F415653

General Info

Members Datasets Scaffolds Average Seq Length
343 211 686 207

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0020060|Ga0373926_0020060_208_924
Length 238
Sequence MAKSGVGTRIVDGDLADNRSDHPPTFAHRHLNSDRLAIATHNPGKLAEMRELVAPYGIAAISVGELGLVEPDESGMTFCENAHIKAEAAAKGAGLPALADDSGLVVDALDGAPGIHSARWAGADRNFRRAMEMIEQQLRTRGATTAERRRAQFVSALCLAWPDGHVEQFEARVAGTLLWPPRGDRGFGYDPMFLPDGEQRTFGEMSSEEKRGLPPHGRGLSHRARAFMKLAEACLDRR

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
85 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
86 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
106 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
107 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
112 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
115 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
116 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
195 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
198 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
199 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
200 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
201 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
202 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
203 2919675420 Luteimonas terrae 4099 Isolate Unclassified
204 2929297113 Heliophilum fasciatum MTM Isolate Rhizosphere
205 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
206 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
207 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
208 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
209 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
210 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
211 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.63
Metatranscriptomes 0
Isolates 4.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 13.7
Nodule 0.29
Rhizoplane 1.17
Rhizosphere 64.14
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0020060 3300035083 Bacteria 2307
2 Ga0055526_1009693 3300003771 Bacteria 4591
3 Ga0055537_1000949 3300003773 Bacteria 13424
4 Ga0055536_1001527 3300003781 Bacteria 13876
5 Ga0055536_1004059 3300003781 Bacteria 7621
6 Ga0055534_1000121 3300003784 Bacteria 57849
7 Ga0055528_1000148 3300003790 Bacteria 57842
8 Ga0055530_10000618 3300003791 Bacteria 30889
9 Ga0055530_10003074 3300003791 Bacteria 9922
10 Ga0055540_1043079 3300003792 Bacteria 964
11 Ga0055531_10002056 3300003794 Bacteria 13876
12 Ga0055531_10006302 3300003794 Bacteria 6759
13 Ga0055531_10015474 3300003794 Bacteria 3358
14 Ga0070683_100410165 3300005329 Bacteria 1292
15 Ga0070669_100722982 3300005353 Bacteria 842
16 Ga0070675_100206630 3300005354 Bacteria 1706
17 Ga0070688_100155318 3300005365 Bacteria 1567
18 Ga0070667_100811482 3300005367 Bacteria 869
19 Ga0070709_10253229 3300005434 Bacteria 1269
20 Ga0070714_100126501 3300005435 Bacteria 2279
21 Ga0070713_100014543 3300005436 Bacteria 5851
22 Ga0070713_100195355 3300005436 Bacteria 1825
23 Ga0070713_101015234 3300005436 Bacteria 800
24 Ga0070710_10013551 3300005437 Bacteria 4086
25 Ga0070711_100164174 3300005439 Bacteria 1686
26 Ga0070711_100253397 3300005439 Bacteria 1382
27 Ga0070711_100371684 3300005439 Bacteria 1154
28 Ga0070708_100033143 3300005445 Bacteria 4487
29 Ga0070708_100063184 3300005445 Bacteria 3313
30 Ga0070706_100081098 3300005467 Bacteria 3004
31 Ga0070707_100000456 3300005468 Bacteria 40527
32 Ga0070707_100056105 3300005468 Bacteria 3777
33 Ga0070698_100216665 3300005471 Bacteria 1848
34 Ga0070698_100410156 3300005471 Bacteria 1289
35 Ga0070699_100081107 3300005518 Bacteria 2828
36 Ga0070699_100834643 3300005518 Bacteria 844
37 Ga0070684_100595297 3300005535 Bacteria 1028
38 Ga0070697_100114908 3300005536 Bacteria 2247
39 Ga0070697_100254662 3300005536 Bacteria 1502
40 Ga0070696_100334419 3300005546 Bacteria 1169
41 Ga0070665_100155537 3300005548 Bacteria 2288
42 Ga0068855_100003294 3300005563 Bacteria 19777
43 Ga0068855_100801791 3300005563 Bacteria 1001
44 Ga0068859_101597539 3300005617 Bacteria 720
45 Ga0068864_100734028 3300005618 Bacteria 967
46 Ga0070717_10431218 3300006028 Bacteria 1186
47 Ga0070717_10659536 3300006028 Bacteria 950
48 Ga0075363_100012296 3300006048 Bacteria 4122
49 Ga0075364_10039559 3300006051 Bacteria 3057
50 Ga0075364_10083963 3300006051 Bacteria 2108
51 Ga0075364_10310020 3300006051 Bacteria 1075
52 Ga0075364_10397380 3300006051 Bacteria 940
53 Ga0075364_10515490 3300006051 Bacteria 817
54 Ga0075364_10542023 3300006051 Bacteria 795
55 Ga0070716_100181600 3300006173 Bacteria 1382
56 Ga0070712_100027947 3300006175 Bacteria 3769
57 Ga0070712_100030211 3300006175 Bacteria 3639
58 Ga0070712_100094526 3300006175 Bacteria 2197
59 Ga0075367_10204740 3300006178 Bacteria 1233
60 Ga0075433_10176041 3300006852 Bacteria 1904
61 Ga0075434_100371826 3300006871 Bacteria 1450
62 Ga0075436_100102613 3300006914 Bacteria 1992
63 Ga0097620_101597096 3300006931 Bacteria 720
64 Ga0105251_10005717 3300009011 Bacteria 8073
65 Ga0105240_10012339 3300009093 Bacteria 11802
66 Ga0105245_10434292 3300009098 Unclassified 1318
67 Ga0157345_1009572 3300012498 Bacteria 829
68 Ga0157373_10189724 3300013100 Bacteria 1448
69 Ga0157373_10208196 3300013100 Bacteria 1379
70 Ga0157371_10000184 3300013102 Bacteria 92100
71 Ga0157371_10211388 3300013102 Bacteria 1392
72 Ga0157370_10054057 3300013104 Bacteria 3828
73 Ga0157370_10132386 3300013104 Bacteria 2325
74 Ga0182008_10000939 3300014497 Bacteria 20309
75 Ga0182008_10005276 3300014497 Bacteria 7387
76 Ga0182008_10035887 3300014497 Bacteria 2482
77 Ga0182006_1029851 3300015261 Bacteria 2207
78 Ga0182006_1080316 3300015261 Bacteria 1191
79 Ga0182007_10000118 3300015262 Bacteria 54536
80 Ga0182005_1000268 3300015265 Bacteria 32952
81 Ga0163161_10003167 3300017792 Bacteria 11607
82 Ga0163161_10338837 3300017792 Bacteria 1192
83 Ga0163161_10642986 3300017792 Bacteria 878
84 Ga0213876_10004731 3300021384 Bacteria 7568
85 Ga0213875_10000457 3300021388 Bacteria 35351
86 Ga0213875_10017778 3300021388 Bacteria 3431
87 Ga0228598_1038793 3300024227 Bacteria 940
88 Ga0209565_1000023 3300025263 Bacteria 388244
89 Ga0209673_1000047 3300025273 Bacteria 289276
90 Ga0209130_1008001 3300025284 Bacteria 3179
91 Ga0209675_1000016 3300025291 Bacteria 391965
92 Ga0209676_1000160 3300025292 Bacteria 161069
93 Ga0209676_1000796 3300025292 Bacteria 41705
94 Ga0209025_1045473 3300025294 Bacteria 1819
95 Ga0209564_1000194 3300025295 Bacteria 141518
96 Ga0209050_1000462 3300025298 Bacteria 72638
97 Ga0209050_1000971 3300025298 Bacteria 36685
98 Ga0209256_1002520 3300025299 Bacteria 14713
99 Ga0209051_1001229 3300025303 Bacteria 23028
100 Ga0209257_1000177 3300025304 Bacteria 161069
101 Ga0209257_1002904 3300025304 Bacteria 15851
102 Ga0209257_1003668 3300025304 Bacteria 12861
103 Ga0207655_1063274 3300025728 Bacteria 1418
104 Ga0207713_1007274 3300025735 Bacteria 6567
105 Ga0207699_10031462 3300025906 Bacteria 2979
106 Ga0207684_10027667 3300025910 Bacteria 4829
107 Ga0207684_10281519 3300025910 Bacteria 1434
108 Ga0207693_10005261 3300025915 Bacteria 10831
109 Ga0207693_10006242 3300025915 Bacteria 9882
110 Ga0207663_10104318 3300025916 Bacteria 1911
111 Ga0207646_10000480 3300025922 Bacteria 53452
112 Ga0207646_10007712 3300025922 Bacteria 10895
113 Ga0207681_10448663 3300025923 Bacteria 1049
114 Ga0207687_10304620 3300025927 Unclassified 1284
115 Ga0207700_10087875 3300025928 Bacteria 2445
116 Ga0207700_10160200 3300025928 Bacteria 1868
117 Ga0207700_10209418 3300025928 Bacteria 1647
118 Ga0207664_10815818 3300025929 Bacteria 839
119 Ga0207665_10040860 3300025939 Bacteria 3095
120 Ga0207667_10015205 3300025949 Bacteria 8750
121 Ga0207667_10810033 3300025949 Bacteria 933
122 Ga0207702_10236599 3300026078 Bacteria 1709
123 Ga0207702_10365885 3300026078 Bacteria 1383
124 Ga0268265_10838556 3300028380 Bacteria 899
125 Ga0307515_10000029 3300028794 Bacteria 365410
126 Ga0316176_1181826 3300030732 Bacteria 2554
127 Ga0316183_1130037 3300030742 Bacteria 13426
128 Ga0316181_1026451 3300030744 Bacteria 1518
129 Ga0307513_10000338 3300031456 Bacteria 67781
130 Ga0307408_100040803 3300031548 Bacteria 3288
131 Ga0316577_10117824 3300031733 Bacteria 1492
132 Ga0307410_10459842 3300031852 Bacteria 1040
133 Ga0307407_10098288 3300031903 Bacteria 1811
134 Ga0307412_10035695 3300031911 Bacteria 3179
135 Ga0307414_10004775 3300032004 Bacteria 7396
136 Ga0307414_10097544 3300032004 Bacteria 2202
137 Ga0307414_10277454 3300032004 Bacteria 1407
138 Ga0307415_100030395 3300032126 Bacteria 3467
139 Ga0373944_0003297 3300035089 Bacteria 4158
140 Ga0373945_0003458 3300035116 Bacteria 4967
141 Ga0373945_0194229 3300035116 Bacteria 840
142 Ga0373943_0002924 3300035170 Bacteria 7752
143 Ga0373943_0005650 3300035170 Bacteria 5612
144 Ga0373946_0004266 3300035171 Bacteria 5109
145 Ga0373946_0141821 3300035171 Bacteria 1114
146 Ga0373924_0027642 3300035410 Bacteria 2257
147 Ga0373935_0025025 3300035692 Bacteria 3677
148 Ga0373935_0067442 3300035692 Bacteria 2300
149 Ga0373935_0069768 3300035692 Bacteria 2264
150 Ga0373927_0004334 3300035695 Bacteria 9949
151 Ga0373927_0061170 3300035695 Bacteria 2436
152 Ga0373947_0003204 3300035725 Bacteria 9710
153 Ga0373947_0068357 3300035725 Bacteria 2172
154 Ga0373925_0001534 3300037068 Bacteria 19696
155 Ga0373925_0031429 3300037068 Bacteria 3901
156 Ga0373925_0276328 3300037068 Bacteria 1352
157 Ga0373925_0382296 3300037068 Bacteria 1146
158 Ga0436364_0108904 3300037853 Bacteria 3539
159 Ga0436364_0617280 3300037853 Bacteria 2682
160 Ga0436364_0668201 3300037853 Bacteria 105492
161 Ga0436364_0791322 3300037853 Bacteria 2022
162 Ga0400485_17705 3300038735 Bacteria 1624
163 Ga0400488_06025 3300038741 Bacteria 1519
164 Ga0400486_05459 3300038742 Bacteria 1628
165 Ga0400486_21231 3300038742 Bacteria 1934
166 Ga0436365_0678522 3300039437 Bacteria 2093
167 Ga0436365_0985147 3300039437 Bacteria 2552
168 Ga0436365_1054176 3300039437 Bacteria 4982
169 Ga0436365_1161976 3300039437 Bacteria 1177
170 Ga0436360_0027689 3300039438 Bacteria 937
171 Ga0436360_0988855 3300039438 Bacteria 1333
172 Ga0436361_0941361 3300039447 Bacteria 1941
173 Ga0436363_0481764 3300039450 Bacteria 837
174 Ga0436362_0364089 3300039453 Bacteria 1207
175 Ga0436362_0524017 3300039453 Bacteria 1313
176 Ga0439466_0126711 3300041411 Bacteria 787
177 Ga0439432_013954 3300042006 Bacteria 2723
178 Ga0439432_032073 3300042006 Bacteria 1696
179 Ga0450920_013967 3300042122 Bacteria 1515
180 Ga0450906_002334 3300042145 Bacteria 4158
181 Ga0451577_0086675 3300042876 Bacteria 2793
182 Ga0466961_0095360 3300044693 Bacteria 1876
183 Ga0466963_0338602 3300044694 Bacteria 1059
184 Ga0453684_0000491 3300044712 Bacteria 155597
185 Ga0453684_0087871 3300044712 Bacteria 3851
186 Ga0453684_0089184 3300044712 Bacteria 3815
187 Ga0453684_0205216 3300044712 Bacteria 2294
188 Ga0453684_0484066 3300044712 Bacteria 1372
189 Ga0453684_1178307 3300044712 Bacteria 805
190 Ga0466968_0025443 3300044735 Bacteria 2424
191 Ga0466959_0205918 3300045049 Bacteria 1368
192 Ga0495627_010541 3300046453 Bacteria 3355
193 Ga0495627_043807 3300046453 Bacteria 1367
194 Ga0495592_0342109 3300046454 Bacteria 961
195 Ga0495629_0052547 3300046459 Bacteria 2852
196 Ga0495638_0001816 3300046460 Bacteria 18521
197 Ga0495638_0212303 3300046460 Bacteria 1086
198 Ga0495653_0122923 3300046463 Bacteria 1846
199 Ga0495580_0036879 3300046472 Bacteria 3510
200 Ga0495580_0363346 3300046472 Bacteria 979
201 Ga0495639_0008977 3300046475 Bacteria 4286
202 Ga0495662_0009203 3300046476 Bacteria 4846
203 Ga0495664_0000368 3300046477 Bacteria 21935
204 Ga0495606_0075725 3300046507 Bacteria 2105
205 Ga0495610_0004633 3300046512 Bacteria 10063
206 Ga0495618_0065617 3300046514 Bacteria 2307
207 Ga0495618_0107837 3300046514 Bacteria 1783
208 Ga0495630_0005854 3300046517 Bacteria 8691
209 Ga0495630_0044349 3300046517 Bacteria 3323
210 Ga0495631_0004728 3300046518 Bacteria 7196
211 Ga0495643_0001888 3300046522 Bacteria 17752
212 Ga0495663_0001965 3300046525 Bacteria 6324
213 Ga0495663_0012109 3300046525 Bacteria 2404
214 Ga0495663_0018522 3300046525 Bacteria 1983
215 Ga0495666_0007768 3300046526 Bacteria 5369
216 Ga0495652_0051616 3300046529 Bacteria 3511
217 Ga0495665_0033227 3300046531 Bacteria 2759
218 Ga0495665_0063741 3300046531 Bacteria 1945
219 Ga0495640_0134538 3300046533 Bacteria 1597
220 Ga0495586_0016181 3300046535 Bacteria 3968
221 Ga0495587_0252457 3300046536 Bacteria 991
222 Ga0495645_0003956 3300046543 Bacteria 10105
223 Ga0495633_0005058 3300046558 Bacteria 8213
224 Ga0495633_0099451 3300046558 Bacteria 1350
225 Ga0495634_0017172 3300046642 Bacteria 5168
226 Ga0495634_0046520 3300046642 Bacteria 2927
227 Ga0495625_0072743 3300046660 Bacteria 2411
228 Ga0495625_0347336 3300046660 Bacteria 938
229 Ga0495635_0002253 3300046663 Bacteria 13109
230 Ga0495635_0045844 3300046663 Bacteria 3016
231 Ga0495588_0219115 3300046674 Bacteria 1005
232 Ga0495646_0184636 3300046680 Bacteria 1143
233 Ga0495658_0039666 3300046683 Bacteria 2614
234 Ga0495613_0226883 3300046689 Bacteria 1310
235 Ga0495624_0003817 3300046690 Bacteria 11139
236 Ga0495624_0043580 3300046690 Bacteria 2862
237 Ga0495581_0036034 3300047315 Bacteria 2862
238 Ga0495581_0291807 3300047315 Bacteria 953
239 Ga0495674_0014649 3300047319 Bacteria 7337
240 Ga0495672_0005001 3300047320 Bacteria 10610
241 Ga0495672_0119178 3300047320 Bacteria 1405
242 Ga0495676_0009716 3300047321 Bacteria 8747
243 Ga0495676_0605287 3300047321 Bacteria 713
244 Ga0495684_0005917 3300047471 Bacteria 9505
245 Ga0495684_0006398 3300047471 Bacteria 9143
246 Ga0495684_0015023 3300047471 Bacteria 5962
247 Ga0495686_0007978 3300047472 Bacteria 7850
248 Ga0495614_0013427 3300048089 Bacteria 3593
249 Ga0496104_0727055 3300048907 Bacteria 900
250 Ga0496111_0200096 3300048914 Bacteria 1485
251 Ga0496111_0727690 3300048914 Bacteria 721
252 Ga0496113_0435042 3300048916 Bacteria 1054
253 Ga0496116_0104447 3300048919 Bacteria 1683
254 Ga0496116_0194370 3300048919 Bacteria 1070
255 Ga0496117_0000854 3300048920 Bacteria 47114
256 Ga0496117_0001593 3300048920 Bacteria 32105
257 Ga0496117_0013796 3300048920 Bacteria 7017
258 Ga0496117_0075823 3300048920 Bacteria 2232
259 Ga0496117_0131480 3300048920 Bacteria 1516
260 Ga0496117_0235777 3300048920 Bacteria 1008
261 Ga0496118_0000383 3300048921 Bacteria 74507
262 Ga0496118_0015687 3300048921 Bacteria 6996
263 Ga0496118_0032770 3300048921 Bacteria 4272
264 Ga0496118_0100706 3300048921 Bacteria 1953
265 Ga0496118_0125193 3300048921 Bacteria 1665
266 Ga0496118_0390614 3300048921 Bacteria 726
267 Ga0496119_0000069 3300048922 Bacteria 155265
268 Ga0496120_0000884 3300048923 Bacteria 42219
269 Ga0496121_0030576 3300048924 Bacteria 4943
270 Ga0496121_0038879 3300048924 Bacteria 4203
271 Ga0496121_0129197 3300048924 Bacteria 1894
272 Ga0496122_0000710 3300048925 Bacteria 65728
273 Ga0496122_0007903 3300048925 Bacteria 11665
274 Ga0496122_0033449 3300048925 Bacteria 4228
275 Ga0496122_0072978 3300048925 Bacteria 2436
276 Ga0496122_0129822 3300048925 Bacteria 1604
277 Ga0496123_0000104 3300048926 Bacteria 168230
278 Ga0496123_0040933 3300048926 Bacteria 3219
279 Ga0496123_0049439 3300048926 Bacteria 2819
280 Ga0496123_0060671 3300048926 Bacteria 2436
281 Ga0496123_0080303 3300048926 Bacteria 1988
282 Ga0496124_0000516 3300048927 Bacteria 66627
283 Ga0496124_0002024 3300048927 Bacteria 27560
284 Ga0496124_0007141 3300048927 Bacteria 11957
285 Ga0496124_0020862 3300048927 Bacteria 6044
286 Ga0496124_0036037 3300048927 Bacteria 4320
287 Ga0496124_0104787 3300048927 Bacteria 2286
288 Ga0496124_0107000 3300048927 Bacteria 2257
289 Ga0496124_0140593 3300048927 Bacteria 1905
290 Ga0496124_0240791 3300048927 Bacteria 1345
291 Ga0496125_0001475 3300048928 Bacteria 34001
292 Ga0496125_0009350 3300048928 Bacteria 10097
293 Ga0496125_0019578 3300048928 Bacteria 6377
294 Ga0496125_0025527 3300048928 Bacteria 5408
295 Ga0496125_0050641 3300048928 Bacteria 3436
296 Ga0496125_0060790 3300048928 Bacteria 3034
297 Ga0496125_0209980 3300048928 Bacteria 1265
298 Ga0496126_0000913 3300048929 Bacteria 51086
299 Ga0501034_0013976 3300049571 Bacteria 8263
300 Ga0501046_0156392 3300049580 Bacteria 1717
301 Ga0501047_0121470 3300049581 Bacteria 2494
302 Ga0501047_0236868 3300049581 Bacteria 1677
303 Ga0501070_0103409 3300049586 Bacteria 2356
304 Ga0501072_0181503 3300049588 Bacteria 1679
305 Ga0501073_0007663 3300049589 Bacteria 8011
306 Ga0501079_0389758 3300049741 Bacteria 1092
307 Ga0501080_0016301 3300049742 Bacteria 6860
308 Ga0501081_0072157 3300049743 Bacteria 2407
309 Ga0501045_0284134 3300049824 Bacteria 1232
310 nmdc:mga00v17_135060_c1 3300050491 Bacteria 1579
311 nmdc:mga00v17_140343_c1 3300050491 Bacteria 1050
312 nmdc:mga00v17_149026_c1 3300050491 Bacteria 1503
313 nmdc:mga00v17_214897_c1 3300050491 Bacteria 1245
314 nmdc:mga00v17_217545_c1 3300050491 Bacteria 1237
315 nmdc:mga00v17_245295_c1 3300050491 Bacteria 1162
316 nmdc:mga00v17_269644_c1 3300050491 Bacteria 1105
317 nmdc:mga00v17_497200_c1 3300050491 Bacteria 791
318 nmdc:mga00v17_509453_c1 3300050491 Bacteria 780
319 nmdc:mga05p37_187166_c1 3300050507 Bacteria 2517
320 nmdc:mga0n895_152325_c1 3300050512 Bacteria 2343
321 nmdc:mga08x19_247696_c1 3300050514 Bacteria 1230
322 Ga0495601_0002326 3300053077 Bacteria 10747
323 Ga0495612_0001393 3300053078 Bacteria 9976
324 Ga0495619_0013296 3300053085 Bacteria 5185
325 Ga0500641_0050491 3300053096 Bacteria 1709
326 Ga0500555_053609 3300053103 Bacteria 1098
327 Ga0500569_124397 3300053109 Bacteria 860
328 Ga0501082_0075807 3300060353 Bacteria 2898
329 2511185798 2510917028 Bacteria 6185411
330 2513996422 2513237159 Bacteria 6810126
331 2578457150 2576861471 Bacteria 4648976
332 2842759129 2842757796 Bacteria 3981385
333 2852652292 2852649853 Bacteria 4036942
334 2857446798 2857442823 Bacteria 4562550
335 2919676369 2919675420 Bacteria 3969095
336 2929297984 2929297113 Bacteria 3141306
337 2939589658 2939589442 Bacteria 4214238
338 2939624271 2939622612 Bacteria 4698046
339 2941478909 2941475908 Bacteria 4145589
340 2974307787 2974307012 Bacteria 4172388
341 2977248506 2977247770 Bacteria 4160543
342 2984517007 2984514374 Bacteria 4172479
343 2987608612 2987605356 Bacteria 4187822
344 Ga0373926_0020060
345 Ga0055526_1009693
346 Ga0055537_1000949
347 Ga0055536_1001527
348 Ga0055536_1004059
349 Ga0055534_1000121
350 Ga0055528_1000148
351 Ga0055530_10000618
352 Ga0055530_10003074
353 Ga0055540_1043079
354 Ga0055531_10002056
355 Ga0055531_10006302
356 Ga0055531_10015474
357 Ga0070683_100410165
358 Ga0070669_100722982
359 Ga0070675_100206630
360 Ga0070688_100155318
361 Ga0070667_100811482
362 Ga0070709_10253229
363 Ga0070714_100126501
364 Ga0070713_100014543
365 Ga0070713_100195355
366 Ga0070713_101015234
367 Ga0070710_10013551
368 Ga0070711_100164174
369 Ga0070711_100253397
370 Ga0070711_100371684
371 Ga0070708_100033143
372 Ga0070708_100063184
373 Ga0070706_100081098
374 Ga0070707_100000456
375 Ga0070707_100056105
376 Ga0070698_100216665
377 Ga0070698_100410156
378 Ga0070699_100081107
379 Ga0070699_100834643
380 Ga0070684_100595297
381 Ga0070697_100114908
382 Ga0070697_100254662
383 Ga0070696_100334419
384 Ga0070665_100155537
385 Ga0068855_100003294
386 Ga0068855_100801791
387 Ga0068859_101597539
388 Ga0068864_100734028
389 Ga0070717_10431218
390 Ga0070717_10659536
391 Ga0075363_100012296
392 Ga0075364_10039559
393 Ga0075364_10083963
394 Ga0075364_10310020
395 Ga0075364_10397380
396 Ga0075364_10515490
397 Ga0075364_10542023
398 Ga0070716_100181600
399 Ga0070712_100027947
400 Ga0070712_100030211
401 Ga0070712_100094526
402 Ga0075367_10204740
403 Ga0075433_10176041
404 Ga0075434_100371826
405 Ga0075436_100102613
406 Ga0097620_101597096
407 Ga0105251_10005717
408 Ga0105240_10012339
409 Ga0105245_10434292
410 Ga0157345_1009572
411 Ga0157373_10189724
412 Ga0157373_10208196
413 Ga0157371_10000184
414 Ga0157371_10211388
415 Ga0157370_10054057
416 Ga0157370_10132386
417 Ga0182008_10000939
418 Ga0182008_10005276
419 Ga0182008_10035887
420 Ga0182006_1029851
421 Ga0182006_1080316
422 Ga0182007_10000118
423 Ga0182005_1000268
424 Ga0163161_10003167
425 Ga0163161_10338837
426 Ga0163161_10642986
427 Ga0213876_10004731
428 Ga0213875_10000457
429 Ga0213875_10017778
430 Ga0228598_1038793
431 Ga0209565_1000023
432 Ga0209673_1000047
433 Ga0209130_1008001
434 Ga0209675_1000016
435 Ga0209676_1000160
436 Ga0209676_1000796
437 Ga0209025_1045473
438 Ga0209564_1000194
439 Ga0209050_1000462
440 Ga0209050_1000971
441 Ga0209256_1002520
442 Ga0209051_1001229
443 Ga0209257_1000177
444 Ga0209257_1002904
445 Ga0209257_1003668
446 Ga0207655_1063274
447 Ga0207713_1007274
448 Ga0207699_10031462
449 Ga0207684_10027667
450 Ga0207684_10281519
451 Ga0207693_10005261
452 Ga0207693_10006242
453 Ga0207663_10104318
454 Ga0207646_10000480
455 Ga0207646_10007712
456 Ga0207681_10448663
457 Ga0207687_10304620
458 Ga0207700_10087875
459 Ga0207700_10160200
460 Ga0207700_10209418
461 Ga0207664_10815818
462 Ga0207665_10040860
463 Ga0207667_10015205
464 Ga0207667_10810033
465 Ga0207702_10236599
466 Ga0207702_10365885
467 Ga0268265_10838556
468 Ga0307515_10000029
469 Ga0316176_1181826
470 Ga0316183_1130037
471 Ga0316181_1026451
472 Ga0307513_10000338
473 Ga0307408_100040803
474 Ga0316577_10117824
475 Ga0307410_10459842
476 Ga0307407_10098288
477 Ga0307412_10035695
478 Ga0307414_10004775
479 Ga0307414_10097544
480 Ga0307414_10277454
481 Ga0307415_100030395
482 Ga0373944_0003297
483 Ga0373945_0003458
484 Ga0373945_0194229
485 Ga0373943_0002924
486 Ga0373943_0005650
487 Ga0373946_0004266
488 Ga0373946_0141821
489 Ga0373924_0027642
490 Ga0373935_0025025
491 Ga0373935_0067442
492 Ga0373935_0069768
493 Ga0373927_0004334
494 Ga0373927_0061170
495 Ga0373947_0003204
496 Ga0373947_0068357
497 Ga0373925_0001534
498 Ga0373925_0031429
499 Ga0373925_0276328
500 Ga0373925_0382296
501 Ga0436364_0108904
502 Ga0436364_0617280
503 Ga0436364_0668201
504 Ga0436364_0791322
505 Ga0400485_17705
506 Ga0400488_06025
507 Ga0400486_05459
508 Ga0400486_21231
509 Ga0436365_0678522
510 Ga0436365_0985147
511 Ga0436365_1054176
512 Ga0436365_1161976
513 Ga0436360_0027689
514 Ga0436360_0988855
515 Ga0436361_0941361
516 Ga0436363_0481764
517 Ga0436362_0364089
518 Ga0436362_0524017
519 Ga0439466_0126711
520 Ga0439432_013954
521 Ga0439432_032073
522 Ga0450920_013967
523 Ga0450906_002334
524 Ga0451577_0086675
525 Ga0466961_0095360
526 Ga0466963_0338602
527 Ga0453684_0000491
528 Ga0453684_0087871
529 Ga0453684_0089184
530 Ga0453684_0205216
531 Ga0453684_0484066
532 Ga0453684_1178307
533 Ga0466968_0025443
534 Ga0466959_0205918
535 Ga0495627_010541
536 Ga0495627_043807
537 Ga0495592_0342109
538 Ga0495629_0052547
539 Ga0495638_0001816
540 Ga0495638_0212303
541 Ga0495653_0122923
542 Ga0495580_0036879
543 Ga0495580_0363346
544 Ga0495639_0008977
545 Ga0495662_0009203
546 Ga0495664_0000368
547 Ga0495606_0075725
548 Ga0495610_0004633
549 Ga0495618_0065617
550 Ga0495618_0107837
551 Ga0495630_0005854
552 Ga0495630_0044349
553 Ga0495631_0004728
554 Ga0495643_0001888
555 Ga0495663_0001965
556 Ga0495663_0012109
557 Ga0495663_0018522
558 Ga0495666_0007768
559 Ga0495652_0051616
560 Ga0495665_0033227
561 Ga0495665_0063741
562 Ga0495640_0134538
563 Ga0495586_0016181
564 Ga0495587_0252457
565 Ga0495645_0003956
566 Ga0495633_0005058
567 Ga0495633_0099451
568 Ga0495634_0017172
569 Ga0495634_0046520
570 Ga0495625_0072743
571 Ga0495625_0347336
572 Ga0495635_0002253
573 Ga0495635_0045844
574 Ga0495588_0219115
575 Ga0495646_0184636
576 Ga0495658_0039666
577 Ga0495613_0226883
578 Ga0495624_0003817
579 Ga0495624_0043580
580 Ga0495581_0036034
581 Ga0495581_0291807
582 Ga0495674_0014649
583 Ga0495672_0005001
584 Ga0495672_0119178
585 Ga0495676_0009716
586 Ga0495676_0605287
587 Ga0495684_0005917
588 Ga0495684_0006398
589 Ga0495684_0015023
590 Ga0495686_0007978
591 Ga0495614_0013427
592 Ga0496104_0727055
593 Ga0496111_0200096
594 Ga0496111_0727690
595 Ga0496113_0435042
596 Ga0496116_0104447
597 Ga0496116_0194370
598 Ga0496117_0000854
599 Ga0496117_0001593
600 Ga0496117_0013796
601 Ga0496117_0075823
602 Ga0496117_0131480
603 Ga0496117_0235777
604 Ga0496118_0000383
605 Ga0496118_0015687
606 Ga0496118_0032770
607 Ga0496118_0100706
608 Ga0496118_0125193
609 Ga0496118_0390614
610 Ga0496119_0000069
611 Ga0496120_0000884
612 Ga0496121_0030576
613 Ga0496121_0038879
614 Ga0496121_0129197
615 Ga0496122_0000710
616 Ga0496122_0007903
617 Ga0496122_0033449
618 Ga0496122_0072978
619 Ga0496122_0129822
620 Ga0496123_0000104
621 Ga0496123_0040933
622 Ga0496123_0049439
623 Ga0496123_0060671
624 Ga0496123_0080303
625 Ga0496124_0000516
626 Ga0496124_0002024
627 Ga0496124_0007141
628 Ga0496124_0020862
629 Ga0496124_0036037
630 Ga0496124_0104787
631 Ga0496124_0107000
632 Ga0496124_0140593
633 Ga0496124_0240791
634 Ga0496125_0001475
635 Ga0496125_0009350
636 Ga0496125_0019578
637 Ga0496125_0025527
638 Ga0496125_0050641
639 Ga0496125_0060790
640 Ga0496125_0209980
641 Ga0496126_0000913
642 Ga0501034_0013976
643 Ga0501046_0156392
644 Ga0501047_0121470
645 Ga0501047_0236868
646 Ga0501070_0103409
647 Ga0501072_0181503
648 Ga0501073_0007663
649 Ga0501079_0389758
650 Ga0501080_0016301
651 Ga0501081_0072157
652 Ga0501045_0284134
653 nmdc:mga00v17_135060_c1
654 nmdc:mga00v17_140343_c1
655 nmdc:mga00v17_149026_c1
656 nmdc:mga00v17_214897_c1
657 nmdc:mga00v17_217545_c1
658 nmdc:mga00v17_245295_c1
659 nmdc:mga00v17_269644_c1
660 nmdc:mga00v17_497200_c1
661 nmdc:mga00v17_509453_c1
662 nmdc:mga05p37_187166_c1
663 nmdc:mga0n895_152325_c1
664 nmdc:mga08x19_247696_c1
665 Ga0495601_0002326
666 Ga0495612_0001393
667 Ga0495619_0013296
668 Ga0500641_0050491
669 Ga0500555_053609
670 Ga0500569_124397
671 Ga0501082_0075807
672 2511185798
673 2513996422
674 2578457150
675 2842759129
676 2852652292
677 2857446798
678 2919676369
679 2929297984
680 2939589658
681 2939624271
682 2941478909
683 2974307787
684 2977248506
685 2984517007
686 2987608612

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01725

Ham1p_like

Ham1 family

36

233

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9391 9 209
2e5x-assembly1.cif.gz_A-2 structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3 0.9225 8 209
2q16-assembly1.cif.gz_B structure of the e. coli inosine triphosphate pyrophosphatase rgdb in complex with itp 0.9157 9 209
3s86-assembly1.cif.gz_D crystal structure of tm0159 with bound imp 0.9095 8 209
3tqu-assembly2.cif.gz_D structure of a ham1 protein from coxiella burnetii 0.8856 8 209
ID Description Score Start End Superfamily
2ztiA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9272 8 209 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9204 6 209 3.90.950.10
3s86D00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9095 8 209 3.90.950.10
af_Q4DRX4_9_195_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.904 1 207 3.90.950.10
af_P52061_1_197_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.8935 6 209 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A845MKD1-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9791 2 214 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0046872
GO:0047429
AF-A0A1H6MZS1-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9783 1 211 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A5J6MSY5-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9773 2 213 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0016747
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A2E8YR09-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9752 2 214 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872
AF-A0A2P6FR51-F1-model_v4 dITP/XTP pyrophosphatase (EC 3.6.1.66) (Non-canonical purine NTP pyrophosphatase) (Non-standard purine NTP pyrophosphatase) (Nucleoside-triphosphate diphosphatase) (Nucleoside-triphosphate pyrophosphatase) (NTPase) 0.9735 1 213 GO:0000166
GO:0005829
GO:0009117
GO:0009146
GO:0017111
GO:0035870
GO:0036220
GO:0036222
GO:0046872

Map