996848 3300039437 Bacteria 555
281 Ga0436365_1781985 3300039437 Bacteria 2944
282 Ga0436365_1893186 3300039437 Bacteria 48707
283 Ga0436360_0921783 3300039438 Bacteria 648
284 Ga0451839_0884188 3300041496 Unclassified 659
285 Ga0451577_0432466 3300042876 Bacteria 1195
286 Ga0453683_0315182 3300044673 Unclassified 1002
287 Ga0451576_1770755 3300045051 Bacteria 639
288 Ga0451576_1787509 3300045051 Bacteria 636
289 Ga0495606_0155581 3300046507 Bacteria 1338
290 Ga0495632_0055098 3300046519 Bacteria 1947
291 Ga0495663_0008360 3300046525 Bacteria 2866
292 Ga0495621_0499500 3300046539 Bacteria 525
293 Ga0495670_0436091 3300046691 Bacteria 709
294 Ga0495684_0306989 3300047471 Bacteria 1138
295 Ga0496100_1052447 3300048903 Bacteria 641
296 Ga0496101_0927995 3300048904 Bacteria 685
297 Ga0496102_1671377 3300048905 Bacteria 555
298 Ga0496104_0866950 3300048907 Bacteria 808
299 Ga0496105_0216320 3300048908 Bacteria 1561
300 Ga0496106_0007506 3300048909 Bacteria 8061
301 Ga0496106_0096767 3300048909 Bacteria 2285
302 Ga0496108_0626839 3300048911 Bacteria 936
303 Ga0496114_0071545 3300048917 Bacteria 2915
304 Ga0496115_0002840 3300048918 Bacteria 12460
305 Ga0501038_0930565 3300049574 Bacteria 641
306 Ga0501040_0081711 3300049576 Bacteria 2240
307 Ga0501041_0197141 3300049577 Bacteria 1262
308 Ga0501046_0423981 3300049580 Bacteria 959
309 Ga0501071_0921956 3300049587 Bacteria 674
310 Ga0501075_0944295 3300049591 Bacteria 655
311 Ga0501076_0221985 3300049592 Bacteria 1544
312 Ga0501076_0365983 3300049592 Bacteria 1185
313 Ga0501076_0781715 3300049592 Bacteria 788
314 Ga0501077_0383093 3300049593 Bacteria 898
315 Ga0501079_0143254 3300049741 Bacteria 1862
316 Ga0501079_0154981 3300049741 Bacteria 1786
317 Ga0501081_0281144 3300049743 Bacteria 1218
318 Ga0501081_0423593 3300049743 Bacteria 987
319 Ga0501045_0054048 3300049824 Bacteria 2936
320 nmdc:mga05p37_1233481_c1 3300050507 Bacteria 769
321 nmdc:mga05p37_146556_c1 3300050507 Bacteria 2890
322 nmdc:mga05p37_233836_c1 3300050507 Bacteria 2213
323 nmdc:mga05p37_348296_c1 3300050507 Bacteria 1745
324 nmdc:mga05p37_626890_c1 3300050507 Bacteria 1209
325 nmdc:mga09592_1335567_c1 3300050508 Bacteria 588
326 nmdc:mga09592_172888_c1 3300050508 Bacteria 1868
327 nmdc:mga06r32_565150_c1 3300050510 Bacteria 1110
328 nmdc:mga06r32_627177_c1 3300050510 Bacteria 1044
329 nmdc:mga0n895_1008355_c1 3300050512 Bacteria 813
330 nmdc:mga0n895_1134414_c1 3300050512 Bacteria 758
331 nmdc:mga0n895_1495654_c1 3300050512 Bacteria 642
332 nmdc:mga0n895_17331_c1 3300050512 Bacteria 6637
333 nmdc:mga0n895_2134140_c1 3300050512 Bacteria 516
334 nmdc:mga0n895_229735_c1 3300050512 Bacteria 1883
335 nmdc:mga0n895_39551_c1 3300050512 Bacteria 4576
336 nmdc:mga0rr50_158652_c1 3300050513 Bacteria 1834
337 nmdc:mga0rr50_499_c1 3300050513 Bacteria 20926
338 nmdc:mga0a205_2420_c2 3300050515 Bacteria 7420
339 nmdc:mga0a205_260126_c1 3300050515 Unclassified 1613
340 nmdc:mga0a205_265798_c1 3300050515 Bacteria 1593
341 nmdc:mga0a205_7842_c1 3300050515 Bacteria 9699
342 Ga0500627_0110723 3300053158 Bacteria 1236
343 Ga0501084_1009547 3300054114 Bacteria 699
344 Ga0590071_035319 3300059421 Bacteria 1197
345 Ga0530510_0405062 3300061734 Bacteria 1028
346 Ga0105248_11791830
347 JGI26145J50221_1005361
348 JGI26143J51219_1001953
349 Ga0058859_10601949
350 Ga0058863_10528036
351 Ga0065704_10251193
352 Ga0065704_10649529
353 Ga0065715_10397590
354 Ga0065715_10426918
355 Ga0065715_10449706
356 Ga0065715_10516458
357 Ga0065715_10717228
358 Ga0065707_10100894
359 Ga0065707_10282636
360 Ga0065707_10320663
361 Ga0065707_10625306
362 Ga0070683_100681722
363 Ga0070670_101091578
364 Ga0070670_101504791
365 Ga0068869_100934885
366 Ga0068869_101041484
367 Ga0070689_100715006
368 Ga0070692_10525868
369 Ga0070668_101509114
370 Ga0070669_100782702
371 Ga0070675_100332536
372 Ga0070674_100912514
373 Ga0070688_100102589
374 Ga0070709_10000339
375 Ga0070709_10777736
376 Ga0070709_11166181
377 Ga0070714_100801763
378 Ga0070713_100000590
379 Ga0070713_100460973
380 Ga0070713_100926859
381 Ga0070713_102350143
382 Ga0070710_10006114
383 Ga0070710_10285056
384 Ga0070710_10581776
385 Ga0070711_100013948
386 Ga0070711_100147467
387 Ga0070705_100523699
388 Ga0070705_101576259
389 Ga0070705_101899160
390 Ga0070694_100002596
391 Ga0070694_100066298
392 Ga0070694_100079620
393 Ga0070694_101015888
394 Ga0070708_100023332
395 Ga0070708_100089480
396 Ga0070708_100127867
397 Ga0070708_101367165
398 Ga0070708_101382143
399 Ga0070708_101730744
400 Ga0070708_102112107
401 Ga0070678_100374880
402 Ga0070678_100696262
403 Ga0070662_100574575
404 Ga0068867_101090478
405 Ga0070706_100005640
406 Ga0070706_100076014
407 Ga0070707_100003169
408 Ga0070707_100016265
409 Ga0070707_100391834
410 Ga0070707_100542683
411 Ga0070698_100000589
412 Ga0070698_100000808
413 Ga0070698_100062637
414 Ga0070698_100441755
415 Ga0070699_100000115
416 Ga0070699_100352527
417 Ga0070699_101014261
418 Ga0070697_100004181
419 Ga0070697_100091622
420 Ga0070697_100519869
421 Ga0070697_100598466
422 Ga0068853_102295552
423 Ga0070672_101030393
424 Ga0070695_100015430
425 Ga0070695_100741660
426 Ga0070695_100929979
427 Ga0070696_100110766
428 Ga0070693_100050642
429 Ga0070665_100466392
430 Ga0070704_100052165
431 Ga0070704_100052517
432 Ga0070704_100675991
433 Ga0068854_100014207
434 Ga0068856_101471902
435 Ga0068859_100602627
436 Ga0068859_100893263
437 Ga0068866_10469976
438 Ga0068861_100383441
439 Ga0068858_100327840
440 Ga0068858_100399179
441 Ga0068860_100628866
442 Ga0068860_101158781
443 Ga0081539_10257703
444 Ga0070717_10174531
445 Ga0070717_10429576
446 Ga0070715_10020593
447 Ga0070716_100000010
448 Ga0070716_100001215
449 Ga0070716_100078288
450 Ga0070716_100470248
451 Ga0070712_100000340
452 Ga0070712_100916947
453 Ga0075362_10500537
454 Ga0097621_100010854
455 Ga0097621_101815918
456 Ga0068871_100489799
457 Ga0075428_100449471
458 Ga0075428_100525503
459 Ga0075433_10005388
460 Ga0075433_10010692
461 Ga0075433_10251729
462 Ga0075433_10657116
463 Ga0075433_10758070
464 Ga0075434_100000144
465 Ga0075434_100007262
466 Ga0075434_100016548
467 Ga0075434_102269536
468 Ga0075429_101493219
469 Ga0097620_100602634
470 Ga0097620_100893344
471 Ga0075435_100000208
472 Ga0075435_100150852
473 Ga0075435_101809248
474 Ga0075435_101866963
475 Ga0099794_10002748
476 Ga0099794_10005662
477 Ga0099794_10019350
478 Ga0099794_10024830
479 Ga0099794_10039718
480 Ga0099794_10117575
481 Ga0099795_10156736
482 Ga0099795_10157487
483 Ga0111539_10534578
484 Ga0111539_10560072
485 Ga0114129_10065808
486 Ga0114129_10156658
487 Ga0114129_10333332
488 Ga0114129_10416580
489 Ga0114129_10494140
490 Ga0114129_10751461
491 Ga0114129_10815345
492 Ga0114129_12917037
493 Ga0114129_12972085
494 Ga0105243_10000349
495 Ga0105241_10324711
496 Ga0105241_11657584
497 Ga0105242_10001635
498 Ga0105242_11012233
499 Ga0105242_12401142
500 Ga0105248_10014647
501 Ga0105248_10107608
502 Ga0105249_10076691
503 Ga0105249_12848208
504 Ga0099796_10155468
505 Ga0099796_10162187
506 Ga0099796_10227087
507 Ga0099796_10319794
508 Ga0105246_11115750
509 Ga0105246_11253422
510 Ga0157378_10000094
511 Ga0157378_10001559
512 Ga0157378_10926037
513 Ga0157378_11663318
514 Ga0157375_10000943
515 Ga0157375_10500561
516 Ga0157380_10773980
517 Ga0157380_12040288
518 Ga0157377_10304399
519 Ga0157379_10006906
520 Ga0157379_10136616
521 Ga0157376_10000032
522 Ga0157376_11478483
523 Ga0213876_10000076
524 Ga0213875_10021193
525 Ga0213871_10306125
526 Ga0224572_1011611
527 Ga0207653_10019299
528 Ga0207692_10339034
529 Ga0207692_10341077
530 Ga0207692_10561785
531 Ga0207692_10925936
532 Ga0207642_10278279
533 Ga0207685_10092188
534 Ga0207685_10127375
535 Ga0207699_10014376
536 Ga0207699_10298542
537 Ga0207645_10708630
538 Ga0207684_10001916
539 Ga0207684_10012858
540 Ga0207654_10481019
541 Ga0207693_10000182
542 Ga0207693_10027652
543 Ga0207663_10062188
544 Ga0207663_10403449
545 Ga0207657_10601012
546 Ga0207646_10001452
547 Ga0207646_10035522
548 Ga0207646_10035628
549 Ga0207646_10337074
550 Ga0207646_10838838
551 Ga0207646_11019125
552 Ga0207681_10756456
553 Ga0207650_10196631
554 Ga0207700_10000217
555 Ga0207700_10784944
556 Ga0207664_10498358
557 Ga0207664_10694586
558 Ga0207706_11439858
559 Ga0207686_10002127
560 Ga0207686_10338340
561 Ga0207709_10000896
562 Ga0207669_10832460
563 Ga0207665_10000010
564 Ga0207665_10055141
565 Ga0207665_10275850
566 Ga0207665_11096963
567 Ga0207691_10994329
568 Ga0207711_10542379
569 Ga0207711_11518612
570 Ga0207689_10438666
571 Ga0207651_10681230
572 Ga0207712_10649835
573 Ga0207703_10332726
574 Ga0207702_11389728
575 Ga0207648_10841589
576 Ga0207676_10550453
577 Ga0207674_10364579
578 Ga0207675_102383496
579 Ga0209973_1015523
580 Ga0209969_1022447
581 Ga0209967_1002634
582 Ga0209981_1010461
583 Ga0209996_1029587
584 Ga0209984_1009060
585 Ga0209179_1052853
586 Ga0209968_1044910
587 Ga0209999_1007567
588 Ga0209970_1003733
589 Ga0210002_1012900
590 Ga0209983_1006090
591 Ga0209588_1002439
592 Ga0209588_1005784
593 Ga0209588_1005788
594 Ga0209588_1009117
595 Ga0209588_1012245
596 Ga0209588_1029927
597 Ga0209971_1000378
598 Ga0209998_10004652
599 Ga0209974_10003477
600 Ga0307511_10110167
601 Ga0265762_1075401
602 Ga0307410_10506707
603 Ga0373940_0182854
604 Ga0373923_0538307
605 Ga0373955_0536850
606 Ga0373931_0382608
607 Ga0373935_1205927
608 Ga0373927_0886875
609 Ga0373927_1147259
610 Ga0373937_1281780
611 Ga0373937_1674037
612 Ga0395899_0392517
613 Ga0395900_0329896
614 Ga0395900_0596873
615 Ga0395900_0878635
616 Ga0395900_1482900
617 Ga0395900_1804302
618 Ga0395898_0053908
619 Ga0395898_0747672
620 Ga0395905_1027805
621 Ga0436364_0652626
622 Ga0436364_1291609
623 Ga0395901_0674586
624 Ga0395901_1841206
625 Ga0436365_0996848
626 Ga0436365_1781985
627 Ga0436365_1893186
628 Ga0436360_0921783
629 Ga0451839_0884188
630 Ga0451577_0432466
631 Ga0453683_0315182
632 Ga0451576_1770755
633 Ga0451576_1787509
634 Ga0495606_0155581
635 Ga0495632_0055098
636 Ga0495663_0008360
637 Ga0495621_0499500
638 Ga0495670_0436091
639 Ga0495684_0306989
640 Ga0496100_1052447
641 Ga0496101_0927995
642 Ga0496102_1671377
643 Ga0496104_0866950
644 Ga0496105_0216320
645 Ga0496106_0007506
646 Ga0496106_0096767
647 Ga0496108_0626839
648 Ga0496114_0071545
649 Ga0496115_0002840
650 Ga0501038_0930565
651 Ga0501040_0081711
652 Ga0501041_0197141
653 Ga0501046_0423981
654 Ga0501071_0921956
655 Ga0501075_0944295
656 Ga0501076_0221985
657 Ga0501076_0365983
658 Ga0501076_0781715
659 Ga0501077_0383093
660 Ga0501079_0143254
661 Ga0501079_0154981
662 Ga0501081_0281144
663 Ga0501081_0423593
664 Ga0501045_0054048
665 nmdc:mga05p37_1233481_c1
666 nmdc:mga05p37_146556_c1
667 nmdc:mga05p37_233836_c1
668 nmdc:mga05p37_348296_c1
669 nmdc:mga05p37_626890_c1
670 nmdc:mga09592_1335567_c1
671 nmdc:mga09592_172888_c1
672 nmdc:mga06r32_565150_c1
673 nmdc:mga06r32_627177_c1
674 nmdc:mga0n895_1008355_c1
675 nmdc:mga0n895_1134414_c1
676 nmdc:mga0n895_1495654_c1
677 nmdc:mga0n895_17331_c1
678 nmdc:mga0n895_2134140_c1
679 nmdc:mga0n895_229735_c1
680 nmdc:mga0n895_39551_c1
681 nmdc:mga0rr50_158652_c1
682 nmdc:mga0rr50_499_c1
683 nmdc:mga0a205_2420_c2
684 nmdc:mga0a205_260126_c1
685 nmdc:mga0a205_265798_c1
686 nmdc:mga0a205_7842_c1
687 Ga0500627_0110723
688 Ga0501084_1009547
689 Ga0590071_035319
690 Ga0530510_0405062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map