F415653
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 211 | 686 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300035083|Ga0373926_0020060|Ga0373926_0020060_208_924 |
| Length | 238 |
| Sequence | MAKSGVGTRIVDGDLADNRSDHPPTFAHRHLNSDRLAIATHNPGKLAEMRELVAPYGIAAISVGELGLVEPDESGMTFCENAHIKAEAAAKGAGLPALADDSGLVVDALDGAPGIHSARWAGADRNFRRAMEMIEQQLRTRGATTAERRRAQFVSALCLAWPDGHVEQFEARVAGTLLWPPRGDRGFGYDPMFLPDGEQRTFGEMSSEEKRGLPPHGRGLSHRARAFMKLAEACLDRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 2 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 3 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 55 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 56 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 57 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 84 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 85 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 86 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 87 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 88 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 89 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 90 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 91 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 92 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 93 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 94 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 95 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 96 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 97 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 98 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 99 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 100 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 101 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 102 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 103 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 105 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 106 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 107 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 108 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 109 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 110 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 111 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 112 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 113 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 114 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 115 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 116 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 119 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 166 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 167 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 168 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 169 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 170 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 171 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 172 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 173 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 174 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 175 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 176 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 194 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 195 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 196 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 198 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 199 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 200 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 201 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 202 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 203 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 204 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 205 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 206 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 207 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 208 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 209 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 210 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 211 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.63 |
| Metatranscriptomes | 0 |
| Isolates | 4.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 13.7 |
| Nodule | 0.29 |
| Rhizoplane | 1.17 |
| Rhizosphere | 64.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373926_0020060 | 3300035083 | Bacteria | 2307 |
| 2 | Ga0055526_1009693 | 3300003771 | Bacteria | 4591 |
| 3 | Ga0055537_1000949 | 3300003773 | Bacteria | 13424 |
| 4 | Ga0055536_1001527 | 3300003781 | Bacteria | 13876 |
| 5 | Ga0055536_1004059 | 3300003781 | Bacteria | 7621 |
| 6 | Ga0055534_1000121 | 3300003784 | Bacteria | 57849 |
| 7 | Ga0055528_1000148 | 3300003790 | Bacteria | 57842 |
| 8 | Ga0055530_10000618 | 3300003791 | Bacteria | 30889 |
| 9 | Ga0055530_10003074 | 3300003791 | Bacteria | 9922 |
| 10 | Ga0055540_1043079 | 3300003792 | Bacteria | 964 |
| 11 | Ga0055531_10002056 | 3300003794 | Bacteria | 13876 |
| 12 | Ga0055531_10006302 | 3300003794 | Bacteria | 6759 |
| 13 | Ga0055531_10015474 | 3300003794 | Bacteria | 3358 |
| 14 | Ga0070683_100410165 | 3300005329 | Bacteria | 1292 |
| 15 | Ga0070669_100722982 | 3300005353 | Bacteria | 842 |
| 16 | Ga0070675_100206630 | 3300005354 | Bacteria | 1706 |
| 17 | Ga0070688_100155318 | 3300005365 | Bacteria | 1567 |
| 18 | Ga0070667_100811482 | 3300005367 | Bacteria | 869 |
| 19 | Ga0070709_10253229 | 3300005434 | Bacteria | 1269 |
| 20 | Ga0070714_100126501 | 3300005435 | Bacteria | 2279 |
| 21 | Ga0070713_100014543 | 3300005436 | Bacteria | 5851 |
| 22 | Ga0070713_100195355 | 3300005436 | Bacteria | 1825 |
| 23 | Ga0070713_101015234 | 3300005436 | Bacteria | 800 |
| 24 | Ga0070710_10013551 | 3300005437 | Bacteria | 4086 |
| 25 | Ga0070711_100164174 | 3300005439 | Bacteria | 1686 |
| 26 | Ga0070711_100253397 | 3300005439 | Bacteria | 1382 |
| 27 | Ga0070711_100371684 | 3300005439 | Bacteria | 1154 |
| 28 | Ga0070708_100033143 | 3300005445 | Bacteria | 4487 |
| 29 | Ga0070708_100063184 | 3300005445 | Bacteria | 3313 |
| 30 | Ga0070706_100081098 | 3300005467 | Bacteria | 3004 |
| 31 | Ga0070707_100000456 | 3300005468 | Bacteria | 40527 |
| 32 | Ga0070707_100056105 | 3300005468 | Bacteria | 3777 |
| 33 | Ga0070698_100216665 | 3300005471 | Bacteria | 1848 |
| 34 | Ga0070698_100410156 | 3300005471 | Bacteria | 1289 |
| 35 | Ga0070699_100081107 | 3300005518 | Bacteria | 2828 |
| 36 | Ga0070699_100834643 | 3300005518 | Bacteria | 844 |
| 37 | Ga0070684_100595297 | 3300005535 | Bacteria | 1028 |
| 38 | Ga0070697_100114908 | 3300005536 | Bacteria | 2247 |
| 39 | Ga0070697_100254662 | 3300005536 | Bacteria | 1502 |
| 40 | Ga0070696_100334419 | 3300005546 | Bacteria | 1169 |
| 41 | Ga0070665_100155537 | 3300005548 | Bacteria | 2288 |
| 42 | Ga0068855_100003294 | 3300005563 | Bacteria | 19777 |
| 43 | Ga0068855_100801791 | 3300005563 | Bacteria | 1001 |
| 44 | Ga0068859_101597539 | 3300005617 | Bacteria | 720 |
| 45 | Ga0068864_100734028 | 3300005618 | Bacteria | 967 |
| 46 | Ga0070717_10431218 | 3300006028 | Bacteria | 1186 |
| 47 | Ga0070717_10659536 | 3300006028 | Bacteria | 950 |
| 48 | Ga0075363_100012296 | 3300006048 | Bacteria | 4122 |
| 49 | Ga0075364_10039559 | 3300006051 | Bacteria | 3057 |
| 50 | Ga0075364_10083963 | 3300006051 | Bacteria | 2108 |
| 51 | Ga0075364_10310020 | 3300006051 | Bacteria | 1075 |
| 52 | Ga0075364_10397380 | 3300006051 | Bacteria | 940 |
| 53 | Ga0075364_10515490 | 3300006051 | Bacteria | 817 |
| 54 | Ga0075364_10542023 | 3300006051 | Bacteria | 795 |
| 55 | Ga0070716_100181600 | 3300006173 | Bacteria | 1382 |
| 56 | Ga0070712_100027947 | 3300006175 | Bacteria | 3769 |
| 57 | Ga0070712_100030211 | 3300006175 | Bacteria | 3639 |
| 58 | Ga0070712_100094526 | 3300006175 | Bacteria | 2197 |
| 59 | Ga0075367_10204740 | 3300006178 | Bacteria | 1233 |
| 60 | Ga0075433_10176041 | 3300006852 | Bacteria | 1904 |
| 61 | Ga0075434_100371826 | 3300006871 | Bacteria | 1450 |
| 62 | Ga0075436_100102613 | 3300006914 | Bacteria | 1992 |
| 63 | Ga0097620_101597096 | 3300006931 | Bacteria | 720 |
| 64 | Ga0105251_10005717 | 3300009011 | Bacteria | 8073 |
| 65 | Ga0105240_10012339 | 3300009093 | Bacteria | 11802 |
| 66 | Ga0105245_10434292 | 3300009098 | Unclassified | 1318 |
| 67 | Ga0157345_1009572 | 3300012498 | Bacteria | 829 |
| 68 | Ga0157373_10189724 | 3300013100 | Bacteria | 1448 |
| 69 | Ga0157373_10208196 | 3300013100 | Bacteria | 1379 |
| 70 | Ga0157371_10000184 | 3300013102 | Bacteria | 92100 |
| 71 | Ga0157371_10211388 | 3300013102 | Bacteria | 1392 |
| 72 | Ga0157370_10054057 | 3300013104 | Bacteria | 3828 |
| 73 | Ga0157370_10132386 | 3300013104 | Bacteria | 2325 |
| 74 | Ga0182008_10000939 | 3300014497 | Bacteria | 20309 |
| 75 | Ga0182008_10005276 | 3300014497 | Bacteria | 7387 |
| 76 | Ga0182008_10035887 | 3300014497 | Bacteria | 2482 |
| 77 | Ga0182006_1029851 | 3300015261 | Bacteria | 2207 |
| 78 | Ga0182006_1080316 | 3300015261 | Bacteria | 1191 |
| 79 | Ga0182007_10000118 | 3300015262 | Bacteria | 54536 |
| 80 | Ga0182005_1000268 | 3300015265 | Bacteria | 32952 |
| 81 | Ga0163161_10003167 | 3300017792 | Bacteria | 11607 |
| 82 | Ga0163161_10338837 | 3300017792 | Bacteria | 1192 |
| 83 | Ga0163161_10642986 | 3300017792 | Bacteria | 878 |
| 84 | Ga0213876_10004731 | 3300021384 | Bacteria | 7568 |
| 85 | Ga0213875_10000457 | 3300021388 | Bacteria | 35351 |
| 86 | Ga0213875_10017778 | 3300021388 | Bacteria | 3431 |
| 87 | Ga0228598_1038793 | 3300024227 | Bacteria | 940 |
| 88 | Ga0209565_1000023 | 3300025263 | Bacteria | 388244 |
| 89 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 90 | Ga0209130_1008001 | 3300025284 | Bacteria | 3179 |
| 91 | Ga0209675_1000016 | 3300025291 | Bacteria | 391965 |
| 92 | Ga0209676_1000160 | 3300025292 | Bacteria | 161069 |
| 93 | Ga0209676_1000796 | 3300025292 | Bacteria | 41705 |
| 94 | Ga0209025_1045473 | 3300025294 | Bacteria | 1819 |
| 95 | Ga0209564_1000194 | 3300025295 | Bacteria | 141518 |
| 96 | Ga0209050_1000462 | 3300025298 | Bacteria | 72638 |
| 97 | Ga0209050_1000971 | 3300025298 | Bacteria | 36685 |
| 98 | Ga0209256_1002520 | 3300025299 | Bacteria | 14713 |
| 99 | Ga0209051_1001229 | 3300025303 | Bacteria | 23028 |
| 100 | Ga0209257_1000177 | 3300025304 | Bacteria | 161069 |
| 101 | Ga0209257_1002904 | 3300025304 | Bacteria | 15851 |
| 102 | Ga0209257_1003668 | 3300025304 | Bacteria | 12861 |
| 103 | Ga0207655_1063274 | 3300025728 | Bacteria | 1418 |
| 104 | Ga0207713_1007274 | 3300025735 | Bacteria | 6567 |
| 105 | Ga0207699_10031462 | 3300025906 | Bacteria | 2979 |
| 106 | Ga0207684_10027667 | 3300025910 | Bacteria | 4829 |
| 107 | Ga0207684_10281519 | 3300025910 | Bacteria | 1434 |
| 108 | Ga0207693_10005261 | 3300025915 | Bacteria | 10831 |
| 109 | Ga0207693_10006242 | 3300025915 | Bacteria | 9882 |
| 110 | Ga0207663_10104318 | 3300025916 | Bacteria | 1911 |
| 111 | Ga0207646_10000480 | 3300025922 | Bacteria | 53452 |
| 112 | Ga0207646_10007712 | 3300025922 | Bacteria | 10895 |
| 113 | Ga0207681_10448663 | 3300025923 | Bacteria | 1049 |
| 114 | Ga0207687_10304620 | 3300025927 | Unclassified | 1284 |
| 115 | Ga0207700_10087875 | 3300025928 | Bacteria | 2445 |
| 116 | Ga0207700_10160200 | 3300025928 | Bacteria | 1868 |
| 117 | Ga0207700_10209418 | 3300025928 | Bacteria | 1647 |
| 118 | Ga0207664_10815818 | 3300025929 | Bacteria | 839 |
| 119 | Ga0207665_10040860 | 3300025939 | Bacteria | 3095 |
| 120 | Ga0207667_10015205 | 3300025949 | Bacteria | 8750 |
| 121 | Ga0207667_10810033 | 3300025949 | Bacteria | 933 |
| 122 | Ga0207702_10236599 | 3300026078 | Bacteria | 1709 |
| 123 | Ga0207702_10365885 | 3300026078 | Bacteria | 1383 |
| 124 | Ga0268265_10838556 | 3300028380 | Bacteria | 899 |
| 125 | Ga0307515_10000029 | 3300028794 | Bacteria | 365410 |
| 126 | Ga0316176_1181826 | 3300030732 | Bacteria | 2554 |
| 127 | Ga0316183_1130037 | 3300030742 | Bacteria | 13426 |
| 128 | Ga0316181_1026451 | 3300030744 | Bacteria | 1518 |
| 129 | Ga0307513_10000338 | 3300031456 | Bacteria | 67781 |
| 130 | Ga0307408_100040803 | 3300031548 | Bacteria | 3288 |
| 131 | Ga0316577_10117824 | 3300031733 | Bacteria | 1492 |
| 132 | Ga0307410_10459842 | 3300031852 | Bacteria | 1040 |
| 133 | Ga0307407_10098288 | 3300031903 | Bacteria | 1811 |
| 134 | Ga0307412_10035695 | 3300031911 | Bacteria | 3179 |
| 135 | Ga0307414_10004775 | 3300032004 | Bacteria | 7396 |
| 136 | Ga0307414_10097544 | 3300032004 | Bacteria | 2202 |
| 137 | Ga0307414_10277454 | 3300032004 | Bacteria | 1407 |
| 138 | Ga0307415_100030395 | 3300032126 | Bacteria | 3467 |
| 139 | Ga0373944_0003297 | 3300035089 | Bacteria | 4158 |
| 140 | Ga0373945_0003458 | 3300035116 | Bacteria | 4967 |
| 141 | Ga0373945_0194229 | 3300035116 | Bacteria | 840 |
| 142 | Ga0373943_0002924 | 3300035170 | Bacteria | 7752 |
| 143 | Ga0373943_0005650 | 3300035170 | Bacteria | 5612 |
| 144 | Ga0373946_0004266 | 3300035171 | Bacteria | 5109 |
| 145 | Ga0373946_0141821 | 3300035171 | Bacteria | 1114 |
| 146 | Ga0373924_0027642 | 3300035410 | Bacteria | 2257 |
| 147 | Ga0373935_0025025 | 3300035692 | Bacteria | 3677 |
| 148 | Ga0373935_0067442 | 3300035692 | Bacteria | 2300 |
| 149 | Ga0373935_0069768 | 3300035692 | Bacteria | 2264 |
| 150 | Ga0373927_0004334 | 3300035695 | Bacteria | 9949 |
| 151 | Ga0373927_0061170 | 3300035695 | Bacteria | 2436 |
| 152 | Ga0373947_0003204 | 3300035725 | Bacteria | 9710 |
| 153 | Ga0373947_0068357 | 3300035725 | Bacteria | 2172 |
| 154 | Ga0373925_0001534 | 3300037068 | Bacteria | 19696 |
| 155 | Ga0373925_0031429 | 3300037068 | Bacteria | 3901 |
| 156 | Ga0373925_0276328 | 3300037068 | Bacteria | 1352 |
| 157 | Ga0373925_0382296 | 3300037068 | Bacteria | 1146 |
| 158 | Ga0436364_0108904 | 3300037853 | Bacteria | 3539 |
| 159 | Ga0436364_0617280 | 3300037853 | Bacteria | 2682 |
| 160 | Ga0436364_0668201 | 3300037853 | Bacteria | 105492 |
| 161 | Ga0436364_0791322 | 3300037853 | Bacteria | 2022 |
| 162 | Ga0400485_17705 | 3300038735 | Bacteria | 1624 |
| 163 | Ga0400488_06025 | 3300038741 | Bacteria | 1519 |
| 164 | Ga0400486_05459 | 3300038742 | Bacteria | 1628 |
| 165 | Ga0400486_21231 | 3300038742 | Bacteria | 1934 |
| 166 | Ga0436365_0678522 | 3300039437 | Bacteria | 2093 |
| 167 | Ga0436365_0985147 | 3300039437 | Bacteria | 2552 |
| 168 | Ga0436365_1054176 | 3300039437 | Bacteria | 4982 |
| 169 | Ga0436365_1161976 | 3300039437 | Bacteria | 1177 |
| 170 | Ga0436360_0027689 | 3300039438 | Bacteria | 937 |
| 171 | Ga0436360_0988855 | 3300039438 | Bacteria | 1333 |
| 172 | Ga0436361_0941361 | 3300039447 | Bacteria | 1941 |
| 173 | Ga0436363_0481764 | 3300039450 | Bacteria | 837 |
| 174 | Ga0436362_0364089 | 3300039453 | Bacteria | 1207 |
| 175 | Ga0436362_0524017 | 3300039453 | Bacteria | 1313 |
| 176 | Ga0439466_0126711 | 3300041411 | Bacteria | 787 |
| 177 | Ga0439432_013954 | 3300042006 | Bacteria | 2723 |
| 178 | Ga0439432_032073 | 3300042006 | Bacteria | 1696 |
| 179 | Ga0450920_013967 | 3300042122 | Bacteria | 1515 |
| 180 | Ga0450906_002334 | 3300042145 | Bacteria | 4158 |
| 181 | Ga0451577_0086675 | 3300042876 | Bacteria | 2793 |
| 182 | Ga0466961_0095360 | 3300044693 | Bacteria | 1876 |
| 183 | Ga0466963_0338602 | 3300044694 | Bacteria | 1059 |
| 184 | Ga0453684_0000491 | 3300044712 | Bacteria | 155597 |
| 185 | Ga0453684_0087871 | 3300044712 | Bacteria | 3851 |
| 186 | Ga0453684_0089184 | 3300044712 | Bacteria | 3815 |
| 187 | Ga0453684_0205216 | 3300044712 | Bacteria | 2294 |
| 188 | Ga0453684_0484066 | 3300044712 | Bacteria | 1372 |
| 189 | Ga0453684_1178307 | 3300044712 | Bacteria | 805 |
| 190 | Ga0466968_0025443 | 3300044735 | Bacteria | 2424 |
| 191 | Ga0466959_0205918 | 3300045049 | Bacteria | 1368 |
| 192 | Ga0495627_010541 | 3300046453 | Bacteria | 3355 |
| 193 | Ga0495627_043807 | 3300046453 | Bacteria | 1367 |
| 194 | Ga0495592_0342109 | 3300046454 | Bacteria | 961 |
| 195 | Ga0495629_0052547 | 3300046459 | Bacteria | 2852 |
| 196 | Ga0495638_0001816 | 3300046460 | Bacteria | 18521 |
| 197 | Ga0495638_0212303 | 3300046460 | Bacteria | 1086 |
| 198 | Ga0495653_0122923 | 3300046463 | Bacteria | 1846 |
| 199 | Ga0495580_0036879 | 3300046472 | Bacteria | 3510 |
| 200 | Ga0495580_0363346 | 3300046472 | Bacteria | 979 |
| 201 | Ga0495639_0008977 | 3300046475 | Bacteria | 4286 |
| 202 | Ga0495662_0009203 | 3300046476 | Bacteria | 4846 |
| 203 | Ga0495664_0000368 | 3300046477 | Bacteria | 21935 |
| 204 | Ga0495606_0075725 | 3300046507 | Bacteria | 2105 |
| 205 | Ga0495610_0004633 | 3300046512 | Bacteria | 10063 |
| 206 | Ga0495618_0065617 | 3300046514 | Bacteria | 2307 |
| 207 | Ga0495618_0107837 | 3300046514 | Bacteria | 1783 |
| 208 | Ga0495630_0005854 | 3300046517 | Bacteria | 8691 |
| 209 | Ga0495630_0044349 | 3300046517 | Bacteria | 3323 |
| 210 | Ga0495631_0004728 | 3300046518 | Bacteria | 7196 |
| 211 | Ga0495643_0001888 | 3300046522 | Bacteria | 17752 |
| 212 | Ga0495663_0001965 | 3300046525 | Bacteria | 6324 |
| 213 | Ga0495663_0012109 | 3300046525 | Bacteria | 2404 |
| 214 | Ga0495663_0018522 | 3300046525 | Bacteria | 1983 |
| 215 | Ga0495666_0007768 | 3300046526 | Bacteria | 5369 |
| 216 | Ga0495652_0051616 | 3300046529 | Bacteria | 3511 |
| 217 | Ga0495665_0033227 | 3300046531 | Bacteria | 2759 |
| 218 | Ga0495665_0063741 | 3300046531 | Bacteria | 1945 |
| 219 | Ga0495640_0134538 | 3300046533 | Bacteria | 1597 |
| 220 | Ga0495586_0016181 | 3300046535 | Bacteria | 3968 |
| 221 | Ga0495587_0252457 | 3300046536 | Bacteria | 991 |
| 222 | Ga0495645_0003956 | 3300046543 | Bacteria | 10105 |
| 223 | Ga0495633_0005058 | 3300046558 | Bacteria | 8213 |
| 224 | Ga0495633_0099451 | 3300046558 | Bacteria | 1350 |
| 225 | Ga0495634_0017172 | 3300046642 | Bacteria | 5168 |
| 226 | Ga0495634_0046520 | 3300046642 | Bacteria | 2927 |
| 227 | Ga0495625_0072743 | 3300046660 | Bacteria | 2411 |
| 228 | Ga0495625_0347336 | 3300046660 | Bacteria | 938 |
| 229 | Ga0495635_0002253 | 3300046663 | Bacteria | 13109 |
| 230 | Ga0495635_0045844 | 3300046663 | Bacteria | 3016 |
| 231 | Ga0495588_0219115 | 3300046674 | Bacteria | 1005 |
| 232 | Ga0495646_0184636 | 3300046680 | Bacteria | 1143 |
| 233 | Ga0495658_0039666 | 3300046683 | Bacteria | 2614 |
| 234 | Ga0495613_0226883 | 3300046689 | Bacteria | 1310 |
| 235 | Ga0495624_0003817 | 3300046690 | Bacteria | 11139 |
| 236 | Ga0495624_0043580 | 3300046690 | Bacteria | 2862 |
| 237 | Ga0495581_0036034 | 3300047315 | Bacteria | 2862 |
| 238 | Ga0495581_0291807 | 3300047315 | Bacteria | 953 |
| 239 | Ga0495674_0014649 | 3300047319 | Bacteria | 7337 |
| 240 | Ga0495672_0005001 | 3300047320 | Bacteria | 10610 |
| 241 | Ga0495672_0119178 | 3300047320 | Bacteria | 1405 |
| 242 | Ga0495676_0009716 | 3300047321 | Bacteria | 8747 |
| 243 | Ga0495676_0605287 | 3300047321 | Bacteria | 713 |
| 244 | Ga0495684_0005917 | 3300047471 | Bacteria | 9505 |
| 245 | Ga0495684_0006398 | 3300047471 | Bacteria | 9143 |
| 246 | Ga0495684_0015023 | 3300047471 | Bacteria | 5962 |
| 247 | Ga0495686_0007978 | 3300047472 | Bacteria | 7850 |
| 248 | Ga0495614_0013427 | 3300048089 | Bacteria | 3593 |
| 249 | Ga0496104_0727055 | 3300048907 | Bacteria | 900 |
| 250 | Ga0496111_0200096 | 3300048914 | Bacteria | 1485 |
| 251 | Ga0496111_0727690 | 3300048914 | Bacteria | 721 |
| 252 | Ga0496113_0435042 | 3300048916 | Bacteria | 1054 |
| 253 | Ga0496116_0104447 | 3300048919 | Bacteria | 1683 |
| 254 | Ga0496116_0194370 | 3300048919 | Bacteria | 1070 |
| 255 | Ga0496117_0000854 | 3300048920 | Bacteria | 47114 |
| 256 | Ga0496117_0001593 | 3300048920 | Bacteria | 32105 |
| 257 | Ga0496117_0013796 | 3300048920 | Bacteria | 7017 |
| 258 | Ga0496117_0075823 | 3300048920 | Bacteria | 2232 |
| 259 | Ga0496117_0131480 | 3300048920 | Bacteria | 1516 |
| 260 | Ga0496117_0235777 | 3300048920 | Bacteria | 1008 |
| 261 | Ga0496118_0000383 | 3300048921 | Bacteria | 74507 |
| 262 | Ga0496118_0015687 | 3300048921 | Bacteria | 6996 |
| 263 | Ga0496118_0032770 | 3300048921 | Bacteria | 4272 |
| 264 | Ga0496118_0100706 | 3300048921 | Bacteria | 1953 |
| 265 | Ga0496118_0125193 | 3300048921 | Bacteria | 1665 |
| 266 | Ga0496118_0390614 | 3300048921 | Bacteria | 726 |
| 267 | Ga0496119_0000069 | 3300048922 | Bacteria | 155265 |
| 268 | Ga0496120_0000884 | 3300048923 | Bacteria | 42219 |
| 269 | Ga0496121_0030576 | 3300048924 | Bacteria | 4943 |
| 270 | Ga0496121_0038879 | 3300048924 | Bacteria | 4203 |
| 271 | Ga0496121_0129197 | 3300048924 | Bacteria | 1894 |
| 272 | Ga0496122_0000710 | 3300048925 | Bacteria | 65728 |
| 273 | Ga0496122_0007903 | 3300048925 | Bacteria | 11665 |
| 274 | Ga0496122_0033449 | 3300048925 | Bacteria | 4228 |
| 275 | Ga0496122_0072978 | 3300048925 | Bacteria | 2436 |
| 276 | Ga0496122_0129822 | 3300048925 | Bacteria | 1604 |
| 277 | Ga0496123_0000104 | 3300048926 | Bacteria | 168230 |
| 278 | Ga0496123_0040933 | 3300048926 | Bacteria | 3219 |
| 279 | Ga0496123_0049439 | 3300048926 | Bacteria | 2819 |
| 280 | Ga0496123_0060671 | 3300048926 | Bacteria | 2436 |
| 281 | Ga0496123_0080303 | 3300048926 | Bacteria | 1988 |
| 282 | Ga0496124_0000516 | 3300048927 | Bacteria | 66627 |
| 283 | Ga0496124_0002024 | 3300048927 | Bacteria | 27560 |
| 284 | Ga0496124_0007141 | 3300048927 | Bacteria | 11957 |
| 285 | Ga0496124_0020862 | 3300048927 | Bacteria | 6044 |
| 286 | Ga0496124_0036037 | 3300048927 | Bacteria | 4320 |
| 287 | Ga0496124_0104787 | 3300048927 | Bacteria | 2286 |
| 288 | Ga0496124_0107000 | 3300048927 | Bacteria | 2257 |
| 289 | Ga0496124_0140593 | 3300048927 | Bacteria | 1905 |
| 290 | Ga0496124_0240791 | 3300048927 | Bacteria | 1345 |
| 291 | Ga0496125_0001475 | 3300048928 | Bacteria | 34001 |
| 292 | Ga0496125_0009350 | 3300048928 | Bacteria | 10097 |
| 293 | Ga0496125_0019578 | 3300048928 | Bacteria | 6377 |
| 294 | Ga0496125_0025527 | 3300048928 | Bacteria | 5408 |
| 295 | Ga0496125_0050641 | 3300048928 | Bacteria | 3436 |
| 296 | Ga0496125_0060790 | 3300048928 | Bacteria | 3034 |
| 297 | Ga0496125_0209980 | 3300048928 | Bacteria | 1265 |
| 298 | Ga0496126_0000913 | 3300048929 | Bacteria | 51086 |
| 299 | Ga0501034_0013976 | 3300049571 | Bacteria | 8263 |
| 300 | Ga0501046_0156392 | 3300049580 | Bacteria | 1717 |
| 301 | Ga0501047_0121470 | 3300049581 | Bacteria | 2494 |
| 302 | Ga0501047_0236868 | 3300049581 | Bacteria | 1677 |
| 303 | Ga0501070_0103409 | 3300049586 | Bacteria | 2356 |
| 304 | Ga0501072_0181503 | 3300049588 | Bacteria | 1679 |
| 305 | Ga0501073_0007663 | 3300049589 | Bacteria | 8011 |
| 306 | Ga0501079_0389758 | 3300049741 | Bacteria | 1092 |
| 307 | Ga0501080_0016301 | 3300049742 | Bacteria | 6860 |
| 308 | Ga0501081_0072157 | 3300049743 | Bacteria | 2407 |
| 309 | Ga0501045_0284134 | 3300049824 | Bacteria | 1232 |
| 310 | nmdc:mga00v17_135060_c1 | 3300050491 | Bacteria | 1579 |
| 311 | nmdc:mga00v17_140343_c1 | 3300050491 | Bacteria | 1050 |
| 312 | nmdc:mga00v17_149026_c1 | 3300050491 | Bacteria | 1503 |
| 313 | nmdc:mga00v17_214897_c1 | 3300050491 | Bacteria | 1245 |
| 314 | nmdc:mga00v17_217545_c1 | 3300050491 | Bacteria | 1237 |
| 315 | nmdc:mga00v17_245295_c1 | 3300050491 | Bacteria | 1162 |
| 316 | nmdc:mga00v17_269644_c1 | 3300050491 | Bacteria | 1105 |
| 317 | nmdc:mga00v17_497200_c1 | 3300050491 | Bacteria | 791 |
| 318 | nmdc:mga00v17_509453_c1 | 3300050491 | Bacteria | 780 |
| 319 | nmdc:mga05p37_187166_c1 | 3300050507 | Bacteria | 2517 |
| 320 | nmdc:mga0n895_152325_c1 | 3300050512 | Bacteria | 2343 |
| 321 | nmdc:mga08x19_247696_c1 | 3300050514 | Bacteria | 1230 |
| 322 | Ga0495601_0002326 | 3300053077 | Bacteria | 10747 |
| 323 | Ga0495612_0001393 | 3300053078 | Bacteria | 9976 |
| 324 | Ga0495619_0013296 | 3300053085 | Bacteria | 5185 |
| 325 | Ga0500641_0050491 | 3300053096 | Bacteria | 1709 |
| 326 | Ga0500555_053609 | 3300053103 | Bacteria | 1098 |
| 327 | Ga0500569_124397 | 3300053109 | Bacteria | 860 |
| 328 | Ga0501082_0075807 | 3300060353 | Bacteria | 2898 |
| 329 | 2511185798 | 2510917028 | Bacteria | 6185411 |
| 330 | 2513996422 | 2513237159 | Bacteria | 6810126 |
| 331 | 2578457150 | 2576861471 | Bacteria | 4648976 |
| 332 | 2842759129 | 2842757796 | Bacteria | 3981385 |
| 333 | 2852652292 | 2852649853 | Bacteria | 4036942 |
| 334 | 2857446798 | 2857442823 | Bacteria | 4562550 |
| 335 | 2919676369 | 2919675420 | Bacteria | 3969095 |
| 336 | 2929297984 | 2929297113 | Bacteria | 3141306 |
| 337 | 2939589658 | 2939589442 | Bacteria | 4214238 |
| 338 | 2939624271 | 2939622612 | Bacteria | 4698046 |
| 339 | 2941478909 | 2941475908 | Bacteria | 4145589 |
| 340 | 2974307787 | 2974307012 | Bacteria | 4172388 |
| 341 | 2977248506 | 2977247770 | Bacteria | 4160543 |
| 342 | 2984517007 | 2984514374 | Bacteria | 4172479 |
| 343 | 2987608612 | 2987605356 | Bacteria | 4187822 |
| 344 | Ga0373926_0020060 | |||
| 345 | Ga0055526_1009693 | |||
| 346 | Ga0055537_1000949 | |||
| 347 | Ga0055536_1001527 | |||
| 348 | Ga0055536_1004059 | |||
| 349 | Ga0055534_1000121 | |||
| 350 | Ga0055528_1000148 | |||
| 351 | Ga0055530_10000618 | |||
| 352 | Ga0055530_10003074 | |||
| 353 | Ga0055540_1043079 | |||
| 354 | Ga0055531_10002056 | |||
| 355 | Ga0055531_10006302 | |||
| 356 | Ga0055531_10015474 | |||
| 357 | Ga0070683_100410165 | |||
| 358 | Ga0070669_100722982 | |||
| 359 | Ga0070675_100206630 | |||
| 360 | Ga0070688_100155318 | |||
| 361 | Ga0070667_100811482 | |||
| 362 | Ga0070709_10253229 | |||
| 363 | Ga0070714_100126501 | |||
| 364 | Ga0070713_100014543 | |||
| 365 | Ga0070713_100195355 | |||
| 366 | Ga0070713_101015234 | |||
| 367 | Ga0070710_10013551 | |||
| 368 | Ga0070711_100164174 | |||
| 369 | Ga0070711_100253397 | |||
| 370 | Ga0070711_100371684 | |||
| 371 | Ga0070708_100033143 | |||
| 372 | Ga0070708_100063184 | |||
| 373 | Ga0070706_100081098 | |||
| 374 | Ga0070707_100000456 | |||
| 375 | Ga0070707_100056105 | |||
| 376 | Ga0070698_100216665 | |||
| 377 | Ga0070698_100410156 | |||
| 378 | Ga0070699_100081107 | |||
| 379 | Ga0070699_100834643 | |||
| 380 | Ga0070684_100595297 | |||
| 381 | Ga0070697_100114908 | |||
| 382 | Ga0070697_100254662 | |||
| 383 | Ga0070696_100334419 | |||
| 384 | Ga0070665_100155537 | |||
| 385 | Ga0068855_100003294 | |||
| 386 | Ga0068855_100801791 | |||
| 387 | Ga0068859_101597539 | |||
| 388 | Ga0068864_100734028 | |||
| 389 | Ga0070717_10431218 | |||
| 390 | Ga0070717_10659536 | |||
| 391 | Ga0075363_100012296 | |||
| 392 | Ga0075364_10039559 | |||
| 393 | Ga0075364_10083963 | |||
| 394 | Ga0075364_10310020 | |||
| 395 | Ga0075364_10397380 | |||
| 396 | Ga0075364_10515490 | |||
| 397 | Ga0075364_10542023 | |||
| 398 | Ga0070716_100181600 | |||
| 399 | Ga0070712_100027947 | |||
| 400 | Ga0070712_100030211 | |||
| 401 | Ga0070712_100094526 | |||
| 402 | Ga0075367_10204740 | |||
| 403 | Ga0075433_10176041 | |||
| 404 | Ga0075434_100371826 | |||
| 405 | Ga0075436_100102613 | |||
| 406 | Ga0097620_101597096 | |||
| 407 | Ga0105251_10005717 | |||
| 408 | Ga0105240_10012339 | |||
| 409 | Ga0105245_10434292 | |||
| 410 | Ga0157345_1009572 | |||
| 411 | Ga0157373_10189724 | |||
| 412 | Ga0157373_10208196 | |||
| 413 | Ga0157371_10000184 | |||
| 414 | Ga0157371_10211388 | |||
| 415 | Ga0157370_10054057 | |||
| 416 | Ga0157370_10132386 | |||
| 417 | Ga0182008_10000939 | |||
| 418 | Ga0182008_10005276 | |||
| 419 | Ga0182008_10035887 | |||
| 420 | Ga0182006_1029851 | |||
| 421 | Ga0182006_1080316 | |||
| 422 | Ga0182007_10000118 | |||
| 423 | Ga0182005_1000268 | |||
| 424 | Ga0163161_10003167 | |||
| 425 | Ga0163161_10338837 | |||
| 426 | Ga0163161_10642986 | |||
| 427 | Ga0213876_10004731 | |||
| 428 | Ga0213875_10000457 | |||
| 429 | Ga0213875_10017778 | |||
| 430 | Ga0228598_1038793 | |||
| 431 | Ga0209565_1000023 | |||
| 432 | Ga0209673_1000047 | |||
| 433 | Ga0209130_1008001 | |||
| 434 | Ga0209675_1000016 | |||
| 435 | Ga0209676_1000160 | |||
| 436 | Ga0209676_1000796 | |||
| 437 | Ga0209025_1045473 | |||
| 438 | Ga0209564_1000194 | |||
| 439 | Ga0209050_1000462 | |||
| 440 | Ga0209050_1000971 | |||
| 441 | Ga0209256_1002520 | |||
| 442 | Ga0209051_1001229 | |||
| 443 | Ga0209257_1000177 | |||
| 444 | Ga0209257_1002904 | |||
| 445 | Ga0209257_1003668 | |||
| 446 | Ga0207655_1063274 | |||
| 447 | Ga0207713_1007274 | |||
| 448 | Ga0207699_10031462 | |||
| 449 | Ga0207684_10027667 | |||
| 450 | Ga0207684_10281519 | |||
| 451 | Ga0207693_10005261 | |||
| 452 | Ga0207693_10006242 | |||
| 453 | Ga0207663_10104318 | |||
| 454 | Ga0207646_10000480 | |||
| 455 | Ga0207646_10007712 | |||
| 456 | Ga0207681_10448663 | |||
| 457 | Ga0207687_10304620 | |||
| 458 | Ga0207700_10087875 | |||
| 459 | Ga0207700_10160200 | |||
| 460 | Ga0207700_10209418 | |||
| 461 | Ga0207664_10815818 | |||
| 462 | Ga0207665_10040860 | |||
| 463 | Ga0207667_10015205 | |||
| 464 | Ga0207667_10810033 | |||
| 465 | Ga0207702_10236599 | |||
| 466 | Ga0207702_10365885 | |||
| 467 | Ga0268265_10838556 | |||
| 468 | Ga0307515_10000029 | |||
| 469 | Ga0316176_1181826 | |||
| 470 | Ga0316183_1130037 | |||
| 471 | Ga0316181_1026451 | |||
| 472 | Ga0307513_10000338 | |||
| 473 | Ga0307408_100040803 | |||
| 474 | Ga0316577_10117824 | |||
| 475 | Ga0307410_10459842 | |||
| 476 | Ga0307407_10098288 | |||
| 477 | Ga0307412_10035695 | |||
| 478 | Ga0307414_10004775 | |||
| 479 | Ga0307414_10097544 | |||
| 480 | Ga0307414_10277454 | |||
| 481 | Ga0307415_100030395 | |||
| 482 | Ga0373944_0003297 | |||
| 483 | Ga0373945_0003458 | |||
| 484 | Ga0373945_0194229 | |||
| 485 | Ga0373943_0002924 | |||
| 486 | Ga0373943_0005650 | |||
| 487 | Ga0373946_0004266 | |||
| 488 | Ga0373946_0141821 | |||
| 489 | Ga0373924_0027642 | |||
| 490 | Ga0373935_0025025 | |||
| 491 | Ga0373935_0067442 | |||
| 492 | Ga0373935_0069768 | |||
| 493 | Ga0373927_0004334 | |||
| 494 | Ga0373927_0061170 | |||
| 495 | Ga0373947_0003204 | |||
| 496 | Ga0373947_0068357 | |||
| 497 | Ga0373925_0001534 | |||
| 498 | Ga0373925_0031429 | |||
| 499 | Ga0373925_0276328 | |||
| 500 | Ga0373925_0382296 | |||
| 501 | Ga0436364_0108904 | |||
| 502 | Ga0436364_0617280 | |||
| 503 | Ga0436364_0668201 | |||
| 504 | Ga0436364_0791322 | |||
| 505 | Ga0400485_17705 | |||
| 506 | Ga0400488_06025 | |||
| 507 | Ga0400486_05459 | |||
| 508 | Ga0400486_21231 | |||
| 509 | Ga0436365_0678522 | |||
| 510 | Ga0436365_0985147 | |||
| 511 | Ga0436365_1054176 | |||
| 512 | Ga0436365_1161976 | |||
| 513 | Ga0436360_0027689 | |||
| 514 | Ga0436360_0988855 | |||
| 515 | Ga0436361_0941361 | |||
| 516 | Ga0436363_0481764 | |||
| 517 | Ga0436362_0364089 | |||
| 518 | Ga0436362_0524017 | |||
| 519 | Ga0439466_0126711 | |||
| 520 | Ga0439432_013954 | |||
| 521 | Ga0439432_032073 | |||
| 522 | Ga0450920_013967 | |||
| 523 | Ga0450906_002334 | |||
| 524 | Ga0451577_0086675 | |||
| 525 | Ga0466961_0095360 | |||
| 526 | Ga0466963_0338602 | |||
| 527 | Ga0453684_0000491 | |||
| 528 | Ga0453684_0087871 | |||
| 529 | Ga0453684_0089184 | |||
| 530 | Ga0453684_0205216 | |||
| 531 | Ga0453684_0484066 | |||
| 532 | Ga0453684_1178307 | |||
| 533 | Ga0466968_0025443 | |||
| 534 | Ga0466959_0205918 | |||
| 535 | Ga0495627_010541 | |||
| 536 | Ga0495627_043807 | |||
| 537 | Ga0495592_0342109 | |||
| 538 | Ga0495629_0052547 | |||
| 539 | Ga0495638_0001816 | |||
| 540 | Ga0495638_0212303 | |||
| 541 | Ga0495653_0122923 | |||
| 542 | Ga0495580_0036879 | |||
| 543 | Ga0495580_0363346 | |||
| 544 | Ga0495639_0008977 | |||
| 545 | Ga0495662_0009203 | |||
| 546 | Ga0495664_0000368 | |||
| 547 | Ga0495606_0075725 | |||
| 548 | Ga0495610_0004633 | |||
| 549 | Ga0495618_0065617 | |||
| 550 | Ga0495618_0107837 | |||
| 551 | Ga0495630_0005854 | |||
| 552 | Ga0495630_0044349 | |||
| 553 | Ga0495631_0004728 | |||
| 554 | Ga0495643_0001888 | |||
| 555 | Ga0495663_0001965 | |||
| 556 | Ga0495663_0012109 | |||
| 557 | Ga0495663_0018522 | |||
| 558 | Ga0495666_0007768 | |||
| 559 | Ga0495652_0051616 | |||
| 560 | Ga0495665_0033227 | |||
| 561 | Ga0495665_0063741 | |||
| 562 | Ga0495640_0134538 | |||
| 563 | Ga0495586_0016181 | |||
| 564 | Ga0495587_0252457 | |||
| 565 | Ga0495645_0003956 | |||
| 566 | Ga0495633_0005058 | |||
| 567 | Ga0495633_0099451 | |||
| 568 | Ga0495634_0017172 | |||
| 569 | Ga0495634_0046520 | |||
| 570 | Ga0495625_0072743 | |||
| 571 | Ga0495625_0347336 | |||
| 572 | Ga0495635_0002253 | |||
| 573 | Ga0495635_0045844 | |||
| 574 | Ga0495588_0219115 | |||
| 575 | Ga0495646_0184636 | |||
| 576 | Ga0495658_0039666 | |||
| 577 | Ga0495613_0226883 | |||
| 578 | Ga0495624_0003817 | |||
| 579 | Ga0495624_0043580 | |||
| 580 | Ga0495581_0036034 | |||
| 581 | Ga0495581_0291807 | |||
| 582 | Ga0495674_0014649 | |||
| 583 | Ga0495672_0005001 | |||
| 584 | Ga0495672_0119178 | |||
| 585 | Ga0495676_0009716 | |||
| 586 | Ga0495676_0605287 | |||
| 587 | Ga0495684_0005917 | |||
| 588 | Ga0495684_0006398 | |||
| 589 | Ga0495684_0015023 | |||
| 590 | Ga0495686_0007978 | |||
| 591 | Ga0495614_0013427 | |||
| 592 | Ga0496104_0727055 | |||
| 593 | Ga0496111_0200096 | |||
| 594 | Ga0496111_0727690 | |||
| 595 | Ga0496113_0435042 | |||
| 596 | Ga0496116_0104447 | |||
| 597 | Ga0496116_0194370 | |||
| 598 | Ga0496117_0000854 | |||
| 599 | Ga0496117_0001593 | |||
| 600 | Ga0496117_0013796 | |||
| 601 | Ga0496117_0075823 | |||
| 602 | Ga0496117_0131480 | |||
| 603 | Ga0496117_0235777 | |||
| 604 | Ga0496118_0000383 | |||
| 605 | Ga0496118_0015687 | |||
| 606 | Ga0496118_0032770 | |||
| 607 | Ga0496118_0100706 | |||
| 608 | Ga0496118_0125193 | |||
| 609 | Ga0496118_0390614 | |||
| 610 | Ga0496119_0000069 | |||
| 611 | Ga0496120_0000884 | |||
| 612 | Ga0496121_0030576 | |||
| 613 | Ga0496121_0038879 | |||
| 614 | Ga0496121_0129197 | |||
| 615 | Ga0496122_0000710 | |||
| 616 | Ga0496122_0007903 | |||
| 617 | Ga0496122_0033449 | |||
| 618 | Ga0496122_0072978 | |||
| 619 | Ga0496122_0129822 | |||
| 620 | Ga0496123_0000104 | |||
| 621 | Ga0496123_0040933 | |||
| 622 | Ga0496123_0049439 | |||
| 623 | Ga0496123_0060671 | |||
| 624 | Ga0496123_0080303 | |||
| 625 | Ga0496124_0000516 | |||
| 626 | Ga0496124_0002024 | |||
| 627 | Ga0496124_0007141 | |||
| 628 | Ga0496124_0020862 | |||
| 629 | Ga0496124_0036037 | |||
| 630 | Ga0496124_0104787 | |||
| 631 | Ga0496124_0107000 | |||
| 632 | Ga0496124_0140593 | |||
| 633 | Ga0496124_0240791 | |||
| 634 | Ga0496125_0001475 | |||
| 635 | Ga0496125_0009350 | |||
| 636 | Ga0496125_0019578 | |||
| 637 | Ga0496125_0025527 | |||
| 638 | Ga0496125_0050641 | |||
| 639 | Ga0496125_0060790 | |||
| 640 | Ga0496125_0209980 | |||
| 641 | Ga0496126_0000913 | |||
| 642 | Ga0501034_0013976 | |||
| 643 | Ga0501046_0156392 | |||
| 644 | Ga0501047_0121470 | |||
| 645 | Ga0501047_0236868 | |||
| 646 | Ga0501070_0103409 | |||
| 647 | Ga0501072_0181503 | |||
| 648 | Ga0501073_0007663 | |||
| 649 | Ga0501079_0389758 | |||
| 650 | Ga0501080_0016301 | |||
| 651 | Ga0501081_0072157 | |||
| 652 | Ga0501045_0284134 | |||
| 653 | nmdc:mga00v17_135060_c1 | |||
| 654 | nmdc:mga00v17_140343_c1 | |||
| 655 | nmdc:mga00v17_149026_c1 | |||
| 656 | nmdc:mga00v17_214897_c1 | |||
| 657 | nmdc:mga00v17_217545_c1 | |||
| 658 | nmdc:mga00v17_245295_c1 | |||
| 659 | nmdc:mga00v17_269644_c1 | |||
| 660 | nmdc:mga00v17_497200_c1 | |||
| 661 | nmdc:mga00v17_509453_c1 | |||
| 662 | nmdc:mga05p37_187166_c1 | |||
| 663 | nmdc:mga0n895_152325_c1 | |||
| 664 | nmdc:mga08x19_247696_c1 | |||
| 665 | Ga0495601_0002326 | |||
| 666 | Ga0495612_0001393 | |||
| 667 | Ga0495619_0013296 | |||
| 668 | Ga0500641_0050491 | |||
| 669 | Ga0500555_053609 | |||
| 670 | Ga0500569_124397 | |||
| 671 | Ga0501082_0075807 | |||
| 672 | 2511185798 | |||
| 673 | 2513996422 | |||
| 674 | 2578457150 | |||
| 675 | 2842759129 | |||
| 676 | 2852652292 | |||
| 677 | 2857446798 | |||
| 678 | 2919676369 | |||
| 679 | 2929297984 | |||
| 680 | 2939589658 | |||
| 681 | 2939624271 | |||
| 682 | 2941478909 | |||
| 683 | 2974307787 | |||
| 684 | 2977248506 | |||
| 685 | 2984517007 | |||
| 686 | 2987608612 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.9391 | 9 | 209 |
| 2e5x-assembly1.cif.gz_A-2 | structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 | 0.9225 | 8 | 209 |
| 2q16-assembly1.cif.gz_B | structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp | 0.9157 | 9 | 209 |
| 3s86-assembly1.cif.gz_D | crystal structure of tm0159 with bound imp | 0.9095 | 8 | 209 |
| 3tqu-assembly2.cif.gz_D | structure of a ham1 protein from coxiella burnetii | 0.8856 | 8 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ztiA00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9272 | 8 | 209 | 3.90.950.10 |
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9204 | 6 | 209 | 3.90.950.10 |
| 3s86D00 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.9095 | 8 | 209 | 3.90.950.10 |
| af_Q4DRX4_9_195_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.904 | 1 | 207 | 3.90.950.10 |
| af_P52061_1_197_3.90.950.10 | Alpha Beta;Alpha-Beta Complex;Maf protein; | 0.8935 | 6 | 209 | 3.90.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A845MKD1-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9791 | 2 | 214 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0046872 GO:0047429 |
| AF-A0A1H6MZS1-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9783 | 1 | 211 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A5J6MSY5-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9773 | 2 | 213 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0016747 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A2E8YR09-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9752 | 2 | 214 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |
| AF-A0A2P6FR51-F1-model_v4 | dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) | 0.9735 | 1 | 213 |
GO:0000166
GO:0005829 GO:0009117 GO:0009146 GO:0017111 GO:0035870 GO:0036220 GO:0036222 GO:0046872 |