F415648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 343 | 216 | 333 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100608334|Ga0307409_1006083342 |
| Length | 165 |
| Sequence | MTVNTATARYEGLGKAGRGHVASKSGVIDAPFGFGTRFEGQPGTNPEEMIAAAHASCFTMAASLALAGAGNSDGTLETACQVTLDKDGAGFAVTRSALKLTANVPGIDRAELERLAGEAKAGCPISKLLNCEITLPASARGFAASRLSPERRRRICSWSDRHSPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 2 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 3 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 4 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 5 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 6 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 7 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 8 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 9 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 10 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 11 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 125 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 129 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 130 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 142 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 143 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 144 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 145 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 146 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 147 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 150 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 151 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 152 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 153 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 169 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 170 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 171 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 172 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 193 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 196 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 200 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 201 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 203 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 204 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 205 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 206 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 207 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 208 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 209 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 210 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 211 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 212 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 213 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 214 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 215 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.79 |
| Metatranscriptomes | 0.29 |
| Isolates | 2.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.58 |
| Bulb | 0 |
| Endosphere | 8.45 |
| Nodule | 0 |
| Rhizoplane | 1.17 |
| Rhizosphere | 82.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10010214 | 3300001990 | Bacteria | 3103 |
| 2 | JGI24735J21928_10005602 | 3300002067 | Bacteria | 4158 |
| 3 | JGI24751J29686_10026964 | 3300002459 | Bacteria | 1192 |
| 4 | JGI25157J39369_1009084 | 3300002741 | Bacteria | 1352 |
| 5 | JGI25165J46597_1000040 | 3300003214 | Bacteria | 277491 |
| 6 | Ga0055542_1017717 | 3300003762 | Bacteria | 1096 |
| 7 | Ga0055542_1038047 | 3300003762 | Bacteria | 579 |
| 8 | Ga0055529_1009510 | 3300003763 | Bacteria | 1273 |
| 9 | Ga0070658_10017406 | 3300005327 | Bacteria | 5751 |
| 10 | Ga0070658_10318381 | 3300005327 | Bacteria | 1328 |
| 11 | Ga0070676_10064052 | 3300005328 | Bacteria | 2191 |
| 12 | Ga0070670_100009377 | 3300005331 | Bacteria | 8355 |
| 13 | Ga0070670_100174906 | 3300005331 | Bacteria | 1863 |
| 14 | Ga0070666_10093098 | 3300005335 | Bacteria | 2072 |
| 15 | Ga0070666_10160913 | 3300005335 | Bacteria | 1569 |
| 16 | Ga0070666_11261076 | 3300005335 | Bacteria | 551 |
| 17 | Ga0070680_100977681 | 3300005336 | Bacteria | 731 |
| 18 | Ga0070682_100718943 | 3300005337 | Bacteria | 803 |
| 19 | Ga0070682_100788244 | 3300005337 | Bacteria | 771 |
| 20 | Ga0070660_100002182 | 3300005339 | Bacteria | 13496 |
| 21 | Ga0070660_100103332 | 3300005339 | Bacteria | 2260 |
| 22 | Ga0070660_100986734 | 3300005339 | Bacteria | 711 |
| 23 | Ga0070660_101266608 | 3300005339 | Bacteria | 625 |
| 24 | Ga0070661_100309293 | 3300005344 | Bacteria | 1232 |
| 25 | Ga0070668_100000031 | 3300005347 | Bacteria | 87761 |
| 26 | Ga0070668_100388973 | 3300005347 | Bacteria | 1188 |
| 27 | Ga0070669_100054146 | 3300005353 | Bacteria | 2938 |
| 28 | Ga0070669_100055501 | 3300005353 | Bacteria | 2903 |
| 29 | Ga0070675_100017835 | 3300005354 | Bacteria | 5647 |
| 30 | Ga0070671_100000265 | 3300005355 | Bacteria | 35316 |
| 31 | Ga0070671_100876159 | 3300005355 | Bacteria | 784 |
| 32 | Ga0070659_100034224 | 3300005366 | Bacteria | 3951 |
| 33 | Ga0070659_100070098 | 3300005366 | Bacteria | 2784 |
| 34 | Ga0070659_100096446 | 3300005366 | Bacteria | 2376 |
| 35 | Ga0070659_100386927 | 3300005366 | Bacteria | 1179 |
| 36 | Ga0070659_100553703 | 3300005366 | Bacteria | 985 |
| 37 | Ga0070667_100000004 | 3300005367 | Bacteria | 444091 |
| 38 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 39 | Ga0070663_100394814 | 3300005455 | Bacteria | 1129 |
| 40 | Ga0070663_100676770 | 3300005455 | Bacteria | 875 |
| 41 | Ga0070678_100299181 | 3300005456 | Bacteria | 1367 |
| 42 | Ga0070662_100048470 | 3300005457 | Bacteria | 3060 |
| 43 | Ga0070662_100233401 | 3300005457 | Bacteria | 1473 |
| 44 | Ga0070698_100259468 | 3300005471 | Bacteria | 1670 |
| 45 | Ga0070679_101144895 | 3300005530 | Bacteria | 723 |
| 46 | Ga0070684_100472480 | 3300005535 | Bacteria | 1160 |
| 47 | Ga0068853_100002170 | 3300005539 | Bacteria | 14611 |
| 48 | Ga0068853_100288393 | 3300005539 | Bacteria | 1514 |
| 49 | Ga0068853_102260034 | 3300005539 | Bacteria | 527 |
| 50 | Ga0070665_100000024 | 3300005548 | Bacteria | 374559 |
| 51 | Ga0068855_100000333 | 3300005563 | Bacteria | 58773 |
| 52 | Ga0068855_100000954 | 3300005563 | Bacteria | 36005 |
| 53 | Ga0068855_100093622 | 3300005563 | Bacteria | 3465 |
| 54 | Ga0068855_100302261 | 3300005563 | Bacteria | 1772 |
| 55 | Ga0068855_100441044 | 3300005563 | Bacteria | 1422 |
| 56 | Ga0070664_100117765 | 3300005564 | Bacteria | 2323 |
| 57 | Ga0068857_100014552 | 3300005577 | Bacteria | 6863 |
| 58 | Ga0068857_100024487 | 3300005577 | Bacteria | 5314 |
| 59 | Ga0068857_100034750 | 3300005577 | Bacteria | 4459 |
| 60 | Ga0068857_100230799 | 3300005577 | Bacteria | 1693 |
| 61 | Ga0068857_102155877 | 3300005577 | Bacteria | 547 |
| 62 | Ga0068854_100021148 | 3300005578 | Bacteria | 4412 |
| 63 | Ga0068854_101192230 | 3300005578 | Bacteria | 682 |
| 64 | Ga0068856_101464729 | 3300005614 | Bacteria | 697 |
| 65 | Ga0068852_100019458 | 3300005616 | Bacteria | 5374 |
| 66 | Ga0068852_100077003 | 3300005616 | Bacteria | 2947 |
| 67 | Ga0068852_100373423 | 3300005616 | Bacteria | 1397 |
| 68 | Ga0068852_101867650 | 3300005616 | Bacteria | 623 |
| 69 | Ga0068859_100016599 | 3300005617 | Bacteria | 7393 |
| 70 | Ga0068864_100007001 | 3300005618 | Bacteria | 9253 |
| 71 | Ga0068861_100008877 | 3300005719 | Bacteria | 6928 |
| 72 | Ga0068861_100367255 | 3300005719 | Bacteria | 1267 |
| 73 | Ga0068858_100000771 | 3300005842 | Bacteria | 33416 |
| 74 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 75 | Ga0068860_100000256 | 3300005843 | Bacteria | 78477 |
| 76 | Ga0068862_100000721 | 3300005844 | Bacteria | 33533 |
| 77 | Ga0068862_100000928 | 3300005844 | Bacteria | 28369 |
| 78 | Ga0075432_10041751 | 3300006058 | Bacteria | 1603 |
| 79 | Ga0075366_10047608 | 3300006195 | Bacteria | 2542 |
| 80 | Ga0097621_100197883 | 3300006237 | Bacteria | 1743 |
| 81 | Ga0075370_10003378 | 3300006353 | Bacteria | 7584 |
| 82 | Ga0075370_10066201 | 3300006353 | Bacteria | 2061 |
| 83 | Ga0097620_100016599 | 3300006931 | Bacteria | 7393 |
| 84 | Ga0075435_101311383 | 3300007076 | Bacteria | 634 |
| 85 | Ga0105240_10010962 | 3300009093 | Bacteria | 12697 |
| 86 | Ga0105240_10070160 | 3300009093 | Bacteria | 4335 |
| 87 | Ga0105240_10156274 | 3300009093 | Bacteria | 2712 |
| 88 | Ga0105240_11175618 | 3300009093 | Bacteria | 813 |
| 89 | Ga0105240_11819406 | 3300009093 | Bacteria | 634 |
| 90 | Ga0105243_10821933 | 3300009148 | Bacteria | 918 |
| 91 | Ga0105241_10102057 | 3300009174 | Bacteria | 2282 |
| 92 | Ga0105248_10039358 | 3300009177 | Bacteria | 5294 |
| 93 | Ga0105237_10006257 | 3300009545 | Bacteria | 13250 |
| 94 | Ga0105238_11470541 | 3300009551 | Bacteria | 709 |
| 95 | Ga0105249_10624713 | 3300009553 | Bacteria | 1133 |
| 96 | Ga0105239_10000438 | 3300010375 | Bacteria | 60788 |
| 97 | Ga0105239_10086519 | 3300010375 | Bacteria | 3455 |
| 98 | Ga0105239_10252287 | 3300010375 | Bacteria | 1982 |
| 99 | Ga0105239_10954796 | 3300010375 | Bacteria | 985 |
| 100 | Ga0157371_10151961 | 3300013102 | Bacteria | 1651 |
| 101 | Ga0157370_10002056 | 3300013104 | Bacteria | 24667 |
| 102 | Ga0157369_10181650 | 3300013105 | Bacteria | 2213 |
| 103 | Ga0163162_10004509 | 3300013306 | Bacteria | 13410 |
| 104 | Ga0163162_10159106 | 3300013306 | Bacteria | 2380 |
| 105 | Ga0163162_11559218 | 3300013306 | Bacteria | 753 |
| 106 | Ga0157372_11373678 | 3300013307 | Bacteria | 814 |
| 107 | Ga0224712_10252504 | 3300022467 | Bacteria | 815 |
| 108 | Ga0207427_100661 | 3300025231 | Bacteria | 16569 |
| 109 | Ga0209026_1000440 | 3300025250 | Bacteria | 33927 |
| 110 | Ga0209148_1000457 | 3300025254 | Bacteria | 44291 |
| 111 | Ga0209148_1001408 | 3300025254 | Bacteria | 12369 |
| 112 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 113 | Ga0209455_1000848 | 3300025272 | Bacteria | 16337 |
| 114 | Ga0207697_10021626 | 3300025315 | Bacteria | 2634 |
| 115 | Ga0207680_10078841 | 3300025903 | Bacteria | 2064 |
| 116 | Ga0207680_10442242 | 3300025903 | Bacteria | 922 |
| 117 | Ga0207647_10008761 | 3300025904 | Bacteria | 7223 |
| 118 | Ga0207647_10059157 | 3300025904 | Bacteria | 2345 |
| 119 | Ga0207647_10077900 | 3300025904 | Bacteria | 1992 |
| 120 | Ga0207647_10126814 | 3300025904 | Bacteria | 1502 |
| 121 | Ga0207645_10122635 | 3300025907 | Bacteria | 1688 |
| 122 | Ga0207705_10001476 | 3300025909 | Bacteria | 18730 |
| 123 | Ga0207705_10274002 | 3300025909 | Bacteria | 1291 |
| 124 | Ga0207654_10201948 | 3300025911 | Bacteria | 1309 |
| 125 | Ga0207695_10019508 | 3300025913 | Bacteria | 7806 |
| 126 | Ga0207695_10040337 | 3300025913 | Bacteria | 5008 |
| 127 | Ga0207695_10087579 | 3300025913 | Bacteria | 3137 |
| 128 | Ga0207695_10497492 | 3300025913 | Bacteria | 1101 |
| 129 | Ga0207671_10004244 | 3300025914 | Bacteria | 13805 |
| 130 | Ga0207660_10588967 | 3300025917 | Bacteria | 906 |
| 131 | Ga0207657_10010927 | 3300025919 | Bacteria | 9031 |
| 132 | Ga0207657_10024261 | 3300025919 | Bacteria | 5624 |
| 133 | Ga0207657_10025068 | 3300025919 | Bacteria | 5508 |
| 134 | Ga0207657_10068468 | 3300025919 | Bacteria | 3015 |
| 135 | Ga0207657_10257601 | 3300025919 | Bacteria | 1389 |
| 136 | Ga0207649_10077148 | 3300025920 | Bacteria | 2146 |
| 137 | Ga0207649_10399051 | 3300025920 | Bacteria | 1029 |
| 138 | Ga0207652_11000575 | 3300025921 | Bacteria | 735 |
| 139 | Ga0207681_10010266 | 3300025923 | Bacteria | 5734 |
| 140 | Ga0207681_10013486 | 3300025923 | Bacteria | 5059 |
| 141 | Ga0207694_11393873 | 3300025924 | Bacteria | 592 |
| 142 | Ga0207650_10008025 | 3300025925 | Bacteria | 7194 |
| 143 | Ga0207650_10313318 | 3300025925 | Bacteria | 1284 |
| 144 | Ga0207650_10669602 | 3300025925 | Bacteria | 875 |
| 145 | Ga0207659_10021013 | 3300025926 | Bacteria | 4326 |
| 146 | Ga0207687_10142748 | 3300025927 | Bacteria | 1818 |
| 147 | Ga0207644_10000170 | 3300025931 | Bacteria | 46372 |
| 148 | Ga0207690_10138414 | 3300025932 | Bacteria | 1791 |
| 149 | Ga0207690_10472420 | 3300025932 | Bacteria | 1011 |
| 150 | Ga0207690_10838719 | 3300025932 | Bacteria | 761 |
| 151 | Ga0207690_11231251 | 3300025932 | Bacteria | 625 |
| 152 | Ga0207706_10136202 | 3300025933 | Bacteria | 2160 |
| 153 | Ga0207706_11033027 | 3300025933 | Bacteria | 689 |
| 154 | Ga0207709_10962876 | 3300025935 | Bacteria | 696 |
| 155 | Ga0207691_10031662 | 3300025940 | Bacteria | 4935 |
| 156 | Ga0207711_10072735 | 3300025941 | Bacteria | 2987 |
| 157 | Ga0207679_10185494 | 3300025945 | Bacteria | 1724 |
| 158 | Ga0207679_10879483 | 3300025945 | Bacteria | 819 |
| 159 | Ga0207667_10008982 | 3300025949 | Bacteria | 11823 |
| 160 | Ga0207667_10035456 | 3300025949 | Bacteria | 5352 |
| 161 | Ga0207667_10051252 | 3300025949 | Bacteria | 4352 |
| 162 | Ga0207667_11000714 | 3300025949 | Bacteria | 823 |
| 163 | Ga0207712_10360908 | 3300025961 | Bacteria | 1210 |
| 164 | Ga0207712_11167822 | 3300025961 | Bacteria | 686 |
| 165 | Ga0207668_10000024 | 3300025972 | Bacteria | 131871 |
| 166 | Ga0207668_10071492 | 3300025972 | Bacteria | 2478 |
| 167 | Ga0207640_10060669 | 3300025981 | Bacteria | 2501 |
| 168 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 169 | Ga0207658_10000213 | 3300025986 | Bacteria | 60739 |
| 170 | Ga0207658_10452969 | 3300025986 | Bacteria | 1136 |
| 171 | Ga0207703_10001689 | 3300026035 | Bacteria | 19855 |
| 172 | Ga0207703_10007175 | 3300026035 | Bacteria | 8863 |
| 173 | Ga0207703_11115129 | 3300026035 | Bacteria | 758 |
| 174 | Ga0207639_10000220 | 3300026041 | Bacteria | 42726 |
| 175 | Ga0207639_10024208 | 3300026041 | Bacteria | 4391 |
| 176 | Ga0207639_10061065 | 3300026041 | Bacteria | 2909 |
| 177 | Ga0207639_10607912 | 3300026041 | Bacteria | 1009 |
| 178 | Ga0207678_10413599 | 3300026067 | Bacteria | 1169 |
| 179 | Ga0207678_10996338 | 3300026067 | Bacteria | 742 |
| 180 | Ga0207678_11495409 | 3300026067 | Bacteria | 596 |
| 181 | Ga0207702_10014421 | 3300026078 | Bacteria | 6560 |
| 182 | Ga0207702_11270178 | 3300026078 | Bacteria | 730 |
| 183 | Ga0207702_11518007 | 3300026078 | Bacteria | 663 |
| 184 | Ga0207641_10004408 | 3300026088 | Bacteria | 12197 |
| 185 | Ga0207641_10027405 | 3300026088 | Bacteria | 4705 |
| 186 | Ga0207676_10001553 | 3300026095 | Bacteria | 16924 |
| 187 | Ga0207674_10015757 | 3300026116 | Bacteria | 8292 |
| 188 | Ga0207674_10019715 | 3300026116 | Bacteria | 7300 |
| 189 | Ga0207674_10023698 | 3300026116 | Bacteria | 6570 |
| 190 | Ga0207674_10863111 | 3300026116 | Bacteria | 873 |
| 191 | Ga0207675_100016337 | 3300026118 | Bacteria | 6928 |
| 192 | Ga0207675_100394860 | 3300026118 | Bacteria | 1362 |
| 193 | Ga0207683_10025233 | 3300026121 | Bacteria | 5125 |
| 194 | Ga0207698_10019023 | 3300026142 | Bacteria | 4692 |
| 195 | Ga0207698_10020680 | 3300026142 | Bacteria | 4535 |
| 196 | Ga0207698_10299584 | 3300026142 | Bacteria | 1496 |
| 197 | Ga0209974_10002045 | 3300027876 | Bacteria | 7363 |
| 198 | Ga0209974_10134135 | 3300027876 | Bacteria | 884 |
| 199 | Ga0207428_10059040 | 3300027907 | Bacteria | 3042 |
| 200 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 201 | Ga0268265_10000358 | 3300028380 | Bacteria | 49394 |
| 202 | Ga0268265_10019436 | 3300028380 | Bacteria | 4722 |
| 203 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 204 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 205 | Ga0265327_10174363 | 3300031251 | Bacteria | 986 |
| 206 | Ga0307513_10169713 | 3300031456 | Bacteria | 2061 |
| 207 | Ga0307408_100122826 | 3300031548 | Bacteria | 2014 |
| 208 | Ga0307408_101054806 | 3300031548 | Bacteria | 752 |
| 209 | Ga0307508_10020043 | 3300031616 | Bacteria | 6074 |
| 210 | Ga0307405_10000687 | 3300031731 | Bacteria | 13090 |
| 211 | Ga0307405_10113573 | 3300031731 | Bacteria | 1839 |
| 212 | Ga0307405_10224308 | 3300031731 | Bacteria | 1381 |
| 213 | Ga0307405_10471295 | 3300031731 | Bacteria | 1000 |
| 214 | Ga0307413_10177836 | 3300031824 | Bacteria | 1513 |
| 215 | Ga0307410_10060030 | 3300031852 | Bacteria | 2598 |
| 216 | Ga0307410_10071100 | 3300031852 | Bacteria | 2412 |
| 217 | Ga0307406_10033225 | 3300031901 | Bacteria | 3156 |
| 218 | Ga0307406_11453633 | 3300031901 | Bacteria | 602 |
| 219 | Ga0307407_11276838 | 3300031903 | Bacteria | 576 |
| 220 | Ga0307412_10422544 | 3300031911 | Bacteria | 1091 |
| 221 | Ga0307409_100608334 | 3300031995 | Bacteria | 1081 |
| 222 | Ga0307416_100205954 | 3300032002 | Bacteria | 1871 |
| 223 | Ga0307416_100699025 | 3300032002 | Bacteria | 1103 |
| 224 | Ga0307416_101935056 | 3300032002 | Bacteria | 693 |
| 225 | Ga0307414_10039185 | 3300032004 | Bacteria | 3190 |
| 226 | Ga0307414_10128365 | 3300032004 | Bacteria | 1963 |
| 227 | Ga0307414_10217431 | 3300032004 | Bacteria | 1566 |
| 228 | Ga0307414_10297426 | 3300032004 | Bacteria | 1364 |
| 229 | Ga0307414_10355801 | 3300032004 | Bacteria | 1258 |
| 230 | Ga0307411_10042392 | 3300032005 | Bacteria | 2903 |
| 231 | Ga0307411_10194639 | 3300032005 | Bacteria | 1551 |
| 232 | Ga0307411_10247244 | 3300032005 | Bacteria | 1400 |
| 233 | Ga0307415_101167708 | 3300032126 | Bacteria | 724 |
| 234 | Ga0395899_0004135 | 3300037312 | Bacteria | 11414 |
| 235 | Ga0395900_0277988 | 3300037418 | Bacteria | 1667 |
| 236 | Ga0395900_0390322 | 3300037418 | Bacteria | 1358 |
| 237 | Ga0395898_0607544 | 3300037466 | Bacteria | 1036 |
| 238 | Ga0395901_1176523 | 3300038443 | Bacteria | 734 |
| 239 | Ga0451793_1332807 | 3300041452 | Bacteria | 587 |
| 240 | Ga0451806_558808 | 3300041462 | Bacteria | 727 |
| 241 | Ga0439448_0001541 | 3300042005 | Bacteria | 6023 |
| 242 | Ga0439455_0001033 | 3300042012 | Bacteria | 4398 |
| 243 | Ga0439455_0004526 | 3300042012 | Bacteria | 2761 |
| 244 | Ga0450892_009523 | 3300042130 | Bacteria | 841 |
| 245 | Ga0439446_0020707 | 3300042156 | Bacteria | 1854 |
| 246 | Ga0439458_0001791 | 3300042157 | Bacteria | 5345 |
| 247 | Ga0439458_0005023 | 3300042157 | Bacteria | 2990 |
| 248 | Ga0466965_0044219 | 3300044683 | Bacteria | 2200 |
| 249 | Ga0466961_0000685 | 3300044693 | Bacteria | 21410 |
| 250 | Ga0466957_0297012 | 3300044842 | Bacteria | 1084 |
| 251 | Ga0466959_0003259 | 3300045049 | Bacteria | 10573 |
| 252 | Ga0466958_0009427 | 3300045836 | Bacteria | 5440 |
| 253 | Ga0466967_0335097 | 3300045976 | Bacteria | 1462 |
| 254 | Ga0495627_001122 | 3300046453 | Bacteria | 17400 |
| 255 | Ga0495650_0001724 | 3300046471 | Bacteria | 20022 |
| 256 | Ga0495639_0126358 | 3300046475 | Bacteria | 1222 |
| 257 | Ga0495607_0273437 | 3300046501 | Bacteria | 804 |
| 258 | Ga0495583_0023296 | 3300046506 | Bacteria | 3135 |
| 259 | Ga0495648_0318987 | 3300046524 | Bacteria | 721 |
| 260 | Ga0495633_0084541 | 3300046558 | Unclassified | 1476 |
| 261 | Ga0495625_0114256 | 3300046660 | Bacteria | 1843 |
| 262 | Ga0495687_055204 | 3300047443 | Bacteria | 1662 |
| 263 | Ga0495677_0008628 | 3300047445 | Bacteria | 3784 |
| 264 | Ga0495673_0041907 | 3300047469 | Bacteria | 2058 |
| 265 | Ga0495681_0000472 | 3300047470 | Bacteria | 30863 |
| 266 | Ga0495686_0007875 | 3300047472 | Bacteria | 7915 |
| 267 | Ga0496101_0594737 | 3300048904 | Bacteria | 875 |
| 268 | Ga0496113_1186848 | 3300048916 | Bacteria | 596 |
| 269 | Ga0496117_0027892 | 3300048920 | Bacteria | 4384 |
| 270 | Ga0496118_0035090 | 3300048921 | Bacteria | 4079 |
| 271 | Ga0496118_0114142 | 3300048921 | Bacteria | 1782 |
| 272 | Ga0496120_0067524 | 3300048923 | Bacteria | 1975 |
| 273 | Ga0496121_0000158 | 3300048924 | Bacteria | 148917 |
| 274 | Ga0496121_0016467 | 3300048924 | Bacteria | 7632 |
| 275 | Ga0496121_0019723 | 3300048924 | Bacteria | 6725 |
| 276 | Ga0496121_0244610 | 3300048924 | Bacteria | 1248 |
| 277 | Ga0496124_0145438 | 3300048927 | Bacteria | 1866 |
| 278 | Ga0496125_0066591 | 3300048928 | Bacteria | 2845 |
| 279 | Ga0496125_0313059 | 3300048928 | Bacteria | 956 |
| 280 | Ga0496126_0016057 | 3300048929 | Bacteria | 7507 |
| 281 | Ga0496126_0163620 | 3300048929 | Bacteria | 1900 |
| 282 | Ga0496126_0350193 | 3300048929 | Bacteria | 1208 |
| 283 | Ga0496126_0469795 | 3300048929 | Bacteria | 1010 |
| 284 | Ga0496126_0774742 | 3300048929 | Unclassified | 738 |
| 285 | Ga0496126_1329444 | 3300048929 | Bacteria | 522 |
| 286 | Ga0501031_0920303 | 3300049568 | Bacteria | 559 |
| 287 | Ga0501032_0003860 | 3300049569 | Bacteria | 11378 |
| 288 | Ga0501033_0000720 | 3300049570 | Bacteria | 30337 |
| 289 | Ga0501033_0420824 | 3300049570 | Bacteria | 930 |
| 290 | Ga0501034_0004188 | 3300049571 | Bacteria | 16100 |
| 291 | Ga0501034_1159480 | 3300049571 | Bacteria | 652 |
| 292 | Ga0501036_0004881 | 3300049572 | Bacteria | 10832 |
| 293 | Ga0501037_0002331 | 3300049573 | Bacteria | 13712 |
| 294 | Ga0501038_0004437 | 3300049574 | Bacteria | 13039 |
| 295 | Ga0501039_0039145 | 3300049575 | Bacteria | 3661 |
| 296 | Ga0501043_0052126 | 3300049579 | Bacteria | 3214 |
| 297 | Ga0501046_0006002 | 3300049580 | Bacteria | 10805 |
| 298 | Ga0501046_0814764 | 3300049580 | Bacteria | 654 |
| 299 | Ga0501047_0003486 | 3300049581 | Bacteria | 14871 |
| 300 | Ga0501047_0465739 | 3300049581 | Bacteria | 1092 |
| 301 | Ga0501067_0079487 | 3300049583 | Bacteria | 1817 |
| 302 | Ga0501069_0024847 | 3300049585 | Bacteria | 3271 |
| 303 | Ga0501070_0063599 | 3300049586 | Bacteria | 3056 |
| 304 | Ga0501072_0231557 | 3300049588 | Bacteria | 1472 |
| 305 | Ga0501073_0003125 | 3300049589 | Bacteria | 12413 |
| 306 | Ga0501074_0006172 | 3300049590 | Bacteria | 8650 |
| 307 | Ga0501249_157442 | 3300049679 | Bacteria | 575 |
| 308 | Ga0501080_0002682 | 3300049742 | Bacteria | 15585 |
| 309 | Ga0501083_0051253 | 3300049744 | Bacteria | 2776 |
| 310 | Ga0501241_026838 | 3300049758 | Unclassified | 1075 |
| 311 | Ga0501035_0300848 | 3300049822 | Bacteria | 1351 |
| 312 | Ga0501044_0070339 | 3300049823 | Bacteria | 3559 |
| 313 | Ga0501045_0299340 | 3300049824 | Bacteria | 1197 |
| 314 | nmdc:mga0k408_94001_c1 | 3300050493 | Bacteria | 1763 |
| 315 | nmdc:mga07m45_12319_c2 | 3300050496 | Bacteria | 3868 |
| 316 | nmdc:mga0rr50_1236887_c1 | 3300050513 | Bacteria | 634 |
| 317 | Ga0500643_000548 | 3300053087 | Bacteria | 26252 |
| 318 | Ga0500643_014388 | 3300053087 | Bacteria | 2753 |
| 319 | Ga0500594_0020940 | 3300053118 | Bacteria | 1636 |
| 320 | Ga0500608_000223 | 3300053122 | Bacteria | 22281 |
| 321 | Ga0500614_009487 | 3300053123 | Bacteria | 2077 |
| 322 | Ga0500652_047177 | 3300053131 | Bacteria | 1750 |
| 323 | Ga0500559_0018397 | 3300053136 | Bacteria | 2953 |
| 324 | Ga0500559_0402640 | 3300053136 | Bacteria | 636 |
| 325 | Ga0500564_007099 | 3300053138 | Bacteria | 4726 |
| 326 | Ga0500573_0272477 | 3300053140 | Bacteria | 861 |
| 327 | Ga0500577_0266195 | 3300053142 | Bacteria | 746 |
| 328 | Ga0500624_000100 | 3300053157 | Bacteria | 41296 |
| 329 | Ga0500636_0030944 | 3300053177 | Bacteria | 3167 |
| 330 | Ga0500567_018705 | 3300053723 | Bacteria | 3332 |
| 331 | Ga0500625_000017 | 3300053729 | Bacteria | 96168 |
| 332 | Ga0501082_0020721 | 3300060353 | Bacteria | 5669 |
| 333 | Ga0466962_0375656 | 3300061719 | Bacteria | 710 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025925 | Ga0207650_10669602 | Ga0207650_106696022 | 129 |
| 2 | 3300047445 | Ga0495677_0008628 | Ga0495677_0008628_753_1151 | 132 |
| 3 | iso_pu_bacteria | 2808606379 | 2808940381 | 136 |
| 4 | iso_pu_bacteria | 3003665799 | 3003666191 | 136 |
| 5 | iso_pu_bacteria | 3007872151 | 3007873700 | 136 |
| 6 | iso_pu_bacteria | 2739367664 | 2739649823 | 137 |
| 7 | iso_pu_bacteria | 2739367865 | 2740028296 | 137 |
| 8 | iso_pu_bacteria | 2861691609 | 2861692284 | 137 |
| 9 | iso_pu_bacteria | 2896184354 | 2896185990 | 137 |
| 10 | iso_pu_bacteria | 2946787523 | 2946789715 | 137 |
| 11 | iso_pu_bacteria | 2990265787 | 2990268810 | 137 |
| 12 | iso_pu_bacteria | 2993693658 | 2993694483 | 137 |
| 13 | 3300006058 | Ga0075432_10041751 | Ga0075432_100417511 | 139 |
| 14 | 3300006353 | Ga0075370_10066201 | Ga0075370_100662012 | 139 |
| 15 | 3300007076 | Ga0075435_101311383 | Ga0075435_1013113832 | 139 |
| 16 | 3300027907 | Ga0207428_10059040 | Ga0207428_100590403 | 139 |
| 17 | 3300050513 | nmdc:mga0rr50_1236887_c1 | nmdc:mga0rr50_1236887_c1_158_577 | 139 |
| 18 | 3300005336 | Ga0070680_100977681 | Ga0070680_1009776812 | 140 |
| 19 | 3300005355 | Ga0070671_100876159 | Ga0070671_1008761591 | 140 |
| 20 | 3300005455 | Ga0070663_100676770 | Ga0070663_1006767702 | 140 |
| 21 | 3300005471 | Ga0070698_100259468 | Ga0070698_1002594683 | 140 |
| 22 | 3300005530 | Ga0070679_101144895 | Ga0070679_1011448951 | 140 |
| 23 | 3300005539 | Ga0068853_100288393 | Ga0068853_1002883933 | 140 |
| 24 | 3300005563 | Ga0068855_100000333 | Ga0068855_10000033323 | 140 |
| 25 | 3300005577 | Ga0068857_100024487 | Ga0068857_1000244874 | 140 |
| 26 | 3300005578 | Ga0068854_100021148 | Ga0068854_1000211487 | 140 |
| 27 | 3300005578 | Ga0068854_101192230 | Ga0068854_1011922302 | 140 |
| 28 | 3300005614 | Ga0068856_101464729 | Ga0068856_1014647292 | 140 |
| 29 | 3300009093 | Ga0105240_10010962 | Ga0105240_1001096210 | 140 |
| 30 | 3300009093 | Ga0105240_10070160 | Ga0105240_100701609 | 140 |
| 31 | 3300009174 | Ga0105241_10102057 | Ga0105241_101020572 | 140 |
| 32 | 3300009545 | Ga0105237_10006257 | Ga0105237_100062577 | 140 |
| 33 | 3300009551 | Ga0105238_11470541 | Ga0105238_114705412 | 140 |
| 34 | 3300010375 | Ga0105239_10000438 | Ga0105239_1000043855 | 140 |
| 35 | 3300010375 | Ga0105239_10086519 | Ga0105239_100865193 | 140 |
| 36 | 3300025911 | Ga0207654_10201948 | Ga0207654_102019481 | 140 |
| 37 | 3300025913 | Ga0207695_10040337 | Ga0207695_100403373 | 140 |
| 38 | 3300025913 | Ga0207695_10087579 | Ga0207695_100875794 | 140 |
| 39 | 3300025914 | Ga0207671_10004244 | Ga0207671_100042447 | 140 |
| 40 | 3300025917 | Ga0207660_10588967 | Ga0207660_105889672 | 140 |
| 41 | 3300025919 | Ga0207657_10024261 | Ga0207657_100242616 | 140 |
| 42 | 3300025920 | Ga0207649_10399051 | Ga0207649_103990512 | 140 |
| 43 | 3300025921 | Ga0207652_11000575 | Ga0207652_110005752 | 140 |
| 44 | 3300025924 | Ga0207694_11393873 | Ga0207694_113938731 | 140 |
| 45 | 3300025935 | Ga0207709_10962876 | Ga0207709_109628761 | 140 |
| 46 | 3300025945 | Ga0207679_10879483 | Ga0207679_108794831 | 140 |
| 47 | 3300025949 | Ga0207667_10008982 | Ga0207667_1000898213 | 140 |
| 48 | 3300025981 | Ga0207640_10060669 | Ga0207640_100606693 | 140 |
| 49 | 3300026041 | Ga0207639_10061065 | Ga0207639_100610651 | 140 |
| 50 | 3300026067 | Ga0207678_10996338 | Ga0207678_109963381 | 140 |
| 51 | 3300026078 | Ga0207702_11270178 | Ga0207702_112701781 | 140 |
| 52 | 3300026116 | Ga0207674_10015757 | Ga0207674_100157572 | 140 |
| 53 | 3300027876 | Ga0209974_10002045 | Ga0209974_1000204510 | 140 |
| 54 | 3300031548 | Ga0307408_100122826 | Ga0307408_1001228263 | 140 |
| 55 | 3300031731 | Ga0307405_10113573 | Ga0307405_101135733 | 140 |
| 56 | 3300031824 | Ga0307413_10177836 | Ga0307413_101778363 | 140 |
| 57 | 3300031852 | Ga0307410_10071100 | Ga0307410_100711006 | 140 |
| 58 | 3300031901 | Ga0307406_10033225 | Ga0307406_100332256 | 140 |
| 59 | 3300031995 | Ga0307409_100608334 | Ga0307409_1006083342 | 140 |
| 60 | 3300032002 | Ga0307416_100205954 | Ga0307416_1002059541 | 140 |
| 61 | 3300032002 | Ga0307416_100699025 | Ga0307416_1006990252 | 140 |
| 62 | 3300032004 | Ga0307414_10039185 | Ga0307414_100391855 | 140 |
| 63 | 3300032004 | Ga0307414_10128365 | Ga0307414_101283652 | 140 |
| 64 | 3300032004 | Ga0307414_10217431 | Ga0307414_102174313 | 140 |
| 65 | 3300032004 | Ga0307414_10297426 | Ga0307414_102974261 | 140 |
| 66 | 3300032004 | Ga0307414_10355801 | Ga0307414_103558012 | 140 |
| 67 | 3300032005 | Ga0307411_10042392 | Ga0307411_100423926 | 140 |
| 68 | 3300032005 | Ga0307411_10247244 | Ga0307411_102472442 | 140 |
| 69 | 3300032126 | Ga0307415_101167708 | Ga0307415_1011677082 | 140 |
| 70 | 3300042156 | Ga0439446_0020707 | Ga0439446_0020707_1067_1492 | 140 |
| 71 | 3300048920 | Ga0496117_0027892 | Ga0496117_0027892_3059_3484 | 140 |
| 72 | 3300048921 | Ga0496118_0035090 | Ga0496118_0035090_976_1401 | 140 |
| 73 | 3300048921 | Ga0496118_0114142 | Ga0496118_0114142_157_582 | 140 |
| 74 | 3300048924 | Ga0496121_0016467 | Ga0496121_0016467_1929_2354 | 140 |
| 75 | 3300048924 | Ga0496121_0019723 | Ga0496121_0019723_2102_2527 | 140 |
| 76 | 3300048928 | Ga0496125_0313059 | Ga0496125_0313059_70_492 | 140 |
| 77 | 3300048929 | Ga0496126_0016057 | Ga0496126_0016057_5182_5607 | 140 |
| 78 | 3300048929 | Ga0496126_0774742 | Ga0496126_0774742_205_630 | 140 |
| 79 | 3300049569 | Ga0501032_0003860 | Ga0501032_0003860_7387_7812 | 140 |
| 80 | 3300049570 | Ga0501033_0000720 | Ga0501033_0000720_14584_15009 | 140 |
| 81 | 3300049570 | Ga0501033_0420824 | Ga0501033_0420824_88_513 | 140 |
| 82 | 3300049571 | Ga0501034_0004188 | Ga0501034_0004188_14712_15137 | 140 |
| 83 | 3300049572 | Ga0501036_0004881 | Ga0501036_0004881_5135_5560 | 140 |
| 84 | 3300049573 | Ga0501037_0002331 | Ga0501037_0002331_6105_6530 | 140 |
| 85 | 3300049574 | Ga0501038_0004437 | Ga0501038_0004437_12460_12885 | 140 |
| 86 | 3300049575 | Ga0501039_0039145 | Ga0501039_0039145_139_564 | 140 |
| 87 | 3300049579 | Ga0501043_0052126 | Ga0501043_0052126_2179_2604 | 140 |
| 88 | 3300049580 | Ga0501046_0006002 | Ga0501046_0006002_3560_3985 | 140 |
| 89 | 3300049581 | Ga0501047_0003486 | Ga0501047_0003486_14222_14647 | 140 |
| 90 | 3300049581 | Ga0501047_0465739 | Ga0501047_0465739_222_647 | 140 |
| 91 | 3300049583 | Ga0501067_0079487 | Ga0501067_0079487_19_444 | 140 |
| 92 | 3300049585 | Ga0501069_0024847 | Ga0501069_0024847_827_1252 | 140 |
| 93 | 3300049586 | Ga0501070_0063599 | Ga0501070_0063599_2492_2917 | 140 |
| 94 | 3300049588 | Ga0501072_0231557 | Ga0501072_0231557_54_479 | 140 |
| 95 | 3300049589 | Ga0501073_0003125 | Ga0501073_0003125_1302_1727 | 140 |
| 96 | 3300049590 | Ga0501074_0006172 | Ga0501074_0006172_2590_3015 | 140 |
| 97 | 3300049679 | Ga0501249_157442 | Ga0501249_157442_128_559 | 140 |
| 98 | 3300049742 | Ga0501080_0002682 | Ga0501080_0002682_3503_3928 | 140 |
| 99 | 3300049744 | Ga0501083_0051253 | Ga0501083_0051253_361_786 | 140 |
| 100 | 3300049758 | Ga0501241_026838 | Ga0501241_026838_101_526 | 140 |
| 101 | 3300049822 | Ga0501035_0300848 | Ga0501035_0300848_99_524 | 140 |
| 102 | 3300049823 | Ga0501044_0070339 | Ga0501044_0070339_828_1253 | 140 |
| 103 | 3300049824 | Ga0501045_0299340 | Ga0501045_0299340_85_510 | 140 |
| 104 | 3300053136 | Ga0500559_0402640 | Ga0500559_0402640_83_505 | 140 |
| 105 | 3300060353 | Ga0501082_0020721 | Ga0501082_0020721_4598_5023 | 140 |
| 106 | 3300001990 | JGI24737J22298_10010214 | JGI24737J22298_100102143 | 141 |
| 107 | 3300002067 | JGI24735J21928_10005602 | JGI24735J21928_100056022 | 141 |
| 108 | 3300002459 | JGI24751J29686_10026964 | JGI24751J29686_100269642 | 141 |
| 109 | 3300002741 | JGI25157J39369_1009084 | JGI25157J39369_10090842 | 141 |
| 110 | 3300003214 | JGI25165J46597_1000040 | JGI25165J46597_100004021 | 141 |
| 111 | 3300003762 | Ga0055542_1017717 | Ga0055542_10177172 | 141 |
| 112 | 3300003762 | Ga0055542_1038047 | Ga0055542_10380471 | 141 |
| 113 | 3300003763 | Ga0055529_1009510 | Ga0055529_10095102 | 141 |
| 114 | 3300005327 | Ga0070658_10017406 | Ga0070658_100174068 | 141 |
| 115 | 3300005327 | Ga0070658_10318381 | Ga0070658_103183812 | 141 |
| 116 | 3300005328 | Ga0070676_10064052 | Ga0070676_100640522 | 141 |
| 117 | 3300005331 | Ga0070670_100009377 | Ga0070670_1000093778 | 141 |
| 118 | 3300005331 | Ga0070670_100174906 | Ga0070670_1001749061 | 141 |
| 119 | 3300005335 | Ga0070666_10093098 | Ga0070666_100930982 | 141 |
| 120 | 3300005335 | Ga0070666_10160913 | Ga0070666_101609132 | 141 |
| 121 | 3300005335 | Ga0070666_11261076 | Ga0070666_112610761 | 141 |
| 122 | 3300005337 | Ga0070682_100718943 | Ga0070682_1007189432 | 141 |
| 123 | 3300005337 | Ga0070682_100788244 | Ga0070682_1007882442 | 141 |
| 124 | 3300005339 | Ga0070660_100002182 | Ga0070660_10000218212 | 141 |
| 125 | 3300005339 | Ga0070660_100103332 | Ga0070660_1001033321 | 141 |
| 126 | 3300005339 | Ga0070660_100986734 | Ga0070660_1009867341 | 141 |
| 127 | 3300005339 | Ga0070660_101266608 | Ga0070660_1012666081 | 141 |
| 128 | 3300005344 | Ga0070661_100309293 | Ga0070661_1003092932 | 141 |
| 129 | 3300005347 | Ga0070668_100000031 | Ga0070668_10000003133 | 141 |
| 130 | 3300005347 | Ga0070668_100388973 | Ga0070668_1003889732 | 141 |
| 131 | 3300005353 | Ga0070669_100054146 | Ga0070669_1000541461 | 141 |
| 132 | 3300005353 | Ga0070669_100055501 | Ga0070669_1000555013 | 141 |
| 133 | 3300005354 | Ga0070675_100017835 | Ga0070675_1000178357 | 141 |
| 134 | 3300005355 | Ga0070671_100000265 | Ga0070671_1000002654 | 141 |
| 135 | 3300005366 | Ga0070659_100034224 | Ga0070659_1000342243 | 141 |
| 136 | 3300005366 | Ga0070659_100070098 | Ga0070659_1000700983 | 141 |
| 137 | 3300005366 | Ga0070659_100096446 | Ga0070659_1000964462 | 141 |
| 138 | 3300005366 | Ga0070659_100386927 | Ga0070659_1003869272 | 141 |
| 139 | 3300005366 | Ga0070659_100553703 | Ga0070659_1005537031 | 141 |
| 140 | 3300005367 | Ga0070667_100000004 | Ga0070667_10000000433 | 141 |
| 141 | 3300005367 | Ga0070667_100000016 | Ga0070667_100000016244 | 141 |
| 142 | 3300005455 | Ga0070663_100394814 | Ga0070663_1003948142 | 141 |
| 143 | 3300005456 | Ga0070678_100299181 | Ga0070678_1002991812 | 141 |
| 144 | 3300005457 | Ga0070662_100048470 | Ga0070662_1000484702 | 141 |
| 145 | 3300005457 | Ga0070662_100233401 | Ga0070662_1002334014 | 141 |
| 146 | 3300005535 | Ga0070684_100472480 | Ga0070684_1004724801 | 141 |
| 147 | 3300005539 | Ga0068853_100002170 | Ga0068853_10000217014 | 141 |
| 148 | 3300005539 | Ga0068853_102260034 | Ga0068853_1022600341 | 141 |
| 149 | 3300005548 | Ga0070665_100000024 | Ga0070665_100000024296 | 141 |
| 150 | 3300005563 | Ga0068855_100000954 | Ga0068855_10000095426 | 141 |
| 151 | 3300005563 | Ga0068855_100093622 | Ga0068855_1000936222 | 141 |
| 152 | 3300005563 | Ga0068855_100302261 | Ga0068855_1003022613 | 141 |
| 153 | 3300005563 | Ga0068855_100441044 | Ga0068855_1004410441 | 141 |
| 154 | 3300005564 | Ga0070664_100117765 | Ga0070664_1001177652 | 141 |
| 155 | 3300005577 | Ga0068857_100014552 | Ga0068857_1000145529 | 141 |
| 156 | 3300005577 | Ga0068857_100034750 | Ga0068857_1000347503 | 141 |
| 157 | 3300005577 | Ga0068857_100230799 | Ga0068857_1002307992 | 141 |
| 158 | 3300005577 | Ga0068857_102155877 | Ga0068857_1021558771 | 141 |
| 159 | 3300005616 | Ga0068852_100019458 | Ga0068852_1000194582 | 141 |
| 160 | 3300005616 | Ga0068852_100077003 | Ga0068852_1000770035 | 141 |
| 161 | 3300005616 | Ga0068852_100373423 | Ga0068852_1003734232 | 141 |
| 162 | 3300005616 | Ga0068852_101867650 | Ga0068852_1018676501 | 141 |
| 163 | 3300005617 | Ga0068859_100016599 | Ga0068859_1000165998 | 141 |
| 164 | 3300005618 | Ga0068864_100007001 | Ga0068864_1000070018 | 141 |
| 165 | 3300005719 | Ga0068861_100008877 | Ga0068861_1000088776 | 141 |
| 166 | 3300005719 | Ga0068861_100367255 | Ga0068861_1003672552 | 141 |
| 167 | 3300005842 | Ga0068858_100000771 | Ga0068858_10000077125 | 141 |
| 168 | 3300005843 | Ga0068860_100000002 | Ga0068860_10000000218 | 141 |
| 169 | 3300005843 | Ga0068860_100000256 | Ga0068860_10000025673 | 141 |
| 170 | 3300005844 | Ga0068862_100000721 | Ga0068862_10000072118 | 141 |
| 171 | 3300005844 | Ga0068862_100000928 | Ga0068862_1000009288 | 141 |
| 172 | 3300006195 | Ga0075366_10047608 | Ga0075366_100476082 | 141 |
| 173 | 3300006237 | Ga0097621_100197883 | Ga0097621_1001978833 | 141 |
| 174 | 3300006353 | Ga0075370_10003378 | Ga0075370_100033782 | 141 |
| 175 | 3300006931 | Ga0097620_100016599 | Ga0097620_1000165993 | 141 |
| 176 | 3300009093 | Ga0105240_10156274 | Ga0105240_101562742 | 141 |
| 177 | 3300009093 | Ga0105240_11175618 | Ga0105240_111756181 | 141 |
| 178 | 3300009093 | Ga0105240_11819406 | Ga0105240_118194062 | 141 |
| 179 | 3300009148 | Ga0105243_10821933 | Ga0105243_108219332 | 141 |
| 180 | 3300009177 | Ga0105248_10039358 | Ga0105248_100393582 | 141 |
| 181 | 3300009553 | Ga0105249_10624713 | Ga0105249_106247132 | 141 |
| 182 | 3300010375 | Ga0105239_10252287 | Ga0105239_102522873 | 141 |
| 183 | 3300010375 | Ga0105239_10954796 | Ga0105239_109547961 | 141 |
| 184 | 3300013102 | Ga0157371_10151961 | Ga0157371_101519613 | 141 |
| 185 | 3300013104 | Ga0157370_10002056 | Ga0157370_1000205621 | 141 |
| 186 | 3300013105 | Ga0157369_10181650 | Ga0157369_101816502 | 141 |
| 187 | 3300013306 | Ga0163162_10004509 | Ga0163162_1000450913 | 141 |
| 188 | 3300013306 | Ga0163162_10159106 | Ga0163162_101591063 | 141 |
| 189 | 3300013306 | Ga0163162_11559218 | Ga0163162_115592181 | 141 |
| 190 | 3300013307 | Ga0157372_11373678 | Ga0157372_113736781 | 141 |
| 191 | 3300022467 | Ga0224712_10252504 | Ga0224712_102525041 | 141 |
| 192 | 3300025231 | Ga0207427_100661 | Ga0207427_10066114 | 141 |
| 193 | 3300025250 | Ga0209026_1000440 | Ga0209026_100044032 | 141 |
| 194 | 3300025254 | Ga0209148_1000457 | Ga0209148_100045728 | 141 |
| 195 | 3300025254 | Ga0209148_1001408 | Ga0209148_10014088 | 141 |
| 196 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003462 | 141 |
| 197 | 3300025272 | Ga0209455_1000848 | Ga0209455_100084814 | 141 |
| 198 | 3300025315 | Ga0207697_10021626 | Ga0207697_100216263 | 141 |
| 199 | 3300025903 | Ga0207680_10078841 | Ga0207680_100788413 | 141 |
| 200 | 3300025903 | Ga0207680_10442242 | Ga0207680_104422422 | 141 |
| 201 | 3300025904 | Ga0207647_10008761 | Ga0207647_100087619 | 141 |
| 202 | 3300025904 | Ga0207647_10059157 | Ga0207647_100591572 | 141 |
| 203 | 3300025904 | Ga0207647_10077900 | Ga0207647_100779002 | 141 |
| 204 | 3300025904 | Ga0207647_10126814 | Ga0207647_101268142 | 141 |
| 205 | 3300025907 | Ga0207645_10122635 | Ga0207645_101226352 | 141 |
| 206 | 3300025909 | Ga0207705_10001476 | Ga0207705_1000147620 | 141 |
| 207 | 3300025909 | Ga0207705_10274002 | Ga0207705_102740022 | 141 |
| 208 | 3300025913 | Ga0207695_10019508 | Ga0207695_100195083 | 141 |
| 209 | 3300025913 | Ga0207695_10497492 | Ga0207695_104974922 | 141 |
| 210 | 3300025919 | Ga0207657_10010927 | Ga0207657_100109279 | 141 |
| 211 | 3300025919 | Ga0207657_10025068 | Ga0207657_100250689 | 141 |
| 212 | 3300025919 | Ga0207657_10068468 | Ga0207657_100684684 | 141 |
| 213 | 3300025919 | Ga0207657_10257601 | Ga0207657_102576012 | 141 |
| 214 | 3300025920 | Ga0207649_10077148 | Ga0207649_100771483 | 141 |
| 215 | 3300025923 | Ga0207681_10010266 | Ga0207681_100102666 | 141 |
| 216 | 3300025923 | Ga0207681_10013486 | Ga0207681_100134867 | 141 |
| 217 | 3300025925 | Ga0207650_10008025 | Ga0207650_100080257 | 141 |
| 218 | 3300025925 | Ga0207650_10313318 | Ga0207650_103133181 | 141 |
| 219 | 3300025926 | Ga0207659_10021013 | Ga0207659_100210134 | 141 |
| 220 | 3300025927 | Ga0207687_10142748 | Ga0207687_101427481 | 141 |
| 221 | 3300025931 | Ga0207644_10000170 | Ga0207644_1000017017 | 141 |
| 222 | 3300025932 | Ga0207690_10138414 | Ga0207690_101384141 | 141 |
| 223 | 3300025932 | Ga0207690_10472420 | Ga0207690_104724202 | 141 |
| 224 | 3300025932 | Ga0207690_10838719 | Ga0207690_108387191 | 141 |
| 225 | 3300025932 | Ga0207690_11231251 | Ga0207690_112312511 | 141 |
| 226 | 3300025933 | Ga0207706_10136202 | Ga0207706_101362022 | 141 |
| 227 | 3300025933 | Ga0207706_11033027 | Ga0207706_110330272 | 141 |
| 228 | 3300025940 | Ga0207691_10031662 | Ga0207691_100316623 | 141 |
| 229 | 3300025941 | Ga0207711_10072735 | Ga0207711_100727354 | 141 |
| 230 | 3300025945 | Ga0207679_10185494 | Ga0207679_101854942 | 141 |
| 231 | 3300025949 | Ga0207667_10035456 | Ga0207667_100354562 | 141 |
| 232 | 3300025949 | Ga0207667_10051252 | Ga0207667_100512522 | 141 |
| 233 | 3300025949 | Ga0207667_11000714 | Ga0207667_110007142 | 141 |
| 234 | 3300025961 | Ga0207712_10360908 | Ga0207712_103609082 | 141 |
| 235 | 3300025961 | Ga0207712_11167822 | Ga0207712_111678221 | 141 |
| 236 | 3300025972 | Ga0207668_10000024 | Ga0207668_1000002432 | 141 |
| 237 | 3300025972 | Ga0207668_10071492 | Ga0207668_100714924 | 141 |
| 238 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002325 | 141 |
| 239 | 3300025986 | Ga0207658_10000213 | Ga0207658_1000021326 | 141 |
| 240 | 3300025986 | Ga0207658_10452969 | Ga0207658_104529692 | 141 |
| 241 | 3300026035 | Ga0207703_10001689 | Ga0207703_1000168915 | 141 |
| 242 | 3300026035 | Ga0207703_10007175 | Ga0207703_100071754 | 141 |
| 243 | 3300026035 | Ga0207703_11115129 | Ga0207703_111151291 | 141 |
| 244 | 3300026041 | Ga0207639_10000220 | Ga0207639_100002208 | 141 |
| 245 | 3300026041 | Ga0207639_10024208 | Ga0207639_100242082 | 141 |
| 246 | 3300026041 | Ga0207639_10607912 | Ga0207639_106079122 | 141 |
| 247 | 3300026067 | Ga0207678_10413599 | Ga0207678_104135992 | 141 |
| 248 | 3300026067 | Ga0207678_11495409 | Ga0207678_114954091 | 141 |
| 249 | 3300026078 | Ga0207702_10014421 | Ga0207702_100144218 | 141 |
| 250 | 3300026078 | Ga0207702_11518007 | Ga0207702_115180071 | 141 |
| 251 | 3300026088 | Ga0207641_10004408 | Ga0207641_100044088 | 141 |
| 252 | 3300026088 | Ga0207641_10027405 | Ga0207641_100274057 | 141 |
| 253 | 3300026095 | Ga0207676_10001553 | Ga0207676_100015535 | 141 |
| 254 | 3300026116 | Ga0207674_10019715 | Ga0207674_100197155 | 141 |
| 255 | 3300026116 | Ga0207674_10023698 | Ga0207674_100236983 | 141 |
| 256 | 3300026116 | Ga0207674_10863111 | Ga0207674_108631112 | 141 |
| 257 | 3300026118 | Ga0207675_100016337 | Ga0207675_1000163376 | 141 |
| 258 | 3300026118 | Ga0207675_100394860 | Ga0207675_1003948602 | 141 |
| 259 | 3300026121 | Ga0207683_10025233 | Ga0207683_100252332 | 141 |
| 260 | 3300026142 | Ga0207698_10019023 | Ga0207698_100190232 | 141 |
| 261 | 3300026142 | Ga0207698_10020680 | Ga0207698_100206804 | 141 |
| 262 | 3300026142 | Ga0207698_10299584 | Ga0207698_102995844 | 141 |
| 263 | 3300027876 | Ga0209974_10134135 | Ga0209974_101341351 | 141 |
| 264 | 3300028379 | Ga0268266_10000019 | Ga0268266_1000001973 | 141 |
| 265 | 3300028380 | Ga0268265_10000358 | Ga0268265_1000035832 | 141 |
| 266 | 3300028380 | Ga0268265_10019436 | Ga0268265_100194362 | 141 |
| 267 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001650 | 141 |
| 268 | 3300028381 | Ga0268264_10000087 | Ga0268264_10000087246 | 141 |
| 269 | 3300031251 | Ga0265327_10174363 | Ga0265327_101743632 | 141 |
| 270 | 3300031456 | Ga0307513_10169713 | Ga0307513_101697131 | 141 |
| 271 | 3300031548 | Ga0307408_101054806 | Ga0307408_1010548061 | 141 |
| 272 | 3300031616 | Ga0307508_10020043 | Ga0307508_100200437 | 141 |
| 273 | 3300031731 | Ga0307405_10000687 | Ga0307405_1000068714 | 141 |
| 274 | 3300031731 | Ga0307405_10224308 | Ga0307405_102243082 | 141 |
| 275 | 3300031731 | Ga0307405_10471295 | Ga0307405_104712952 | 141 |
| 276 | 3300031852 | Ga0307410_10060030 | Ga0307410_100600301 | 141 |
| 277 | 3300031901 | Ga0307406_11453633 | Ga0307406_114536331 | 141 |
| 278 | 3300031903 | Ga0307407_11276838 | Ga0307407_112768381 | 141 |
| 279 | 3300031911 | Ga0307412_10422544 | Ga0307412_104225442 | 141 |
| 280 | 3300032002 | Ga0307416_101935056 | Ga0307416_1019350561 | 141 |
| 281 | 3300032005 | Ga0307411_10194639 | Ga0307411_101946393 | 141 |
| 282 | 3300037312 | Ga0395899_0004135 | Ga0395899_0004135_10337_10762 | 141 |
| 283 | 3300037418 | Ga0395900_0277988 | Ga0395900_0277988_604_1029 | 141 |
| 284 | 3300037418 | Ga0395900_0390322 | Ga0395900_0390322_76_513 | 141 |
| 285 | 3300037466 | Ga0395898_0607544 | Ga0395898_0607544_518_943 | 141 |
| 286 | 3300038443 | Ga0395901_1176523 | Ga0395901_1176523_44_469 | 141 |
| 287 | 3300041452 | Ga0451793_1332807 | Ga0451793_1332807_52_477 | 141 |
| 288 | 3300041462 | Ga0451806_558808 | Ga0451806_558808_142_570 | 141 |
| 289 | 3300042005 | Ga0439448_0001541 | Ga0439448_0001541_2292_2717 | 141 |
| 290 | 3300042012 | Ga0439455_0001033 | Ga0439455_0001033_3137_3562 | 141 |
| 291 | 3300042012 | Ga0439455_0004526 | Ga0439455_0004526_782_1207 | 141 |
| 292 | 3300042130 | Ga0450892_009523 | Ga0450892_009523_112_543 | 141 |
| 293 | 3300042157 | Ga0439458_0001791 | Ga0439458_0001791_2076_2501 | 141 |
| 294 | 3300042157 | Ga0439458_0005023 | Ga0439458_0005023_828_1253 | 141 |
| 295 | 3300044683 | Ga0466965_0044219 | Ga0466965_0044219_1751_2179 | 141 |
| 296 | 3300044693 | Ga0466961_0000685 | Ga0466961_0000685_915_1343 | 141 |
| 297 | 3300044842 | Ga0466957_0297012 | Ga0466957_0297012_648_1073 | 141 |
| 298 | 3300045049 | Ga0466959_0003259 | Ga0466959_0003259_5715_6143 | 141 |
| 299 | 3300045836 | Ga0466958_0009427 | Ga0466958_0009427_1276_1704 | 141 |
| 300 | 3300045976 | Ga0466967_0335097 | Ga0466967_0335097_616_1041 | 141 |
| 301 | 3300046453 | Ga0495627_001122 | Ga0495627_001122_15747_16175 | 141 |
| 302 | 3300046471 | Ga0495650_0001724 | Ga0495650_0001724_14701_15129 | 141 |
| 303 | 3300046475 | Ga0495639_0126358 | Ga0495639_0126358_709_1137 | 141 |
| 304 | 3300046501 | Ga0495607_0273437 | Ga0495607_0273437_75_500 | 141 |
| 305 | 3300046506 | Ga0495583_0023296 | Ga0495583_0023296_2677_3105 | 141 |
| 306 | 3300046524 | Ga0495648_0318987 | Ga0495648_0318987_161_589 | 141 |
| 307 | 3300046558 | Ga0495633_0084541 | Ga0495633_0084541_51_479 | 141 |
| 308 | 3300046660 | Ga0495625_0114256 | Ga0495625_0114256_1301_1729 | 141 |
| 309 | 3300047443 | Ga0495687_055204 | Ga0495687_055204_1087_1515 | 141 |
| 310 | 3300047469 | Ga0495673_0041907 | Ga0495673_0041907_1537_1965 | 141 |
| 311 | 3300047470 | Ga0495681_0000472 | Ga0495681_0000472_15735_16163 | 141 |
| 312 | 3300047472 | Ga0495686_0007875 | Ga0495686_0007875_4249_4677 | 141 |
| 313 | 3300048904 | Ga0496101_0594737 | Ga0496101_0594737_427_855 | 141 |
| 314 | 3300048916 | Ga0496113_1186848 | Ga0496113_1186848_98_523 | 141 |
| 315 | 3300048923 | Ga0496120_0067524 | Ga0496120_0067524_438_893 | 141 |
| 316 | 3300048924 | Ga0496121_0000158 | Ga0496121_0000158_90674_91099 | 141 |
| 317 | 3300048924 | Ga0496121_0244610 | Ga0496121_0244610_700_1125 | 141 |
| 318 | 3300048927 | Ga0496124_0145438 | Ga0496124_0145438_889_1314 | 141 |
| 319 | 3300048928 | Ga0496125_0066591 | Ga0496125_0066591_1306_1731 | 141 |
| 320 | 3300048929 | Ga0496126_0163620 | Ga0496126_0163620_1239_1757 | 141 |
| 321 | 3300048929 | Ga0496126_0350193 | Ga0496126_0350193_703_1131 | 141 |
| 322 | 3300048929 | Ga0496126_0469795 | Ga0496126_0469795_539_964 | 141 |
| 323 | 3300048929 | Ga0496126_1329444 | Ga0496126_1329444_63_488 | 141 |
| 324 | 3300049568 | Ga0501031_0920303 | Ga0501031_0920303_32_463 | 141 |
| 325 | 3300049571 | Ga0501034_1159480 | Ga0501034_1159480_50_481 | 141 |
| 326 | 3300049580 | Ga0501046_0814764 | Ga0501046_0814764_119_547 | 141 |
| 327 | 3300050493 | nmdc:mga0k408_94001_c1 | nmdc:mga0k408_94001_c1_972_1397 | 141 |
| 328 | 3300050496 | nmdc:mga07m45_12319_c2 | nmdc:mga07m45_12319_c2_3081_3506 | 141 |
| 329 | 3300053087 | Ga0500643_000548 | Ga0500643_000548_22210_22638 | 141 |
| 330 | 3300053087 | Ga0500643_014388 | Ga0500643_014388_1254_1682 | 141 |
| 331 | 3300053118 | Ga0500594_0020940 | Ga0500594_0020940_555_983 | 141 |
| 332 | 3300053122 | Ga0500608_000223 | Ga0500608_000223_13083_13511 | 141 |
| 333 | 3300053123 | Ga0500614_009487 | Ga0500614_009487_233_661 | 141 |
| 334 | 3300053131 | Ga0500652_047177 | Ga0500652_047177_698_1126 | 141 |
| 335 | 3300053136 | Ga0500559_0018397 | Ga0500559_0018397_1038_1466 | 141 |
| 336 | 3300053138 | Ga0500564_007099 | Ga0500564_007099_1393_1821 | 141 |
| 337 | 3300053140 | Ga0500573_0272477 | Ga0500573_0272477_133_561 | 141 |
| 338 | 3300053142 | Ga0500577_0266195 | Ga0500577_0266195_177_605 | 141 |
| 339 | 3300053157 | Ga0500624_000100 | Ga0500624_000100_10633_11061 | 141 |
| 340 | 3300053177 | Ga0500636_0030944 | Ga0500636_0030944_929_1357 | 141 |
| 341 | 3300053723 | Ga0500567_018705 | Ga0500567_018705_1418_1846 | 141 |
| 342 | 3300053729 | Ga0500625_000017 | Ga0500625_000017_13282_13710 | 141 |
| 343 | 3300061719 | Ga0466962_0375656 | Ga0466962_0375656_84_512 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nye-assembly2.cif.gz_C | crystal structure of osmc from e. coli | 0.9772 | 1 | 141 |
| 1nye-assembly3.cif.gz_F | crystal structure of osmc from e. coli | 0.977 | 1 | 141 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.975 | 1 | 141 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.9748 | 1 | 141 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9741 | 1 | 141 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9784 | 1 | 141 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9716 | 1 | 141 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9252 | 2 | 141 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9189 | 2 | 141 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9154 | 5 | 141 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q2IUN9-F1-model_v4 | OsmC family peroxiredoxin | 0.9964 | 2 | 141 |
GO:0004601
GO:0006979 |
| AF-A0A6J4U590-F1-model_v4 | Peroxiredoxin OsmC (EC 1.11.1.15) | 0.9949 | 1 | 141 |
GO:0004601
GO:0006979 |
| AF-A0A4Q3U8V3-F1-model_v4 | deleted | 0.9896 | 2 | 65 |
|
| AF-A0A7W6SJG2-F1-model_v4 | Osmotically inducible protein OsmC | 0.9894 | 2 | 141 |
GO:0004601
GO:0006979 |
| AF-A0A0Q7D4B0-F1-model_v4 | Osmotically inducible protein OsmC | 0.9879 | 2 | 141 |
GO:0004601
GO:0006979 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar