F415694

General Info

Members Datasets Scaffolds Average Seq Length
343 208 686 210

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0020584|Ga0439459_0020584_421_1149
Length 242
Sequence MSKLNQLFDKNRSWSEAIRERDPEFFAKLSRQQSPEYLWIGCSDSRVPANQIVGLLPGEIFVHRNIANVVVHTDLNCLSVAQFAVDVIKVRHIIVCGHYGCGGVRAALRGDRHGLVDNWLRHVQDVRDKHESLLKSLDNEVERADRLCELNVLEQVLNVCQTSIVRDAWYRGQELTVHSWIYGLHDGLIRDLGMAVGAWKEVEPAHRKAISNLGKPVTPAPSKKKGSKLVVPPLNPQRRTLN

Samples

Sample ID Description Type Environment
1 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
149 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 3.5
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 11.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439459_0020584 3300042438 Bacteria 1260
2 MBSR1b_contig_4823667 2162886012 Bacteria 2921
3 2214934091 2209111006 Bacteria 1328
4 ARcpr5oldR_c005282 3300000041 Bacteria 1111
5 ARcpr5yngRDRAFT_c004976 3300000043 Bacteria 1239
6 ARSoilOldRDRAFT_c004103 3300000044 Bacteria 1241
7 ARCol0yngRDRAFT_1002037 3300000652 Bacteria 1559
8 Ga0065715_10093371 3300005293 Unclassified 4710
9 Ga0065715_10346469 3300005293 Bacteria 958
10 Ga0070676_10097247 3300005328 Bacteria 1813
11 Ga0070683_100126584 3300005329 Bacteria 2415
12 Ga0070683_100208362 3300005329 Bacteria 1857
13 Ga0070683_100304027 3300005329 Bacteria 1517
14 Ga0070683_100482240 3300005329 Bacteria 1184
15 Ga0070683_100664279 3300005329 Bacteria 998
16 Ga0070670_100089528 3300005331 Bacteria 2645
17 Ga0070680_100027749 3300005336 Bacteria 4536
18 Ga0070680_100045031 3300005336 Bacteria 3586
19 Ga0068868_100287499 3300005338 Bacteria 1393
20 Ga0070689_100100712 3300005340 Bacteria 2286
21 Ga0070691_10034299 3300005341 Bacteria 2389
22 Ga0070687_100064368 3300005343 Unclassified 1948
23 Ga0070661_100107157 3300005344 Bacteria 2084
24 Ga0070661_100147753 3300005344 Bacteria 1775
25 Ga0070668_100162883 3300005347 Bacteria 1811
26 Ga0070669_100082333 3300005353 Bacteria 2399
27 Ga0070675_100006951 3300005354 Bacteria 8693
28 Ga0070675_100180892 3300005354 Bacteria 1823
29 Ga0070675_100293920 3300005354 Bacteria 1430
30 Ga0070671_100039266 3300005355 Bacteria 3929
31 Ga0070671_100063886 3300005355 Unclassified 3066
32 Ga0070674_100214990 3300005356 Bacteria 1492
33 Ga0070673_100504898 3300005364 Bacteria 1094
34 Ga0070659_100032678 3300005366 Bacteria 4037
35 Ga0070659_100341684 3300005366 Unclassified 1254
36 Ga0070667_100034853 3300005367 Unclassified 4213
37 Ga0070667_100831493 3300005367 Bacteria 858
38 Ga0070700_100096342 3300005441 Bacteria 1941
39 Ga0070700_100101186 3300005441 Bacteria 1899
40 Ga0070694_100477227 3300005444 Bacteria 989
41 Ga0070678_100298979 3300005456 Unclassified 1367
42 Ga0070662_100824338 3300005457 Bacteria 789
43 Ga0070681_10056641 3300005458 Bacteria 3900
44 Ga0070681_10558976 3300005458 Bacteria 1058
45 Ga0070685_10002838 3300005466 Bacteria 8848
46 Ga0070685_10122093 3300005466 Bacteria 1619
47 Ga0070685_10206347 3300005466 Bacteria 1280
48 Ga0070707_100475362 3300005468 Unclassified 1211
49 Ga0070679_100374086 3300005530 Bacteria 1371
50 Ga0070679_100540764 3300005530 Bacteria 1109
51 Ga0070684_100022720 3300005535 Bacteria 5235
52 Ga0070684_100038105 3300005535 Bacteria 4128
53 Ga0070684_100124670 3300005535 Bacteria 2319
54 Ga0070684_100371029 3300005535 Unclassified 1318
55 Ga0068853_100482392 3300005539 Bacteria 1169
56 Ga0068853_100884020 3300005539 Bacteria 858
57 Ga0070686_100004904 3300005544 Bacteria 7376
58 Ga0070686_100011234 3300005544 Bacteria 5074
59 Ga0070695_100182207 3300005545 Bacteria 1489
60 Ga0070693_100072885 3300005547 Bacteria 2027
61 Ga0068855_100009160 3300005563 Bacteria 11955
62 Ga0068855_100520821 3300005563 Bacteria 1290
63 Ga0068855_100890884 3300005563 Archaea 941
64 Ga0070664_100003750 3300005564 Bacteria 12258
65 Ga0070664_100198257 3300005564 Bacteria 1790
66 Ga0068857_100004594 3300005577 Bacteria 11693
67 Ga0068857_100174591 3300005577 Bacteria 1954
68 Ga0068854_100072797 3300005578 Bacteria 2517
69 Ga0068856_100122578 3300005614 Bacteria 2602
70 Ga0070702_100581821 3300005615 Bacteria 836
71 Ga0068852_100052467 3300005616 Unclassified 3504
72 Ga0068852_100401526 3300005616 Unclassified 1348
73 Ga0068859_100012865 3300005617 Bacteria 8406
74 Ga0068859_100067842 3300005617 Unclassified 3602
75 Ga0068864_100173319 3300005618 Bacteria 1968
76 Ga0068861_100028024 3300005719 Unclassified 4108
77 Ga0068861_100044078 3300005719 Bacteria 3352
78 Ga0068861_100228351 3300005719 Bacteria 1577
79 Ga0068861_100411094 3300005719 Bacteria 1203
80 Ga0068861_100525477 3300005719 Bacteria 1074
81 Ga0068863_100277427 3300005841 Bacteria 1623
82 Ga0068858_100084498 3300005842 Unclassified 2952
83 Ga0068860_100024740 3300005843 Bacteria 5800
84 Ga0068860_100186411 3300005843 Bacteria 2007
85 Ga0068862_100481779 3300005844 Bacteria 1174
86 Ga0081455_10011214 3300005937 Bacteria 9019
87 Ga0081455_10036213 3300005937 Bacteria 4398
88 Ga0081539_10000026 3300005985 Bacteria 330830
89 Ga0081539_10006115 3300005985 Bacteria 11736
90 Ga0081539_10074156 3300005985 Bacteria 1813
91 Ga0075432_10000441 3300006058 Bacteria 12192
92 Ga0075366_10006162 3300006195 Bacteria 6543
93 Ga0097621_100195333 3300006237 Bacteria 1754
94 Ga0068871_100337849 3300006358 Unclassified 1329
95 Ga0075428_100003243 3300006844 Bacteria 17811
96 Ga0075430_100008947 3300006846 Bacteria 8456
97 Ga0075433_10051800 3300006852 Bacteria 3576
98 Ga0075429_100021476 3300006880 Bacteria 5596
99 Ga0068865_100050267 3300006881 Bacteria 2879
100 Ga0068865_100077400 3300006881 Bacteria 2377
101 Ga0068865_100229809 3300006881 Unclassified 1455
102 Ga0068865_100587493 3300006881 Bacteria 940
103 Ga0097620_100012862 3300006931 Bacteria 8406
104 Ga0097620_100067839 3300006931 Unclassified 3602
105 Ga0105240_10000931 3300009093 Bacteria 52113
106 Ga0105240_10011797 3300009093 Bacteria 12138
107 Ga0111539_10016644 3300009094 Bacteria 9112
108 Ga0105245_10000574 3300009098 Bacteria 33386
109 Ga0105245_10036734 3300009098 Bacteria 4353
110 Ga0105245_10225538 3300009098 Bacteria 1810
111 Ga0105245_10280928 3300009098 Bacteria 1627
112 Ga0105247_10015196 3300009101 Bacteria 4616
113 Ga0114129_10010088 3300009147 Bacteria 13467
114 Ga0105243_10016379 3300009148 Bacteria 5607
115 Ga0105243_10181223 3300009148 Unclassified 1832
116 Ga0105242_10082647 3300009176 Unclassified 2688
117 Ga0105248_10130811 3300009177 Unclassified 2831
118 Ga0105237_10055715 3300009545 Bacteria 3959
119 Ga0105237_10673289 3300009545 Bacteria 1041
120 Ga0105237_10747888 3300009545 Bacteria 984
121 Ga0105238_10163856 3300009551 Bacteria 2199
122 Ga0105238_10510708 3300009551 Bacteria 1203
123 Ga0105249_10073820 3300009553 Bacteria 3156
124 Ga0105239_10121988 3300010375 Bacteria 2895
125 Ga0105239_10148140 3300010375 Bacteria 2619
126 Ga0105239_10208635 3300010375 Bacteria 2189
127 Ga0105239_10257705 3300010375 Bacteria 1960
128 Ga0105239_10284654 3300010375 Bacteria 1861
129 Ga0105239_10433829 3300010375 Bacteria 1489
130 Ga0157373_10030665 3300013100 Bacteria 3869
131 Ga0157371_10136418 3300013102 Unclassified 1747
132 Ga0157370_10060827 3300013104 Unclassified 3585
133 Ga0157370_10134867 3300013104 Bacteria 2301
134 Ga0157370_10358940 3300013104 Bacteria 1343
135 Ga0157369_10084986 3300013105 Bacteria 3381
136 Ga0157374_10179301 3300013296 Bacteria 2069
137 Ga0157378_10000006 3300013297 Bacteria 192683
138 Ga0157378_10033901 3300013297 Unclassified 4516
139 Ga0163162_10054834 3300013306 Unclassified 4011
140 Ga0163162_10183921 3300013306 Unclassified 2216
141 Ga0163162_10222307 3300013306 Bacteria 2018
142 Ga0163162_10289520 3300013306 Bacteria 1770
143 Ga0163162_10620071 3300013306 Bacteria 1207
144 Ga0157372_10348710 3300013307 Bacteria 1725
145 Ga0157372_10713987 3300013307 Bacteria 1166
146 Ga0157375_10015182 3300013308 Bacteria 6891
147 Ga0157375_10183593 3300013308 Unclassified 2244
148 Ga0163163_10027039 3300014325 Bacteria 5490
149 Ga0163163_10119764 3300014325 Unclassified 2665
150 Ga0163163_10215700 3300014325 Bacteria 1968
151 Ga0157380_10024483 3300014326 Unclassified 4570
152 Ga0157380_10139978 3300014326 Bacteria 2077
153 Ga0157377_10189078 3300014745 Bacteria 1300
154 Ga0157379_10434289 3300014968 Bacteria 1210
155 Ga0157379_10842056 3300014968 Bacteria 867
156 Ga0157376_10221100 3300014969 Bacteria 1754
157 Ga0157376_10312075 3300014969 Unclassified 1492
158 Ga0157376_10929213 3300014969 Bacteria 889
159 Ga0163161_10000782 3300017792 Bacteria 25019
160 Ga0163161_10004166 3300017792 Bacteria 10108
161 Ga0163161_10550658 3300017792 Bacteria 945
162 Ga0207710_10003052 3300025900 Bacteria 7525
163 Ga0207688_10015533 3300025901 Bacteria 4129
164 Ga0207680_10096560 3300025903 Unclassified 1891
165 Ga0207707_10318933 3300025912 Bacteria 1342
166 Ga0207707_10417727 3300025912 Bacteria 1150
167 Ga0207707_10423480 3300025912 Bacteria 1141
168 Ga0207695_10000007 3300025913 Bacteria 1092551
169 Ga0207671_10156798 3300025914 Bacteria 1761
170 Ga0207660_10107134 3300025917 Bacteria 2097
171 Ga0207660_10365177 3300025917 Bacteria 1158
172 Ga0207662_10017850 3300025918 Unclassified 4018
173 Ga0207657_10457255 3300025919 Bacteria 1001
174 Ga0207649_10091616 3300025920 Bacteria 1991
175 Ga0207652_10120992 3300025921 Bacteria 2329
176 Ga0207652_10672244 3300025921 Bacteria 925
177 Ga0207681_10134700 3300025923 Bacteria 1831
178 Ga0207681_10258268 3300025923 Bacteria 1363
179 Ga0207694_10033283 3300025924 Bacteria 3949
180 Ga0207650_10006978 3300025925 Bacteria 7701
181 Ga0207659_10385472 3300025926 Bacteria 1169
182 Ga0207687_10000002 3300025927 Bacteria 975489
183 Ga0207687_10008795 3300025927 Bacteria 6599
184 Ga0207687_10173575 3300025927 Bacteria 1664
185 Ga0207687_10310376 3300025927 Bacteria 1273
186 Ga0207644_10032277 3300025931 Unclassified 3652
187 Ga0207690_10022732 3300025932 Bacteria 3904
188 Ga0207706_10008890 3300025933 Bacteria 9248
189 Ga0207706_10046744 3300025933 Unclassified 3831
190 Ga0207706_10180160 3300025933 Bacteria 1856
191 Ga0207686_10205363 3300025934 Bacteria 1413
192 Ga0207669_10048820 3300025937 Bacteria 2517
193 Ga0207704_10101269 3300025938 Bacteria 1921
194 Ga0207704_10115769 3300025938 Bacteria 1823
195 Ga0207691_10085572 3300025940 Bacteria 2830
196 Ga0207691_10129369 3300025940 Bacteria 2231
197 Ga0207711_10042204 3300025941 Unclassified 3886
198 Ga0207661_10063443 3300025944 Bacteria 2992
199 Ga0207661_10212214 3300025944 Bacteria 1707
200 Ga0207661_10241310 3300025944 Bacteria 1604
201 Ga0207679_10068897 3300025945 Bacteria 2660
202 Ga0207679_10082947 3300025945 Bacteria 2455
203 Ga0207679_10096033 3300025945 Bacteria 2305
204 Ga0207679_10314640 3300025945 Bacteria 1354
205 Ga0207679_11031363 3300025945 Bacteria 754
206 Ga0207667_10470904 3300025949 Bacteria 1276
207 Ga0207667_10965508 3300025949 Archaea 841
208 Ga0207651_10093436 3300025960 Bacteria 2209
209 Ga0207651_10101162 3300025960 Bacteria 2139
210 Ga0207651_10202549 3300025960 Bacteria 1592
211 Ga0207712_10082313 3300025961 Bacteria 2346
212 Ga0207668_10068401 3300025972 Bacteria 2525
213 Ga0207668_10378357 3300025972 Bacteria 1191
214 Ga0207640_10117283 3300025981 Bacteria 1899
215 Ga0207640_10455098 3300025981 Bacteria 1056
216 Ga0207640_10520375 3300025981 Bacteria 994
217 Ga0207658_10078404 3300025986 Unclassified 2524
218 Ga0207658_10413986 3300025986 Bacteria 1187
219 Ga0207703_10086231 3300026035 Unclassified 2630
220 Ga0207703_10122849 3300026035 Bacteria 2231
221 Ga0207678_10147039 3300026067 Bacteria 2011
222 Ga0207702_10159709 3300026078 Bacteria 2058
223 Ga0207702_10184100 3300026078 Bacteria 1925
224 Ga0207641_10065865 3300026088 Bacteria 3100
225 Ga0207641_10162122 3300026088 Bacteria 2033
226 Ga0207648_10616085 3300026089 Bacteria 1001
227 Ga0207676_10023767 3300026095 Unclassified 4527
228 Ga0207674_10013143 3300026116 Bacteria 9213
229 Ga0207674_10123353 3300026116 Bacteria 2557
230 Ga0207674_10159051 3300026116 Bacteria 2214
231 Ga0207675_100042765 3300026118 Unclassified 4230
232 Ga0207675_100070906 3300026118 Bacteria 3257
233 Ga0207698_10316777 3300026142 Bacteria 1459
234 Ga0207428_10000015 3300027907 Bacteria 332663
235 Ga0207428_10002698 3300027907 Bacteria 17692
236 Ga0268265_10029676 3300028380 Bacteria 3929
237 Ga0268264_10003179 3300028381 Bacteria 14229
238 Ga0268264_11003680 3300028381 Bacteria 841
239 Ga0307513_10002024 3300031456 Bacteria 28560
240 Ga0307516_10006816 3300031730 Bacteria 13328
241 Ga0307516_10076603 3300031730 Bacteria 3196
242 Ga0307405_10138933 3300031731 Bacteria 1691
243 Ga0307412_10393678 3300031911 Bacteria 1126
244 Ga0307409_100177047 3300031995 Bacteria 1884
245 Ga0307409_100303594 3300031995 Bacteria 1486
246 Ga0307416_100531718 3300032002 Bacteria 1246
247 Ga0307414_10440996 3300032004 Bacteria 1140
248 Ga0373924_0003087 3300035410 Bacteria 5685
249 Ga0373937_1016358 3300036401 Bacteria 778
250 Ga0436364_0237400 3300037853 Bacteria 762
251 Ga0436365_1581886 3300039437 Bacteria 3621
252 Ga0451853_0103571 3300041512 Bacteria 1384
253 Ga0450920_038499 3300042122 Bacteria 951
254 Ga0439460_0071453 3300042461 Bacteria 1076
255 Ga0451577_0001780 3300042876 Bacteria 27676
256 Ga0451577_0003363 3300042876 Bacteria 17899
257 Ga0453684_0002385 3300044712 Bacteria 45843
258 Ga0453684_0011892 3300044712 Bacteria 14492
259 Ga0466957_0468131 3300044842 Bacteria 870
260 Ga0466967_0317672 3300045976 Bacteria 1501
261 Ga0495603_0283430 3300046455 Bacteria 952
262 Ga0495582_0308051 3300046473 Bacteria 911
263 Ga0495596_0065835 3300046500 Bacteria 1409
264 Ga0495668_0000847 3300046616 Bacteria 34708
265 Ga0496102_0395365 3300048905 Bacteria 1300
266 Ga0496103_0082253 3300048906 Bacteria 2026
267 Ga0496104_0096836 3300048907 Bacteria 2823
268 Ga0496105_0156097 3300048908 Bacteria 1874
269 Ga0496109_0010725 3300048912 Bacteria 7842
270 Ga0496109_0622707 3300048912 Unclassified 1016
271 Ga0496110_0126977 3300048913 Bacteria 2301
272 Ga0496111_0181511 3300048914 Bacteria 1564
273 Ga0496112_0080150 3300048915 Bacteria 3229
274 Ga0496113_0106717 3300048916 Bacteria 2176
275 Ga0496114_0049758 3300048917 Unclassified 3488
276 Ga0496114_0846052 3300048917 Bacteria 795
277 Ga0496118_0033637 3300048921 Bacteria 4202
278 Ga0496126_0369940 3300048929 Bacteria 1169
279 Ga0501031_0062451 3300049568 Bacteria 2428
280 Ga0501031_0090323 3300049568 Bacteria 1998
281 Ga0501033_0177420 3300049570 Bacteria 1528
282 Ga0501036_0033935 3300049572 Bacteria 4317
283 Ga0501036_0060593 3300049572 Bacteria 3206
284 Ga0501037_0068338 3300049573 Bacteria 2587
285 Ga0501038_0105921 3300049574 Bacteria 2335
286 Ga0501039_0087201 3300049575 Bacteria 2431
287 Ga0501039_0155660 3300049575 Bacteria 1795
288 Ga0501039_0645785 3300049575 Bacteria 828
289 Ga0501040_0043983 3300049576 Bacteria 3044
290 Ga0501040_0730169 3300049576 Bacteria 716
291 Ga0501041_0063477 3300049577 Bacteria 2262
292 Ga0501041_0078596 3300049577 Bacteria 2030
293 Ga0501042_0016739 3300049578 Bacteria 5041
294 Ga0501043_0334793 3300049579 Bacteria 1152
295 Ga0501046_0450874 3300049580 Bacteria 925
296 Ga0501048_0122850 3300049582 Bacteria 1835
297 Ga0501048_0141006 3300049582 Bacteria 1704
298 Ga0501048_0673324 3300049582 Bacteria 743
299 Ga0501068_0030537 3300049584 Bacteria 3197
300 Ga0501068_0447104 3300049584 Bacteria 836
301 Ga0501069_0466478 3300049585 Bacteria 751
302 Ga0501070_0249797 3300049586 Bacteria 1451
303 Ga0501071_0030480 3300049587 Bacteria 3815
304 Ga0501071_0122720 3300049587 Bacteria 1926
305 Ga0501071_0127991 3300049587 Bacteria 1886
306 Ga0501072_0103748 3300049588 Bacteria 2260
307 Ga0501072_0158663 3300049588 Bacteria 1804
308 Ga0501074_0353498 3300049590 Bacteria 1043
309 Ga0501075_0006197 3300049591 Bacteria 8219
310 Ga0501075_0104443 3300049591 Bacteria 2153
311 Ga0501076_0101454 3300049592 Bacteria 2319
312 Ga0501076_0266983 3300049592 Bacteria 1401
313 Ga0501076_0390796 3300049592 Bacteria 1143
314 Ga0501077_0005103 3300049593 Bacteria 7971
315 Ga0501077_0198476 3300049593 Bacteria 1274
316 Ga0501235_099181 3300049669 Bacteria 710
317 Ga0501079_0254180 3300049741 Bacteria 1373
318 Ga0501080_0096401 3300049742 Bacteria 2746
319 Ga0501080_0365348 3300049742 Bacteria 1302
320 Ga0501081_0078084 3300049743 Bacteria 2314
321 Ga0501083_0010180 3300049744 Bacteria 6628
322 Ga0501035_0210164 3300049822 Bacteria 1665
323 Ga0501045_0013139 3300049824 Bacteria 5839
324 Ga0501045_0018436 3300049824 Bacteria 4964
325 nmdc:mga00v17_405336_c1 3300050491 Bacteria 886
326 nmdc:mga0k408_467_c1 3300050493 Bacteria 22231
327 nmdc:mga05p37_240938_c1 3300050507 Bacteria 2175
328 nmdc:mga05p37_259767_c1 3300050507 Bacteria 2079
329 nmdc:mga09592_50984_c1 3300050508 Bacteria 3491
330 nmdc:mga0qj67_21284_c1 3300050509 Bacteria 4974
331 nmdc:mga08y16_11969_c1 3300050511 Bacteria 9111
332 nmdc:mga08y16_18_c1 3300050511 Bacteria 332558
333 nmdc:mga08y16_217870_c1 3300050511 Bacteria 1976
334 nmdc:mga08y16_467631_c1 3300050511 Bacteria 1284
335 nmdc:mga0n895_102159_c1 3300050512 Bacteria 2877
336 nmdc:mga0a205_9182_c1 3300050515 Bacteria 3114
337 Ga0501084_0036276 3300054114 Bacteria 4118
338 Ga0501084_0065907 3300054114 Bacteria 3030
339 Ga0501084_0374906 3300054114 Bacteria 1203
340 Ga0501084_1000930 3300054114 Bacteria 702
341 Ga0501082_0032729 3300060353 Bacteria 4485
342 Ga0530510_0109747 3300061734 Bacteria 2020
343 Ga0530510_0360057 3300061734 Bacteria 1093
344 Ga0439459_0020584
345 MBSR1b_contig_4823667
346 2214934091
347 ARcpr5oldR_c005282
348 ARcpr5yngRDRAFT_c004976
349 ARSoilOldRDRAFT_c004103
350 ARCol0yngRDRAFT_1002037
351 Ga0065715_10093371
352 Ga0065715_10346469
353 Ga0070676_10097247
354 Ga0070683_100126584
355 Ga0070683_100208362
356 Ga0070683_100304027
357 Ga0070683_100482240
358 Ga0070683_100664279
359 Ga0070670_100089528
360 Ga0070680_100027749
361 Ga0070680_100045031
362 Ga0068868_100287499
363 Ga0070689_100100712
364 Ga0070691_10034299
365 Ga0070687_100064368
366 Ga0070661_100107157
367 Ga0070661_100147753
368 Ga0070668_100162883
369 Ga0070669_100082333
370 Ga0070675_100006951
371 Ga0070675_100180892
372 Ga0070675_100293920
373 Ga0070671_100039266
374 Ga0070671_100063886
375 Ga0070674_100214990
376 Ga0070673_100504898
377 Ga0070659_100032678
378 Ga0070659_100341684
379 Ga0070667_100034853
380 Ga0070667_100831493
381 Ga0070700_100096342
382 Ga0070700_100101186
383 Ga0070694_100477227
384 Ga0070678_100298979
385 Ga0070662_100824338
386 Ga0070681_10056641
387 Ga0070681_10558976
388 Ga0070685_10002838
389 Ga0070685_10122093
390 Ga0070685_10206347
391 Ga0070707_100475362
392 Ga0070679_100374086
393 Ga0070679_100540764
394 Ga0070684_100022720
395 Ga0070684_100038105
396 Ga0070684_100124670
397 Ga0070684_100371029
398 Ga0068853_100482392
399 Ga0068853_100884020
400 Ga0070686_100004904
401 Ga0070686_100011234
402 Ga0070695_100182207
403 Ga0070693_100072885
404 Ga0068855_100009160
405 Ga0068855_100520821
406 Ga0068855_100890884
407 Ga0070664_100003750
408 Ga0070664_100198257
409 Ga0068857_100004594
410 Ga0068857_100174591
411 Ga0068854_100072797
412 Ga0068856_100122578
413 Ga0070702_100581821
414 Ga0068852_100052467
415 Ga0068852_100401526
416 Ga0068859_100012865
417 Ga0068859_100067842
418 Ga0068864_100173319
419 Ga0068861_100028024
420 Ga0068861_100044078
421 Ga0068861_100228351
422 Ga0068861_100411094
423 Ga0068861_100525477
424 Ga0068863_100277427
425 Ga0068858_100084498
426 Ga0068860_100024740
427 Ga0068860_100186411
428 Ga0068862_100481779
429 Ga0081455_10011214
430 Ga0081455_10036213
431 Ga0081539_10000026
432 Ga0081539_10006115
433 Ga0081539_10074156
434 Ga0075432_10000441
435 Ga0075366_10006162
436 Ga0097621_100195333
437 Ga0068871_100337849
438 Ga0075428_100003243
439 Ga0075430_100008947
440 Ga0075433_10051800
441 Ga0075429_100021476
442 Ga0068865_100050267
443 Ga0068865_100077400
444 Ga0068865_100229809
445 Ga0068865_100587493
446 Ga0097620_100012862
447 Ga0097620_100067839
448 Ga0105240_10000931
449 Ga0105240_10011797
450 Ga0111539_10016644
451 Ga0105245_10000574
452 Ga0105245_10036734
453 Ga0105245_10225538
454 Ga0105245_10280928
455 Ga0105247_10015196
456 Ga0114129_10010088
457 Ga0105243_10016379
458 Ga0105243_10181223
459 Ga0105242_10082647
460 Ga0105248_10130811
461 Ga0105237_10055715
462 Ga0105237_10673289
463 Ga0105237_10747888
464 Ga0105238_10163856
465 Ga0105238_10510708
466 Ga0105249_10073820
467 Ga0105239_10121988
468 Ga0105239_10148140
469 Ga0105239_10208635
470 Ga0105239_10257705
471 Ga0105239_10284654
472 Ga0105239_10433829
473 Ga0157373_10030665
474 Ga0157371_10136418
475 Ga0157370_10060827
476 Ga0157370_10134867
477 Ga0157370_10358940
478 Ga0157369_10084986
479 Ga0157374_10179301
480 Ga0157378_10000006
481 Ga0157378_10033901
482 Ga0163162_10054834
483 Ga0163162_10183921
484 Ga0163162_10222307
485 Ga0163162_10289520
486 Ga0163162_10620071
487 Ga0157372_10348710
488 Ga0157372_10713987
489 Ga0157375_10015182
490 Ga0157375_10183593
491 Ga0163163_10027039
492 Ga0163163_10119764
493 Ga0163163_10215700
494 Ga0157380_10024483
495 Ga0157380_10139978
496 Ga0157377_10189078
497 Ga0157379_10434289
498 Ga0157379_10842056
499 Ga0157376_10221100
500 Ga0157376_10312075
501 Ga0157376_10929213
502 Ga0163161_10000782
503 Ga0163161_10004166
504 Ga0163161_10550658
505 Ga0207710_10003052
506 Ga0207688_10015533
507 Ga0207680_10096560
508 Ga0207707_10318933
509 Ga0207707_10417727
510 Ga0207707_10423480
511 Ga0207695_10000007
512 Ga0207671_10156798
513 Ga0207660_10107134
514 Ga0207660_10365177
515 Ga0207662_10017850
516 Ga0207657_10457255
517 Ga0207649_10091616
518 Ga0207652_10120992
519 Ga0207652_10672244
520 Ga0207681_10134700
521 Ga0207681_10258268
522 Ga0207694_10033283
523 Ga0207650_10006978
524 Ga0207659_10385472
525 Ga0207687_10000002
526 Ga0207687_10008795
527 Ga0207687_10173575
528 Ga0207687_10310376
529 Ga0207644_10032277
530 Ga0207690_10022732
531 Ga0207706_10008890
532 Ga0207706_10046744
533 Ga0207706_10180160
534 Ga0207686_10205363
535 Ga0207669_10048820
536 Ga0207704_10101269
537 Ga0207704_10115769
538 Ga0207691_10085572
539 Ga0207691_10129369
540 Ga0207711_10042204
541 Ga0207661_10063443
542 Ga0207661_10212214
543 Ga0207661_10241310
544 Ga0207679_10068897
545 Ga0207679_10082947
546 Ga0207679_10096033
547 Ga0207679_10314640
548 Ga0207679_11031363
549 Ga0207667_10470904
550 Ga0207667_10965508
551 Ga0207651_10093436
552 Ga0207651_10101162
553 Ga0207651_10202549
554 Ga0207712_10082313
555 Ga0207668_10068401
556 Ga0207668_10378357
557 Ga0207640_10117283
558 Ga0207640_10455098
559 Ga0207640_10520375
560 Ga0207658_10078404
561 Ga0207658_10413986
562 Ga0207703_10086231
563 Ga0207703_10122849
564 Ga0207678_10147039
565 Ga0207702_10159709
566 Ga0207702_10184100
567 Ga0207641_10065865
568 Ga0207641_10162122
569 Ga0207648_10616085
570 Ga0207676_10023767
571 Ga0207674_10013143
572 Ga0207674_10123353
573 Ga0207674_10159051
574 Ga0207675_100042765
575 Ga0207675_100070906
576 Ga0207698_10316777
577 Ga0207428_10000015
578 Ga0207428_10002698
579 Ga0268265_10029676
580 Ga0268264_10003179
581 Ga0268264_11003680
582 Ga0307513_10002024
583 Ga0307516_10006816
584 Ga0307516_10076603
585 Ga0307405_10138933
586 Ga0307412_10393678
587 Ga0307409_100177047
588 Ga0307409_100303594
589 Ga0307416_100531718
590 Ga0307414_10440996
591 Ga0373924_0003087
592 Ga0373937_1016358
593 Ga0436364_0237400
594 Ga0436365_1581886
595 Ga0451853_0103571
596 Ga0450920_038499
597 Ga0439460_0071453
598 Ga0451577_0001780
599 Ga0451577_0003363
600 Ga0453684_0002385
601 Ga0453684_0011892
602 Ga0466957_0468131
603 Ga0466967_0317672
604 Ga0495603_0283430
605 Ga0495582_0308051
606 Ga0495596_0065835
607 Ga0495668_0000847
608 Ga0496102_0395365
609 Ga0496103_0082253
610 Ga0496104_0096836
611 Ga0496105_0156097
612 Ga0496109_0010725
613 Ga0496109_0622707
614 Ga0496110_0126977
615 Ga0496111_0181511
616 Ga0496112_0080150
617 Ga0496113_0106717
618 Ga0496114_0049758
619 Ga0496114_0846052
620 Ga0496118_0033637
621 Ga0496126_0369940
622 Ga0501031_0062451
623 Ga0501031_0090323
624 Ga0501033_0177420
625 Ga0501036_0033935
626 Ga0501036_0060593
627 Ga0501037_0068338
628 Ga0501038_0105921
629 Ga0501039_0087201
630 Ga0501039_0155660
631 Ga0501039_0645785
632 Ga0501040_0043983
633 Ga0501040_0730169
634 Ga0501041_0063477
635 Ga0501041_0078596
636 Ga0501042_0016739
637 Ga0501043_0334793
638 Ga0501046_0450874
639 Ga0501048_0122850
640 Ga0501048_0141006
641 Ga0501048_0673324
642 Ga0501068_0030537
643 Ga0501068_0447104
644 Ga0501069_0466478
645 Ga0501070_0249797
646 Ga0501071_0030480
647 Ga0501071_0122720
648 Ga0501071_0127991
649 Ga0501072_0103748
650 Ga0501072_0158663
651 Ga0501074_0353498
652 Ga0501075_0006197
653 Ga0501075_0104443
654 Ga0501076_0101454
655 Ga0501076_0266983
656 Ga0501076_0390796
657 Ga0501077_0005103
658 Ga0501077_0198476
659 Ga0501235_099181
660 Ga0501079_0254180
661 Ga0501080_0096401
662 Ga0501080_0365348
663 Ga0501081_0078084
664 Ga0501083_0010180
665 Ga0501035_0210164
666 Ga0501045_0013139
667 Ga0501045_0018436
668 nmdc:mga00v17_405336_c1
669 nmdc:mga0k408_467_c1
670 nmdc:mga05p37_240938_c1
671 nmdc:mga05p37_259767_c1
672 nmdc:mga09592_50984_c1
673 nmdc:mga0qj67_21284_c1
674 nmdc:mga08y16_11969_c1
675 nmdc:mga08y16_18_c1
676 nmdc:mga08y16_217870_c1
677 nmdc:mga08y16_467631_c1
678 nmdc:mga0n895_102159_c1
679 nmdc:mga0a205_9182_c1
680 Ga0501084_0036276
681 Ga0501084_0065907
682 Ga0501084_0374906
683 Ga0501084_1000930
684 Ga0501082_0032729
685 Ga0530510_0109747
686 Ga0530510_0360057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00484

Pro_CA

Carbonic anhydrase

37

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4waj-assembly1.cif.gz_A-2 h. influenzae beta-carbonic anhydase variant p48s/a49p 0.9447 33 210
3e24-assembly1.cif.gz_A h. influenzae beta-carbonic anhydrase, variant w39f 0.9379 35 210
6d2j-assembly1.cif.gz_A beta carbonic anhydrase in complex with thiocyanate 0.9372 4 201
5jj8-assembly1.cif.gz_A crystal structure of the beta carbonic anhydrase psca3 isolated from pseudomonas aeruginosa - alternate crystal packing form 0.9358 4 201
3e2x-assembly1.cif.gz_B-2 h. influenzae beta-carbonic anhydrase, variant v47a 0.9351 34 210
ID Description Score Start End Superfamily
4wamA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9315 34 210 3.40.1050.10
2a8cA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.913 1 210 3.40.1050.10
1ddzB02 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9089 33 210 3.40.1050.10
3ucnB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9057 1 204 3.40.1050.10
af_O94255_95_324_3.40.1050.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-carbonic Anhydrase; Chain A;Carbonic anhydrase 0.9035 5 205 3.40.1050.10
ID Description Score Start End GO Terms
AF-A0A2I6QN63-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9816 81 201 GO:0004089
GO:0008270
GO:0015976
AF-A0A536WXT4-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.9813 96 198 GO:0004089
GO:0008270
AF-A0A6S6UF92-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9796 81 210 GO:0004089
GO:0008270
GO:0015976
AF-A0A3N5FSF0-F1-model_v4 carbonic anhydrase (EC 4.2.1.1) 0.971 88 208 GO:0004089
GO:0008270
AF-A0A1C3JW41-F1-model_v4 Carbonic anhydrase (EC 4.2.1.1) (Carbonate dehydratase) 0.9675 7 208 GO:0004089
GO:0008270
GO:0015976

Map