F415887

General Info

Members Datasets Scaffolds Average Seq Length
344 199 342 115

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100728787|Ga0068854_1007287871
Length 113
Sequence MDKNRVYKLVLSVSMLYIKKAEAKAHKGRGDAVIFWLTAYTKQTLQKQIDKKNDFETFFAEASALKNASKITGVICGYRVEEIEDKLIQKMRYLDKLIDELAKGKTMEKILRK

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
4 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
146 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
188 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
189 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
190 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 2.03
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 2.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02F9HHG 2088090002 Bacteria 552
2 MBSR1b_contig_1075097 2162886012 Bacteria 915
3 MBSR1b_contig_7998474 2162886012 Bacteria 919
4 ARcpr5yngRDRAFT_c019793 3300000043 Bacteria 569
5 Ga0065704_10788038 3300005289 Bacteria 529
6 Ga0065715_10113183 3300005293 Bacteria 2470
7 Ga0065707_10374370 3300005295 Bacteria 886
8 Ga0070676_10211412 3300005328 Bacteria 1277
9 Ga0070683_100019931 3300005329 Bacteria 5961
10 Ga0070683_100025408 3300005329 Bacteria 5319
11 Ga0070683_100316460 3300005329 Bacteria 1485
12 Ga0070690_100010953 3300005330 Bacteria 5293
13 Ga0070690_100110234 3300005330 Bacteria 1835
14 Ga0070670_100264880 3300005331 Bacteria 1499
15 Ga0070677_10396113 3300005333 Bacteria 726
16 Ga0068869_100071758 3300005334 Bacteria 2565
17 Ga0070666_10338251 3300005335 Bacteria 1075
18 Ga0070666_11428358 3300005335 Bacteria 517
19 Ga0070680_101195060 3300005336 Bacteria 658
20 Ga0070682_101966377 3300005337 Bacteria 513
21 Ga0068868_100178281 3300005338 Bacteria 1762
22 Ga0068868_100687992 3300005338 Bacteria 914
23 Ga0068868_100688165 3300005338 Bacteria 914
24 Ga0070689_100108498 3300005340 Bacteria 2205
25 Ga0070691_10229524 3300005341 Bacteria 987
26 Ga0070661_100059623 3300005344 Bacteria 2799
27 Ga0070661_100305008 3300005344 Bacteria 1240
28 Ga0070661_100513592 3300005344 Bacteria 960
29 Ga0070661_100645273 3300005344 Bacteria 859
30 Ga0070669_100612143 3300005353 Unclassified 913
31 Ga0070675_101658059 3300005354 Bacteria 590
32 Ga0070671_100114091 3300005355 Bacteria 2271
33 Ga0070671_100121320 3300005355 Bacteria 2200
34 Ga0070671_100321101 3300005355 Bacteria 1319
35 Ga0070673_100177067 3300005364 Bacteria 1823
36 Ga0070673_101173686 3300005364 Bacteria 719
37 Ga0070688_100038825 3300005365 Bacteria 2910
38 Ga0070688_100053806 3300005365 Bacteria 2519
39 Ga0070688_101166448 3300005365 Bacteria 618
40 Ga0070659_101650236 3300005366 Bacteria 573
41 Ga0070667_100024990 3300005367 Bacteria 4963
42 Ga0070667_100025140 3300005367 Bacteria 4950
43 Ga0070667_100610074 3300005367 Bacteria 1006
44 Ga0070694_100063322 3300005444 Bacteria 2529
45 Ga0070678_100147696 3300005456 Bacteria 1890
46 Ga0070678_100612970 3300005456 Bacteria 973
47 Ga0070662_100013645 3300005457 Bacteria 5409
48 Ga0070662_100036931 3300005457 Bacteria 3461
49 Ga0070662_100066832 3300005457 Bacteria 2639
50 Ga0070662_100193853 3300005457 Bacteria 1609
51 Ga0068867_100141121 3300005459 Bacteria 1883
52 Ga0068867_101304879 3300005459 Bacteria 670
53 Ga0070685_10146250 3300005466 Bacteria 1493
54 Ga0070698_100001350 3300005471 Bacteria 27279
55 Ga0070698_100701897 3300005471 Bacteria 954
56 Ga0070679_100049752 3300005530 Bacteria 4174
57 Ga0070679_101018766 3300005530 Unclassified 772
58 Ga0070684_100002578 3300005535 Bacteria 13385
59 Ga0070684_100011405 3300005535 Bacteria 7081
60 Ga0068853_100273407 3300005539 Bacteria 1556
61 Ga0070672_101301972 3300005543 Bacteria 649
62 Ga0070686_100066998 3300005544 Bacteria 2337
63 Ga0070686_100349874 3300005544 Bacteria 1110
64 Ga0070704_101211628 3300005549 Bacteria 689
65 Ga0070704_101635779 3300005549 Bacteria 594
66 Ga0070664_100013210 3300005564 Bacteria 6724
67 Ga0070664_100487557 3300005564 Unclassified 1135
68 Ga0068857_100118633 3300005577 Bacteria 2381
69 Ga0068854_100079929 3300005578 Bacteria 2412
70 Ga0068854_100362708 3300005578 Bacteria 1189
71 Ga0068854_100728787 3300005578 Bacteria 858
72 Ga0068854_100899964 3300005578 Bacteria 778
73 Ga0068856_100510742 3300005614 Bacteria 1223
74 Ga0068852_100130923 3300005616 Bacteria 2310
75 Ga0068852_100956441 3300005616 Bacteria 875
76 Ga0068859_100015933 3300005617 Bacteria 7556
77 Ga0068859_100030014 3300005617 Bacteria 5454
78 Ga0068864_100004652 3300005618 Bacteria 11255
79 Ga0068866_10218786 3300005718 Bacteria 1148
80 Ga0068866_10854476 3300005718 Bacteria 637
81 Ga0068861_101915529 3300005719 Bacteria 590
82 Ga0068851_10689197 3300005834 Bacteria 628
83 Ga0068870_10086915 3300005840 Bacteria 1740
84 Ga0068870_10762967 3300005840 Bacteria 673
85 Ga0068858_100216664 3300005842 Bacteria 1812
86 Ga0068860_100068747 3300005843 Bacteria 3366
87 Ga0075363_100257576 3300006048 Bacteria 1006
88 Ga0070715_10198047 3300006163 Bacteria 1018
89 Ga0070716_101743866 3300006173 Bacteria 514
90 Ga0075366_10016009 3300006195 Bacteria 4306
91 Ga0097621_100824614 3300006237 Bacteria 860
92 Ga0097621_102331516 3300006237 Bacteria 512
93 Ga0068871_100177442 3300006358 Bacteria 1829
94 Ga0068871_100704053 3300006358 Bacteria 925
95 Ga0075428_100413870 3300006844 Bacteria 1444
96 Ga0075428_101541757 3300006844 Bacteria 695
97 Ga0075431_101207287 3300006847 Bacteria 719
98 Ga0075434_100573382 3300006871 Bacteria 1148
99 Ga0068865_100056224 3300006881 Bacteria 2740
100 Ga0068865_100228162 3300006881 Bacteria 1459
101 Ga0068865_100338146 3300006881 Bacteria 1216
102 Ga0068865_100911396 3300006881 Bacteria 765
103 Ga0068865_101248821 3300006881 Bacteria 659
104 Ga0097620_100015932 3300006931 Bacteria 7556
105 Ga0097620_100030013 3300006931 Bacteria 5454
106 Ga0105251_10138958 3300009011 Bacteria 1099
107 Ga0105240_10030722 3300009093 Bacteria 6977
108 Ga0105240_10259261 3300009093 Bacteria 2006
109 Ga0111539_10065720 3300009094 Bacteria 4285
110 Ga0111539_10224520 3300009094 Bacteria 2188
111 Ga0105247_11189717 3300009101 Bacteria 606
112 Ga0105247_11213561 3300009101 Bacteria 601
113 Ga0114129_10836246 3300009147 Bacteria 1172
114 Ga0105241_10394677 3300009174 Bacteria 1212
115 Ga0105242_10208843 3300009176 Bacteria 1739
116 Ga0105242_10702579 3300009176 Bacteria 989
117 Ga0105242_10732607 3300009176 Bacteria 971
118 Ga0105242_10967110 3300009176 Bacteria 857
119 Ga0105248_10296464 3300009177 Bacteria 1821
120 Ga0105248_10512674 3300009177 Bacteria 1352
121 Ga0105248_11699623 3300009177 Bacteria 715
122 Ga0105237_10488050 3300009545 Bacteria 1238
123 Ga0105249_10007861 3300009553 Bacteria 9289
124 Ga0105249_10019239 3300009553 Bacteria 6089
125 Ga0105249_10593724 3300009553 Unclassified 1161
126 Ga0105239_13451790 3300010375 Bacteria 514
127 Ga0105246_10214504 3300011119 Bacteria 1504
128 Ga0105246_10911173 3300011119 Unclassified 789
129 Ga0157373_10137079 3300013100 Bacteria 1721
130 Ga0157373_10243988 3300013100 Bacteria 1270
131 Ga0157373_10316617 3300013100 Unclassified 1109
132 Ga0157373_10430999 3300013100 Bacteria 947
133 Ga0157371_10170781 3300013102 Bacteria 1554
134 Ga0157370_10133997 3300013104 Bacteria 2310
135 Ga0157374_10038106 3300013296 Bacteria 4418
136 Ga0157374_10085956 3300013296 Bacteria 2992
137 Ga0157374_10424573 3300013296 Bacteria 1328
138 Ga0157378_10006950 3300013297 Bacteria 9872
139 Ga0157378_10043049 3300013297 Bacteria 4009
140 Ga0157378_10373963 3300013297 Bacteria 1397
141 Ga0157378_11634635 3300013297 Unclassified 690
142 Ga0157378_12417496 3300013297 Bacteria 577
143 Ga0157378_12570818 3300013297 Bacteria 561
144 Ga0163162_10003528 3300013306 Bacteria 14966
145 Ga0163162_10023563 3300013306 Bacteria 6076
146 Ga0163162_10044216 3300013306 Bacteria 4460
147 Ga0163162_10524571 3300013306 Bacteria 1314
148 Ga0163162_10783019 3300013306 Bacteria 1072
149 Ga0157372_10008763 3300013307 Bacteria 10742
150 Ga0157372_12366523 3300013307 Bacteria 610
151 Ga0157372_12394016 3300013307 Bacteria 606
152 Ga0157375_10004375 3300013308 Bacteria 12267
153 Ga0157375_10275780 3300013308 Bacteria 1844
154 Ga0157375_11045942 3300013308 Bacteria 954
155 Ga0157375_11299641 3300013308 Bacteria 855
156 Ga0157375_11417807 3300013308 Bacteria 818
157 Ga0157375_11943727 3300013308 Bacteria 699
158 Ga0163163_10001667 3300014325 Bacteria 18724
159 Ga0163163_10350675 3300014325 Bacteria 1532
160 Ga0163163_10391041 3300014325 Bacteria 1449
161 Ga0157380_10219841 3300014326 Bacteria 1699
162 Ga0157380_10246102 3300014326 Bacteria 1615
163 Ga0157380_10667533 3300014326 Bacteria 1039
164 Ga0157380_11218412 3300014326 Bacteria 797
165 Ga0157380_11763600 3300014326 Bacteria 678
166 Ga0157380_13191185 3300014326 Bacteria 523
167 Ga0157377_10043406 3300014745 Bacteria 2502
168 Ga0157377_10332731 3300014745 Bacteria 1013
169 Ga0157379_10033556 3300014968 Bacteria 4576
170 Ga0157379_10247077 3300014968 Bacteria 1619
171 Ga0157379_10493506 3300014968 Bacteria 1134
172 Ga0157379_10762232 3300014968 Bacteria 912
173 Ga0157379_12323745 3300014968 Bacteria 534
174 Ga0157376_10841078 3300014969 Bacteria 933
175 Ga0163161_10004747 3300017792 Bacteria 9452
176 Ga0163161_10015095 3300017792 Bacteria 5385
177 Ga0163161_10093001 3300017792 Bacteria 2234
178 Ga0163161_10512642 3300017792 Bacteria 978
179 Ga0163161_10559703 3300017792 Bacteria 938
180 Ga0213876_10008161 3300021384 Bacteria 5673
181 Ga0207656_10327328 3300025321 Bacteria 762
182 Ga0207656_10718718 3300025321 Bacteria 512
183 Ga0207642_10287904 3300025899 Bacteria 947
184 Ga0207680_10664622 3300025903 Bacteria 746
185 Ga0207680_10882521 3300025903 Bacteria 641
186 Ga0207647_10021287 3300025904 Bacteria 4331
187 Ga0207685_10165951 3300025905 Bacteria 1012
188 Ga0207645_10144936 3300025907 Bacteria 1548
189 Ga0207645_10483740 3300025907 Bacteria 837
190 Ga0207660_10572867 3300025917 Bacteria 919
191 Ga0207662_10010072 3300025918 Bacteria 5211
192 Ga0207662_10746601 3300025918 Bacteria 688
193 Ga0207649_10065968 3300025920 Bacteria 2293
194 Ga0207649_11289543 3300025920 Bacteria 578
195 Ga0207652_10051087 3300025921 Bacteria 3544
196 Ga0207650_10174563 3300025925 Bacteria 1710
197 Ga0207650_10473598 3300025925 Bacteria 1044
198 Ga0207659_10839441 3300025926 Bacteria 790
199 Ga0207690_10078240 3300025932 Bacteria 2301
200 Ga0207706_10019501 3300025933 Bacteria 6102
201 Ga0207706_10028280 3300025933 Bacteria 5007
202 Ga0207706_10214075 3300025933 Bacteria 1688
203 Ga0207706_10825186 3300025933 Bacteria 786
204 Ga0207686_10236139 3300025934 Bacteria 1328
205 Ga0207686_10300001 3300025934 Bacteria 1193
206 Ga0207686_10357870 3300025934 Bacteria 1101
207 Ga0207704_10507597 3300025938 Bacteria 973
208 Ga0207704_10938674 3300025938 Bacteria 729
209 Ga0207691_10045360 3300025940 Bacteria 4041
210 Ga0207711_10709414 3300025941 Bacteria 938
211 Ga0207689_10142503 3300025942 Bacteria 1975
212 Ga0207689_10182298 3300025942 Bacteria 1731
213 Ga0207689_10845894 3300025942 Bacteria 772
214 Ga0207661_10038321 3300025944 Bacteria 3756
215 Ga0207661_10060761 3300025944 Bacteria 3051
216 Ga0207661_10408945 3300025944 Unclassified 1231
217 Ga0207661_10536268 3300025944 Bacteria 1071
218 Ga0207661_10609084 3300025944 Unclassified 1003
219 Ga0207661_12039014 3300025944 Bacteria 520
220 Ga0207679_10025995 3300025945 Bacteria 4032
221 Ga0207679_10119827 3300025945 Unclassified 2093
222 Ga0207679_10130541 3300025945 Bacteria 2015
223 Ga0207679_10132517 3300025945 Bacteria 2002
224 Ga0207712_10005514 3300025961 Bacteria 7983
225 Ga0207712_11305266 3300025961 Bacteria 649
226 Ga0207668_11388720 3300025972 Bacteria 633
227 Ga0207640_10209079 3300025981 Bacteria 1485
228 Ga0207640_10617944 3300025981 Bacteria 919
229 Ga0207640_10700703 3300025981 Bacteria 868
230 Ga0207658_10015415 3300025986 Bacteria 5243
231 Ga0207658_10259766 3300025986 Bacteria 1480
232 Ga0207658_10645921 3300025986 Bacteria 953
233 Ga0207677_10187080 3300026023 Bacteria 1634
234 Ga0207677_10200232 3300026023 Bacteria 1587
235 Ga0207703_10039737 3300026035 Bacteria 3761
236 Ga0207703_10140865 3300026035 Bacteria 2093
237 Ga0207703_10141557 3300026035 Bacteria 2088
238 Ga0207703_11054342 3300026035 Bacteria 780
239 Ga0207639_10542001 3300026041 Bacteria 1067
240 Ga0207639_11050944 3300026041 Bacteria 763
241 Ga0207708_10258875 3300026075 Bacteria 1404
242 Ga0207702_10604652 3300026078 Bacteria 1076
243 Ga0207702_11536123 3300026078 Bacteria 659
244 Ga0207641_10333412 3300026088 Bacteria 1442
245 Ga0207676_10011767 3300026095 Bacteria 6258
246 Ga0207676_10922733 3300026095 Bacteria 857
247 Ga0207674_10004429 3300026116 Bacteria 16885
248 Ga0207674_10115047 3300026116 Bacteria 2661
249 Ga0207675_100472457 3300026118 Bacteria 1245
250 Ga0207675_101279000 3300026118 Bacteria 754
251 Ga0207683_10103418 3300026121 Bacteria 2544
252 Ga0207683_10442257 3300026121 Bacteria 1198
253 Ga0207698_10987425 3300026142 Bacteria 852
254 Ga0207428_10128959 3300027907 Bacteria 1936
255 Ga0268264_10072803 3300028381 Bacteria 2914
256 Ga0268264_10730085 3300028381 Bacteria 985
257 Ga0265327_10022259 3300031251 Bacteria 3797
258 Ga0307408_100061917 3300031548 Bacteria 2733
259 Ga0307408_100154091 3300031548 Bacteria 1817
260 Ga0307405_11032949 3300031731 Bacteria 703
261 Ga0307413_10046328 3300031824 Bacteria 2584
262 Ga0307413_11740379 3300031824 Bacteria 557
263 Ga0307410_10325726 3300031852 Bacteria 1220
264 Ga0307406_10380074 3300031901 Bacteria 1113
265 Ga0307407_10172639 3300031903 Bacteria 1425
266 Ga0307412_10315508 3300031911 Bacteria 1241
267 Ga0307414_10290789 3300032004 Bacteria 1377
268 Ga0307415_100161433 3300032126 Bacteria 1737
269 Ga0307415_100460874 3300032126 Bacteria 1101
270 Ga0373934_0144110 3300035086 Bacteria 975
271 Ga0373924_0059499 3300035410 Bacteria 1596
272 Ga0373937_0026802 3300036401 Bacteria 5209
273 Ga0373937_0469657 3300036401 Bacteria 1195
274 Ga0395905_0110397 3300037471 Bacteria 2582
275 Ga0436365_0720741 3300039437 Bacteria 28818
276 Ga0451849_0120296 3300041505 Bacteria 603
277 Ga0450923_094095 3300042125 Bacteria 686
278 Ga0451577_0040059 3300042876 Bacteria 4208
279 Ga0453683_0716706 3300044673 Bacteria 656
280 Ga0453684_0004916 3300044712 Bacteria 27306
281 Ga0453684_0107035 3300044712 Bacteria 3406
282 Ga0453684_0115316 3300044712 Bacteria 3255
283 Ga0453684_0163892 3300044712 Bacteria 2626
284 Ga0453684_0181489 3300044712 Bacteria 2471
285 Ga0453684_0201245 3300044712 Bacteria 2321
286 Ga0453684_0905451 3300044712 Bacteria 944
287 Ga0451576_0136436 3300045051 Bacteria 2559
288 Ga0451576_0642934 3300045051 Bacteria 1114
289 Ga0495664_0788502 3300046477 Bacteria 559
290 Ga0495594_0206968 3300046499 Bacteria 1118
291 Ga0495618_0110758 3300046514 Bacteria 1758
292 Ga0495628_0132282 3300046516 Bacteria 1907
293 Ga0495630_0064410 3300046517 Bacteria 2754
294 Ga0495652_0193712 3300046529 Bacteria 1549
295 Ga0495586_0132255 3300046535 Bacteria 1397
296 Ga0495586_0444037 3300046535 Bacteria 748
297 Ga0495587_0729509 3300046536 Bacteria 543
298 Ga0495667_0889261 3300046559 Bacteria 546
299 Ga0495668_0003192 3300046616 Bacteria 12555
300 Ga0495635_0534594 3300046663 Bacteria 770
301 Ga0495657_0037939 3300046675 Bacteria 3318
302 Ga0495599_0287117 3300046678 Bacteria 995
303 Ga0495646_0167488 3300046680 Bacteria 1213
304 Ga0495581_0618277 3300047315 Bacteria 627
305 Ga0495604_0202267 3300047317 Bacteria 1377
306 Ga0495674_0246824 3300047319 Bacteria 1470
307 Ga0495680_0293949 3300047322 Bacteria 1142
308 Ga0495684_0058138 3300047471 Bacteria 2946
309 Ga0496100_0591880 3300048903 Bacteria 861
310 Ga0496102_0135321 3300048905 Bacteria 2309
311 Ga0496104_1815145 3300048907 Bacteria 512
312 Ga0496110_0123780 3300048913 Bacteria 2332
313 Ga0496112_1252972 3300048915 Bacteria 658
314 Ga0496114_0142397 3300048917 Bacteria 2077
315 Ga0496114_0327118 3300048917 Bacteria 1355
316 Ga0496117_0000082 3300048920 Bacteria 220895
317 Ga0496118_0001029 3300048921 Bacteria 43389
318 Ga0496119_0000021 3300048922 Bacteria 277056
319 Ga0496122_0001176 3300048925 Bacteria 44742
320 Ga0496123_0002766 3300048926 Bacteria 20973
321 Ga0496125_0046777 3300048928 Bacteria 3626
322 Ga0501034_0000277 3300049571 Bacteria 92445
323 Ga0501047_0232624 3300049581 Bacteria 1696
324 Ga0501048_1247024 3300049582 Bacteria 535
325 Ga0501240_090742 3300049673 Bacteria 577
326 Ga0501249_055443 3300049679 Bacteria 914
327 Ga0501259_165183 3300049688 Bacteria 555
328 Ga0501268_012730 3300049765 Bacteria 1349
329 Ga0501270_007208 3300049767 Bacteria 1369
330 nmdc:mga03683_226690_c1 3300050489 Bacteria 863
331 nmdc:mga00v17_179605_c1 3300050491 Bacteria 1365
332 nmdc:mga0k408_27909_c1 3300050493 Bacteria 3208
333 nmdc:mga0k408_31151_c1 3300050493 Bacteria 3043
334 nmdc:mga0k408_866905_c1 3300050493 Bacteria 524
335 nmdc:mga05p37_259327_c1 3300050507 Bacteria 2081
336 nmdc:mga09592_1236502_c1 3300050508 Bacteria 616
337 nmdc:mga08y16_1633865_c1 3300050511 Bacteria 601
338 nmdc:mga08y16_33236_c1 3300050511 Bacteria 5418
339 nmdc:mga0n895_1624225_c1 3300050512 Bacteria 610
340 Ga0495619_0180071 3300053085 Bacteria 1462
341 Ga0500622_0000570 3300053156 Bacteria 33770
342 Ga0590077_057184 3300059426 Bacteria 881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_11699623 Ga0105248_116996231 104
2 3300000043 ARcpr5yngRDRAFT_c019793 ARcpr5yngRDRAFT_0197931 105
3 3300048913 Ga0496110_0123780 Ga0496110_0123780_105_422 105
4 3300005295 Ga0065707_10374370 Ga0065707_103743701 108
5 3300005338 Ga0068868_100178281 Ga0068868_1001782813 108
6 3300005344 Ga0070661_100513592 Ga0070661_1005135922 108
7 3300005365 Ga0070688_101166448 Ga0070688_1011664481 108
8 3300005466 Ga0070685_10146250 Ga0070685_101462501 108
9 3300005578 Ga0068854_100899964 Ga0068854_1008999641 108
10 3300005719 Ga0068861_101915529 Ga0068861_1019155292 108
11 3300009011 Ga0105251_10138958 Ga0105251_101389582 108
12 3300009101 Ga0105247_11189717 Ga0105247_111897172 108
13 3300009174 Ga0105241_10394677 Ga0105241_103946772 108
14 3300009176 Ga0105242_10208843 Ga0105242_102088432 108
15 3300009176 Ga0105242_10732607 Ga0105242_107326072 108
16 3300009176 Ga0105242_10967110 Ga0105242_109671101 108
17 3300009177 Ga0105248_10296464 Ga0105248_102964641 108
18 3300009177 Ga0105248_10512674 Ga0105248_105126742 108
19 3300009545 Ga0105237_10488050 Ga0105237_104880502 108
20 3300009553 Ga0105249_10007861 Ga0105249_1000786112 108
21 3300009553 Ga0105249_10593724 Ga0105249_105937242 108
22 3300010375 Ga0105239_13451790 Ga0105239_134517901 108
23 3300011119 Ga0105246_10214504 Ga0105246_102145042 108
24 3300013100 Ga0157373_10316617 Ga0157373_103166172 108
25 3300013102 Ga0157371_10170781 Ga0157371_101707812 108
26 3300013296 Ga0157374_10038106 Ga0157374_100381065 108
27 3300013296 Ga0157374_10085956 Ga0157374_100859563 108
28 3300013296 Ga0157374_10424573 Ga0157374_104245731 108
29 3300013297 Ga0157378_10006950 Ga0157378_100069504 108
30 3300013297 Ga0157378_10373963 Ga0157378_103739632 108
31 3300013297 Ga0157378_11634635 Ga0157378_116346351 108
32 3300013297 Ga0157378_12570818 Ga0157378_125708181 108
33 3300013306 Ga0163162_10023563 Ga0163162_100235634 108
34 3300013306 Ga0163162_10044216 Ga0163162_100442164 108
35 3300013306 Ga0163162_10524571 Ga0163162_105245712 108
36 3300013306 Ga0163162_10783019 Ga0163162_107830192 108
37 3300013307 Ga0157372_12366523 Ga0157372_123665231 108
38 3300013308 Ga0157375_10004375 Ga0157375_100043758 108
39 3300013308 Ga0157375_10275780 Ga0157375_102757802 108
40 3300013308 Ga0157375_11045942 Ga0157375_110459422 108
41 3300013308 Ga0157375_11299641 Ga0157375_112996412 108
42 3300013308 Ga0157375_11417807 Ga0157375_114178072 108
43 3300014325 Ga0163163_10001667 Ga0163163_100016674 108
44 3300014325 Ga0163163_10350675 Ga0163163_103506752 108
45 3300014325 Ga0163163_10391041 Ga0163163_103910412 108
46 3300014326 Ga0157380_10219841 Ga0157380_102198412 108
47 3300014745 Ga0157377_10043406 Ga0157377_100434063 108
48 3300014745 Ga0157377_10332731 Ga0157377_103327311 108
49 3300014968 Ga0157379_10033556 Ga0157379_100335563 108
50 3300014968 Ga0157379_10247077 Ga0157379_102470772 108
51 3300014968 Ga0157379_10762232 Ga0157379_107622321 108
52 3300014968 Ga0157379_12323745 Ga0157379_123237451 108
53 3300014969 Ga0157376_10841078 Ga0157376_108410782 108
54 3300017792 Ga0163161_10015095 Ga0163161_100150952 108
55 3300025321 Ga0207656_10327328 Ga0207656_103273282 108
56 3300025907 Ga0207645_10483740 Ga0207645_104837402 108
57 3300025917 Ga0207660_10572867 Ga0207660_105728672 108
58 3300025925 Ga0207650_10174563 Ga0207650_101745631 108
59 3300025972 Ga0207668_11388720 Ga0207668_113887202 108
60 3300025986 Ga0207658_10259766 Ga0207658_102597662 108
61 3300025986 Ga0207658_10645921 Ga0207658_106459211 108
62 3300026023 Ga0207677_10187080 Ga0207677_101870802 108
63 3300031548 Ga0307408_100061917 Ga0307408_1000619172 108
64 3300031731 Ga0307405_11032949 Ga0307405_110329491 108
65 3300031901 Ga0307406_10380074 Ga0307406_103800742 108
66 3300032126 Ga0307415_100460874 Ga0307415_1004608742 108
67 3300037471 Ga0395905_0110397 Ga0395905_0110397_83_409 108
68 3300044673 Ga0453683_0716706 Ga0453683_0716706_24_359 108
69 3300046499 Ga0495594_0206968 Ga0495594_0206968_312_638 108
70 3300046536 Ga0495587_0729509 Ga0495587_0729509_13_339 108
71 3300046616 Ga0495668_0003192 Ga0495668_0003192_2030_2356 108
72 3300048903 Ga0496100_0591880 Ga0496100_0591880_281_607 108
73 3300048907 Ga0496104_1815145 Ga0496104_1815145_90_416 108
74 3300048915 Ga0496112_1252972 Ga0496112_1252972_53_379 108
75 3300048917 Ga0496114_0142397 Ga0496114_0142397_906_1232 108
76 3300048917 Ga0496114_0327118 Ga0496114_0327118_322_648 108
77 3300050493 nmdc:mga0k408_31151_c1 nmdc:mga0k408_31151_c1_2620_2946 108
78 3300050512 nmdc:mga0n895_1624225_c1 nmdc:mga0n895_1624225_c1_226_552 108
79 3300053156 Ga0500622_0000570 Ga0500622_0000570_4315_4641 108
80 iso_pu_bacteria 2585428184 2588221557 112
81 3300005578 Ga0068854_100728787 Ga0068854_1007287871 113
82 3300044712 Ga0453684_0201245 Ga0453684_0201245_1028_1369 113
83 iso_pu_bacteria 2896109856 2896112159 113
84 3300006048 Ga0075363_100257576 Ga0075363_1002575762 115
85 3300031824 Ga0307413_11740379 Ga0307413_117403791 115
86 3300049582 Ga0501048_1247024 Ga0501048_1247024_28_378 115
87 3300050489 nmdc:mga03683_226690_c1 nmdc:mga03683_226690_c1_309_656 115
88 3300050491 nmdc:mga00v17_179605_c1 nmdc:mga00v17_179605_c1_363_710 115
89 3300050493 nmdc:mga0k408_27909_c1 nmdc:mga0k408_27909_c1_2193_2540 115
90 2088090002 CNA_F6ESG4R02F9HHG CNA_00438450 116
91 2162886012 MBSR1b_contig_1075097 MBSR1b_0654.00001290 116
92 2162886012 MBSR1b_contig_7998474 MBSR1b_0679.00004610 116
93 3300005289 Ga0065704_10788038 Ga0065704_107880381 116
94 3300005293 Ga0065715_10113183 Ga0065715_101131833 116
95 3300005328 Ga0070676_10211412 Ga0070676_102114122 116
96 3300005329 Ga0070683_100019931 Ga0070683_1000199318 116
97 3300005329 Ga0070683_100025408 Ga0070683_1000254085 116
98 3300005329 Ga0070683_100316460 Ga0070683_1003164603 116
99 3300005330 Ga0070690_100010953 Ga0070690_1000109535 116
100 3300005330 Ga0070690_100110234 Ga0070690_1001102341 116
101 3300005331 Ga0070670_100264880 Ga0070670_1002648801 116
102 3300005333 Ga0070677_10396113 Ga0070677_103961131 116
103 3300005334 Ga0068869_100071758 Ga0068869_1000717582 116
104 3300005335 Ga0070666_10338251 Ga0070666_103382512 116
105 3300005335 Ga0070666_11428358 Ga0070666_114283581 116
106 3300005336 Ga0070680_101195060 Ga0070680_1011950602 116
107 3300005337 Ga0070682_101966377 Ga0070682_1019663771 116
108 3300005338 Ga0068868_100687992 Ga0068868_1006879922 116
109 3300005338 Ga0068868_100688165 Ga0068868_1006881652 116
110 3300005340 Ga0070689_100108498 Ga0070689_1001084983 116
111 3300005341 Ga0070691_10229524 Ga0070691_102295242 116
112 3300005344 Ga0070661_100059623 Ga0070661_1000596232 116
113 3300005344 Ga0070661_100305008 Ga0070661_1003050082 116
114 3300005344 Ga0070661_100645273 Ga0070661_1006452731 116
115 3300005353 Ga0070669_100612143 Ga0070669_1006121432 116
116 3300005354 Ga0070675_101658059 Ga0070675_1016580591 116
117 3300005355 Ga0070671_100114091 Ga0070671_1001140913 116
118 3300005355 Ga0070671_100121320 Ga0070671_1001213203 116
119 3300005355 Ga0070671_100321101 Ga0070671_1003211011 116
120 3300005364 Ga0070673_100177067 Ga0070673_1001770673 116
121 3300005364 Ga0070673_101173686 Ga0070673_1011736861 116
122 3300005365 Ga0070688_100038825 Ga0070688_1000388253 116
123 3300005365 Ga0070688_100053806 Ga0070688_1000538062 116
124 3300005366 Ga0070659_101650236 Ga0070659_1016502361 116
125 3300005367 Ga0070667_100024990 Ga0070667_1000249905 116
126 3300005367 Ga0070667_100025140 Ga0070667_1000251407 116
127 3300005367 Ga0070667_100610074 Ga0070667_1006100742 116
128 3300005444 Ga0070694_100063322 Ga0070694_1000633223 116
129 3300005456 Ga0070678_100147696 Ga0070678_1001476962 116
130 3300005456 Ga0070678_100612970 Ga0070678_1006129702 116
131 3300005457 Ga0070662_100013645 Ga0070662_1000136454 116
132 3300005457 Ga0070662_100036931 Ga0070662_1000369314 116
133 3300005457 Ga0070662_100066832 Ga0070662_1000668321 116
134 3300005457 Ga0070662_100193853 Ga0070662_1001938531 116
135 3300005459 Ga0068867_100141121 Ga0068867_1001411212 116
136 3300005459 Ga0068867_101304879 Ga0068867_1013048792 116
137 3300005471 Ga0070698_100001350 Ga0070698_10000135015 116
138 3300005471 Ga0070698_100701897 Ga0070698_1007018972 116
139 3300005530 Ga0070679_100049752 Ga0070679_1000497526 116
140 3300005530 Ga0070679_101018766 Ga0070679_1010187662 116
141 3300005535 Ga0070684_100002578 Ga0070684_10000257818 116
142 3300005535 Ga0070684_100011405 Ga0070684_1000114053 116
143 3300005539 Ga0068853_100273407 Ga0068853_1002734073 116
144 3300005543 Ga0070672_101301972 Ga0070672_1013019721 116
145 3300005544 Ga0070686_100066998 Ga0070686_1000669983 116
146 3300005544 Ga0070686_100349874 Ga0070686_1003498742 116
147 3300005549 Ga0070704_101211628 Ga0070704_1012116282 116
148 3300005549 Ga0070704_101635779 Ga0070704_1016357791 116
149 3300005564 Ga0070664_100013210 Ga0070664_1000132109 116
150 3300005564 Ga0070664_100487557 Ga0070664_1004875572 116
151 3300005577 Ga0068857_100118633 Ga0068857_1001186332 116
152 3300005578 Ga0068854_100079929 Ga0068854_1000799292 116
153 3300005578 Ga0068854_100362708 Ga0068854_1003627081 116
154 3300005614 Ga0068856_100510742 Ga0068856_1005107421 116
155 3300005616 Ga0068852_100130923 Ga0068852_1001309233 116
156 3300005616 Ga0068852_100956441 Ga0068852_1009564412 116
157 3300005617 Ga0068859_100015933 Ga0068859_1000159332 116
158 3300005617 Ga0068859_100030014 Ga0068859_1000300146 116
159 3300005618 Ga0068864_100004652 Ga0068864_10000465216 116
160 3300005718 Ga0068866_10218786 Ga0068866_102187862 116
161 3300005718 Ga0068866_10854476 Ga0068866_108544762 116
162 3300005834 Ga0068851_10689197 Ga0068851_106891971 116
163 3300005840 Ga0068870_10086915 Ga0068870_100869153 116
164 3300005840 Ga0068870_10762967 Ga0068870_107629672 116
165 3300005842 Ga0068858_100216664 Ga0068858_1002166642 116
166 3300005843 Ga0068860_100068747 Ga0068860_1000687474 116
167 3300006163 Ga0070715_10198047 Ga0070715_101980472 116
168 3300006173 Ga0070716_101743866 Ga0070716_1017438661 116
169 3300006195 Ga0075366_10016009 Ga0075366_100160094 116
170 3300006237 Ga0097621_100824614 Ga0097621_1008246142 116
171 3300006237 Ga0097621_102331516 Ga0097621_1023315161 116
172 3300006358 Ga0068871_100177442 Ga0068871_1001774422 116
173 3300006358 Ga0068871_100704053 Ga0068871_1007040532 116
174 3300006844 Ga0075428_100413870 Ga0075428_1004138702 116
175 3300006844 Ga0075428_101541757 Ga0075428_1015417571 116
176 3300006847 Ga0075431_101207287 Ga0075431_1012072872 116
177 3300006871 Ga0075434_100573382 Ga0075434_1005733821 116
178 3300006881 Ga0068865_100056224 Ga0068865_1000562242 116
179 3300006881 Ga0068865_100228162 Ga0068865_1002281622 116
180 3300006881 Ga0068865_100338146 Ga0068865_1003381461 116
181 3300006881 Ga0068865_100911396 Ga0068865_1009113962 116
182 3300006881 Ga0068865_101248821 Ga0068865_1012488211 116
183 3300006931 Ga0097620_100015932 Ga0097620_1000159322 116
184 3300006931 Ga0097620_100030013 Ga0097620_1000300136 116
185 3300009093 Ga0105240_10030722 Ga0105240_100307226 116
186 3300009093 Ga0105240_10259261 Ga0105240_102592613 116
187 3300009094 Ga0111539_10065720 Ga0111539_100657203 116
188 3300009094 Ga0111539_10224520 Ga0111539_102245202 116
189 3300009101 Ga0105247_11213561 Ga0105247_112135612 116
190 3300009147 Ga0114129_10836246 Ga0114129_108362462 116
191 3300009176 Ga0105242_10702579 Ga0105242_107025792 116
192 3300009553 Ga0105249_10019239 Ga0105249_100192394 116
193 3300011119 Ga0105246_10911173 Ga0105246_109111732 116
194 3300013100 Ga0157373_10137079 Ga0157373_101370794 116
195 3300013100 Ga0157373_10243988 Ga0157373_102439882 116
196 3300013100 Ga0157373_10430999 Ga0157373_104309991 116
197 3300013104 Ga0157370_10133997 Ga0157370_101339972 116
198 3300013297 Ga0157378_10043049 Ga0157378_100430495 116
199 3300013297 Ga0157378_12417496 Ga0157378_124174961 116
200 3300013306 Ga0163162_10003528 Ga0163162_100035283 116
201 3300013307 Ga0157372_10008763 Ga0157372_100087639 116
202 3300013307 Ga0157372_12394016 Ga0157372_123940162 116
203 3300013308 Ga0157375_11943727 Ga0157375_119437272 116
204 3300014326 Ga0157380_10246102 Ga0157380_102461023 116
205 3300014326 Ga0157380_10667533 Ga0157380_106675331 116
206 3300014326 Ga0157380_11218412 Ga0157380_112184122 116
207 3300014326 Ga0157380_11763600 Ga0157380_117636001 116
208 3300014326 Ga0157380_13191185 Ga0157380_131911851 116
209 3300014968 Ga0157379_10493506 Ga0157379_104935061 116
210 3300017792 Ga0163161_10004747 Ga0163161_100047477 116
211 3300017792 Ga0163161_10093001 Ga0163161_100930013 116
212 3300017792 Ga0163161_10512642 Ga0163161_105126422 116
213 3300017792 Ga0163161_10559703 Ga0163161_105597032 116
214 3300021384 Ga0213876_10008161 Ga0213876_100081613 116
215 3300025321 Ga0207656_10718718 Ga0207656_107187181 116
216 3300025899 Ga0207642_10287904 Ga0207642_102879041 116
217 3300025903 Ga0207680_10664622 Ga0207680_106646222 116
218 3300025903 Ga0207680_10882521 Ga0207680_108825211 116
219 3300025904 Ga0207647_10021287 Ga0207647_100212875 116
220 3300025905 Ga0207685_10165951 Ga0207685_101659511 116
221 3300025907 Ga0207645_10144936 Ga0207645_101449361 116
222 3300025918 Ga0207662_10010072 Ga0207662_100100722 116
223 3300025918 Ga0207662_10746601 Ga0207662_107466012 116
224 3300025920 Ga0207649_10065968 Ga0207649_100659682 116
225 3300025920 Ga0207649_11289543 Ga0207649_112895431 116
226 3300025921 Ga0207652_10051087 Ga0207652_100510873 116
227 3300025925 Ga0207650_10473598 Ga0207650_104735982 116
228 3300025926 Ga0207659_10839441 Ga0207659_108394412 116
229 3300025932 Ga0207690_10078240 Ga0207690_100782404 116
230 3300025933 Ga0207706_10019501 Ga0207706_100195012 116
231 3300025933 Ga0207706_10028280 Ga0207706_100282806 116
232 3300025933 Ga0207706_10214075 Ga0207706_102140752 116
233 3300025933 Ga0207706_10825186 Ga0207706_108251862 116
234 3300025934 Ga0207686_10236139 Ga0207686_102361392 116
235 3300025934 Ga0207686_10300001 Ga0207686_103000012 116
236 3300025934 Ga0207686_10357870 Ga0207686_103578702 116
237 3300025938 Ga0207704_10507597 Ga0207704_105075971 116
238 3300025938 Ga0207704_10938674 Ga0207704_109386741 116
239 3300025940 Ga0207691_10045360 Ga0207691_100453601 116
240 3300025941 Ga0207711_10709414 Ga0207711_107094141 116
241 3300025942 Ga0207689_10142503 Ga0207689_101425032 116
242 3300025942 Ga0207689_10182298 Ga0207689_101822981 116
243 3300025942 Ga0207689_10845894 Ga0207689_108458941 116
244 3300025944 Ga0207661_10038321 Ga0207661_100383215 116
245 3300025944 Ga0207661_10060761 Ga0207661_100607615 116
246 3300025944 Ga0207661_10408945 Ga0207661_104089453 116
247 3300025944 Ga0207661_10536268 Ga0207661_105362681 116
248 3300025944 Ga0207661_10609084 Ga0207661_106090842 116
249 3300025944 Ga0207661_12039014 Ga0207661_120390141 116
250 3300025945 Ga0207679_10025995 Ga0207679_100259958 116
251 3300025945 Ga0207679_10119827 Ga0207679_101198273 116
252 3300025945 Ga0207679_10130541 Ga0207679_101305413 116
253 3300025945 Ga0207679_10132517 Ga0207679_101325174 116
254 3300025961 Ga0207712_10005514 Ga0207712_100055149 116
255 3300025961 Ga0207712_11305266 Ga0207712_113052661 116
256 3300025981 Ga0207640_10209079 Ga0207640_102090791 116
257 3300025981 Ga0207640_10617944 Ga0207640_106179442 116
258 3300025981 Ga0207640_10700703 Ga0207640_107007032 116
259 3300025986 Ga0207658_10015415 Ga0207658_100154157 116
260 3300026023 Ga0207677_10200232 Ga0207677_102002322 116
261 3300026035 Ga0207703_10039737 Ga0207703_100397372 116
262 3300026035 Ga0207703_10140865 Ga0207703_101408653 116
263 3300026035 Ga0207703_10141557 Ga0207703_101415572 116
264 3300026035 Ga0207703_11054342 Ga0207703_110543421 116
265 3300026041 Ga0207639_10542001 Ga0207639_105420012 116
266 3300026041 Ga0207639_11050944 Ga0207639_110509442 116
267 3300026075 Ga0207708_10258875 Ga0207708_102588752 116
268 3300026078 Ga0207702_10604652 Ga0207702_106046521 116
269 3300026078 Ga0207702_11536123 Ga0207702_115361232 116
270 3300026088 Ga0207641_10333412 Ga0207641_103334122 116
271 3300026095 Ga0207676_10011767 Ga0207676_100117673 116
272 3300026095 Ga0207676_10922733 Ga0207676_109227332 116
273 3300026116 Ga0207674_10004429 Ga0207674_100044298 116
274 3300026116 Ga0207674_10115047 Ga0207674_101150472 116
275 3300026118 Ga0207675_100472457 Ga0207675_1004724572 116
276 3300026118 Ga0207675_101279000 Ga0207675_1012790002 116
277 3300026121 Ga0207683_10103418 Ga0207683_101034182 116
278 3300026121 Ga0207683_10442257 Ga0207683_104422571 116
279 3300026142 Ga0207698_10987425 Ga0207698_109874252 116
280 3300027907 Ga0207428_10128959 Ga0207428_101289592 116
281 3300028381 Ga0268264_10072803 Ga0268264_100728032 116
282 3300028381 Ga0268264_10730085 Ga0268264_107300851 116
283 3300031251 Ga0265327_10022259 Ga0265327_100222592 116
284 3300031548 Ga0307408_100154091 Ga0307408_1001540912 116
285 3300031824 Ga0307413_10046328 Ga0307413_100463282 116
286 3300031852 Ga0307410_10325726 Ga0307410_103257262 116
287 3300031903 Ga0307407_10172639 Ga0307407_101726391 116
288 3300031911 Ga0307412_10315508 Ga0307412_103155082 116
289 3300032004 Ga0307414_10290789 Ga0307414_102907891 116
290 3300032126 Ga0307415_100161433 Ga0307415_1001614332 116
291 3300035086 Ga0373934_0144110 Ga0373934_0144110_125_475 116
292 3300035410 Ga0373924_0059499 Ga0373924_0059499_445_795 116
293 3300036401 Ga0373937_0026802 Ga0373937_0026802_3863_4213 116
294 3300036401 Ga0373937_0469657 Ga0373937_0469657_517_867 116
295 3300039437 Ga0436365_0720741 Ga0436365_0720741_3576_3926 116
296 3300041505 Ga0451849_0120296 Ga0451849_0120296_149_580 116
297 3300042125 Ga0450923_094095 Ga0450923_094095_111_461 116
298 3300042876 Ga0451577_0040059 Ga0451577_0040059_2550_2918 116
299 3300044712 Ga0453684_0004916 Ga0453684_0004916_23582_23944 116
300 3300044712 Ga0453684_0107035 Ga0453684_0107035_2705_3055 116
301 3300044712 Ga0453684_0115316 Ga0453684_0115316_2734_3084 116
302 3300044712 Ga0453684_0163892 Ga0453684_0163892_871_1239 116
303 3300044712 Ga0453684_0181489 Ga0453684_0181489_1220_1570 116
304 3300044712 Ga0453684_0905451 Ga0453684_0905451_74_424 116
305 3300045051 Ga0451576_0136436 Ga0451576_0136436_71_421 116
306 3300045051 Ga0451576_0642934 Ga0451576_0642934_240_608 116
307 3300046477 Ga0495664_0788502 Ga0495664_0788502_51_401 116
308 3300046514 Ga0495618_0110758 Ga0495618_0110758_574_924 116
309 3300046516 Ga0495628_0132282 Ga0495628_0132282_1307_1657 116
310 3300046517 Ga0495630_0064410 Ga0495630_0064410_618_968 116
311 3300046529 Ga0495652_0193712 Ga0495652_0193712_431_781 116
312 3300046535 Ga0495586_0132255 Ga0495586_0132255_297_647 116
313 3300046535 Ga0495586_0444037 Ga0495586_0444037_353_703 116
314 3300046559 Ga0495667_0889261 Ga0495667_0889261_160_510 116
315 3300046663 Ga0495635_0534594 Ga0495635_0534594_388_738 116
316 3300046675 Ga0495657_0037939 Ga0495657_0037939_853_1203 116
317 3300046678 Ga0495599_0287117 Ga0495599_0287117_148_498 116
318 3300046680 Ga0495646_0167488 Ga0495646_0167488_525_875 116
319 3300047315 Ga0495581_0618277 Ga0495581_0618277_246_596 116
320 3300047317 Ga0495604_0202267 Ga0495604_0202267_947_1297 116
321 3300047319 Ga0495674_0246824 Ga0495674_0246824_190_540 116
322 3300047322 Ga0495680_0293949 Ga0495680_0293949_714_1064 116
323 3300047471 Ga0495684_0058138 Ga0495684_0058138_56_406 116
324 3300048905 Ga0496102_0135321 Ga0496102_0135321_1940_2293 116
325 3300048920 Ga0496117_0000082 Ga0496117_0000082_193744_194097 116
326 3300048921 Ga0496118_0001029 Ga0496118_0001029_26769_27122 116
327 3300048922 Ga0496119_0000021 Ga0496119_0000021_259117_259470 116
328 3300048925 Ga0496122_0001176 Ga0496122_0001176_26808_27161 116
329 3300048926 Ga0496123_0002766 Ga0496123_0002766_13992_14345 116
330 3300048928 Ga0496125_0046777 Ga0496125_0046777_2152_2505 116
331 3300049571 Ga0501034_0000277 Ga0501034_0000277_29387_29737 116
332 3300049581 Ga0501047_0232624 Ga0501047_0232624_372_722 116
333 3300049673 Ga0501240_090742 Ga0501240_090742_116_466 116
334 3300049679 Ga0501249_055443 Ga0501249_055443_476_826 116
335 3300049688 Ga0501259_165183 Ga0501259_165183_89_439 116
336 3300049765 Ga0501268_012730 Ga0501268_012730_395_745 116
337 3300049767 Ga0501270_007208 Ga0501270_007208_379_729 116
338 3300050493 nmdc:mga0k408_866905_c1 nmdc:mga0k408_866905_c1_128_478 116
339 3300050507 nmdc:mga05p37_259327_c1 nmdc:mga05p37_259327_c1_249_599 116
340 3300050508 nmdc:mga09592_1236502_c1 nmdc:mga09592_1236502_c1_98_448 116
341 3300050511 nmdc:mga08y16_1633865_c1 nmdc:mga08y16_1633865_c1_49_429 116
342 3300050511 nmdc:mga08y16_33236_c1 nmdc:mga08y16_33236_c1_4553_4909 116
343 3300053085 Ga0495619_0180071 Ga0495619_0180071_559_909 116
344 3300059426 Ga0590077_057184 Ga0590077_057184_286_636 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09966

DUF2200

Uncharacterized protein conserved in bacteria (DUF2200)

5

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9413 3 115
3c9p-assembly1.cif.gz_A crystal structure of uncharacterized protein sp1917 0.9107 3 115
5cd4-assembly2.cif.gz_P the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.4007 9 115
4tvx-assembly1.cif.gz_P crystal structure of the e. coli crispr rna-guided surveillance complex, cascade 0.3666 4 115
5cd4-assembly1.cif.gz_C the type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back 0.3557 4 115
ID Description Score Start End Superfamily
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.9363 3 115 1.10.8.290
3c9pA00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;uncharacterized protein sp1917 domain 0.8905 3 115 1.10.8.290
af_Q2FWE1_2_83_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7855 9 115 1.10.8.10
af_P9WHV3_1_82_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7811 9 115 1.10.8.10
2b3tA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.7556 9 114 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A239SPK5-F1-model_v4 Lin0147 1.001 4 115
AF-A0A359FDS4-F1-model_v4 deleted 1.001 5 115
AF-A0A200HG91-F1-model_v4 DUF2200 domain-containing protein 1.001 9 116
AF-A0A1W6VMU7-F1-model_v4 deleted 1.001 33 116
AF-A0A0B8T2D2-F1-model_v4 DUF2200 domain-containing protein 1 2 116

Feature Viewer

pLDDT pTM Quality
92.9 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map