F415648

General Info

Members Datasets Scaffolds Average Seq Length
343 216 333 142

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100608334|Ga0307409_1006083342
Length 165
Sequence MTVNTATARYEGLGKAGRGHVASKSGVIDAPFGFGTRFEGQPGTNPEEMIAAAHASCFTMAASLALAGAGNSDGTLETACQVTLDKDGAGFAVTRSALKLTANVPGIDRAELERLAGEAKAGCPISKLLNCEITLPASARGFAASRLSPERRRRICSWSDRHSPG

Samples

Sample ID Description Type Environment
1 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
2 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
3 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
4 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
5 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
6 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
7 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
8 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
9 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
10 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
142 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
143 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
144 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
205 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
209 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
210 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
211 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
214 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.79
Metatranscriptomes 0.29
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 8.45
Nodule 0
Rhizoplane 1.17
Rhizosphere 82.8
Stem 0
Stem Tuber 0
Unclassified 7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10010214 3300001990 Bacteria 3103
2 JGI24735J21928_10005602 3300002067 Bacteria 4158
3 JGI24751J29686_10026964 3300002459 Bacteria 1192
4 JGI25157J39369_1009084 3300002741 Bacteria 1352
5 JGI25165J46597_1000040 3300003214 Bacteria 277491
6 Ga0055542_1017717 3300003762 Bacteria 1096
7 Ga0055542_1038047 3300003762 Bacteria 579
8 Ga0055529_1009510 3300003763 Bacteria 1273
9 Ga0070658_10017406 3300005327 Bacteria 5751
10 Ga0070658_10318381 3300005327 Bacteria 1328
11 Ga0070676_10064052 3300005328 Bacteria 2191
12 Ga0070670_100009377 3300005331 Bacteria 8355
13 Ga0070670_100174906 3300005331 Bacteria 1863
14 Ga0070666_10093098 3300005335 Bacteria 2072
15 Ga0070666_10160913 3300005335 Bacteria 1569
16 Ga0070666_11261076 3300005335 Bacteria 551
17 Ga0070680_100977681 3300005336 Bacteria 731
18 Ga0070682_100718943 3300005337 Bacteria 803
19 Ga0070682_100788244 3300005337 Bacteria 771
20 Ga0070660_100002182 3300005339 Bacteria 13496
21 Ga0070660_100103332 3300005339 Bacteria 2260
22 Ga0070660_100986734 3300005339 Bacteria 711
23 Ga0070660_101266608 3300005339 Bacteria 625
24 Ga0070661_100309293 3300005344 Bacteria 1232
25 Ga0070668_100000031 3300005347 Bacteria 87761
26 Ga0070668_100388973 3300005347 Bacteria 1188
27 Ga0070669_100054146 3300005353 Bacteria 2938
28 Ga0070669_100055501 3300005353 Bacteria 2903
29 Ga0070675_100017835 3300005354 Bacteria 5647
30 Ga0070671_100000265 3300005355 Bacteria 35316
31 Ga0070671_100876159 3300005355 Bacteria 784
32 Ga0070659_100034224 3300005366 Bacteria 3951
33 Ga0070659_100070098 3300005366 Bacteria 2784
34 Ga0070659_100096446 3300005366 Bacteria 2376
35 Ga0070659_100386927 3300005366 Bacteria 1179
36 Ga0070659_100553703 3300005366 Bacteria 985
37 Ga0070667_100000004 3300005367 Bacteria 444091
38 Ga0070667_100000016 3300005367 Bacteria 237028
39 Ga0070663_100394814 3300005455 Bacteria 1129
40 Ga0070663_100676770 3300005455 Bacteria 875
41 Ga0070678_100299181 3300005456 Bacteria 1367
42 Ga0070662_100048470 3300005457 Bacteria 3060
43 Ga0070662_100233401 3300005457 Bacteria 1473
44 Ga0070698_100259468 3300005471 Bacteria 1670
45 Ga0070679_101144895 3300005530 Bacteria 723
46 Ga0070684_100472480 3300005535 Bacteria 1160
47 Ga0068853_100002170 3300005539 Bacteria 14611
48 Ga0068853_100288393 3300005539 Bacteria 1514
49 Ga0068853_102260034 3300005539 Bacteria 527
50 Ga0070665_100000024 3300005548 Bacteria 374559
51 Ga0068855_100000333 3300005563 Bacteria 58773
52 Ga0068855_100000954 3300005563 Bacteria 36005
53 Ga0068855_100093622 3300005563 Bacteria 3465
54 Ga0068855_100302261 3300005563 Bacteria 1772
55 Ga0068855_100441044 3300005563 Bacteria 1422
56 Ga0070664_100117765 3300005564 Bacteria 2323
57 Ga0068857_100014552 3300005577 Bacteria 6863
58 Ga0068857_100024487 3300005577 Bacteria 5314
59 Ga0068857_100034750 3300005577 Bacteria 4459
60 Ga0068857_100230799 3300005577 Bacteria 1693
61 Ga0068857_102155877 3300005577 Bacteria 547
62 Ga0068854_100021148 3300005578 Bacteria 4412
63 Ga0068854_101192230 3300005578 Bacteria 682
64 Ga0068856_101464729 3300005614 Bacteria 697
65 Ga0068852_100019458 3300005616 Bacteria 5374
66 Ga0068852_100077003 3300005616 Bacteria 2947
67 Ga0068852_100373423 3300005616 Bacteria 1397
68 Ga0068852_101867650 3300005616 Bacteria 623
69 Ga0068859_100016599 3300005617 Bacteria 7393
70 Ga0068864_100007001 3300005618 Bacteria 9253
71 Ga0068861_100008877 3300005719 Bacteria 6928
72 Ga0068861_100367255 3300005719 Bacteria 1267
73 Ga0068858_100000771 3300005842 Bacteria 33416
74 Ga0068860_100000002 3300005843 Bacteria 627849
75 Ga0068860_100000256 3300005843 Bacteria 78477
76 Ga0068862_100000721 3300005844 Bacteria 33533
77 Ga0068862_100000928 3300005844 Bacteria 28369
78 Ga0075432_10041751 3300006058 Bacteria 1603
79 Ga0075366_10047608 3300006195 Bacteria 2542
80 Ga0097621_100197883 3300006237 Bacteria 1743
81 Ga0075370_10003378 3300006353 Bacteria 7584
82 Ga0075370_10066201 3300006353 Bacteria 2061
83 Ga0097620_100016599 3300006931 Bacteria 7393
84 Ga0075435_101311383 3300007076 Bacteria 634
85 Ga0105240_10010962 3300009093 Bacteria 12697
86 Ga0105240_10070160 3300009093 Bacteria 4335
87 Ga0105240_10156274 3300009093 Bacteria 2712
88 Ga0105240_11175618 3300009093 Bacteria 813
89 Ga0105240_11819406 3300009093 Bacteria 634
90 Ga0105243_10821933 3300009148 Bacteria 918
91 Ga0105241_10102057 3300009174 Bacteria 2282
92 Ga0105248_10039358 3300009177 Bacteria 5294
93 Ga0105237_10006257 3300009545 Bacteria 13250
94 Ga0105238_11470541 3300009551 Bacteria 709
95 Ga0105249_10624713 3300009553 Bacteria 1133
96 Ga0105239_10000438 3300010375 Bacteria 60788
97 Ga0105239_10086519 3300010375 Bacteria 3455
98 Ga0105239_10252287 3300010375 Bacteria 1982
99 Ga0105239_10954796 3300010375 Bacteria 985
100 Ga0157371_10151961 3300013102 Bacteria 1651
101 Ga0157370_10002056 3300013104 Bacteria 24667
102 Ga0157369_10181650 3300013105 Bacteria 2213
103 Ga0163162_10004509 3300013306 Bacteria 13410
104 Ga0163162_10159106 3300013306 Bacteria 2380
105 Ga0163162_11559218 3300013306 Bacteria 753
106 Ga0157372_11373678 3300013307 Bacteria 814
107 Ga0224712_10252504 3300022467 Bacteria 815
108 Ga0207427_100661 3300025231 Bacteria 16569
109 Ga0209026_1000440 3300025250 Bacteria 33927
110 Ga0209148_1000457 3300025254 Bacteria 44291
111 Ga0209148_1001408 3300025254 Bacteria 12369
112 Ga0209233_1000003 3300025261 Bacteria 1607366
113 Ga0209455_1000848 3300025272 Bacteria 16337
114 Ga0207697_10021626 3300025315 Bacteria 2634
115 Ga0207680_10078841 3300025903 Bacteria 2064
116 Ga0207680_10442242 3300025903 Bacteria 922
117 Ga0207647_10008761 3300025904 Bacteria 7223
118 Ga0207647_10059157 3300025904 Bacteria 2345
119 Ga0207647_10077900 3300025904 Bacteria 1992
120 Ga0207647_10126814 3300025904 Bacteria 1502
121 Ga0207645_10122635 3300025907 Bacteria 1688
122 Ga0207705_10001476 3300025909 Bacteria 18730
123 Ga0207705_10274002 3300025909 Bacteria 1291
124 Ga0207654_10201948 3300025911 Bacteria 1309
125 Ga0207695_10019508 3300025913 Bacteria 7806
126 Ga0207695_10040337 3300025913 Bacteria 5008
127 Ga0207695_10087579 3300025913 Bacteria 3137
128 Ga0207695_10497492 3300025913 Bacteria 1101
129 Ga0207671_10004244 3300025914 Bacteria 13805
130 Ga0207660_10588967 3300025917 Bacteria 906
131 Ga0207657_10010927 3300025919 Bacteria 9031
132 Ga0207657_10024261 3300025919 Bacteria 5624
133 Ga0207657_10025068 3300025919 Bacteria 5508
134 Ga0207657_10068468 3300025919 Bacteria 3015
135 Ga0207657_10257601 3300025919 Bacteria 1389
136 Ga0207649_10077148 3300025920 Bacteria 2146
137 Ga0207649_10399051 3300025920 Bacteria 1029
138 Ga0207652_11000575 3300025921 Bacteria 735
139 Ga0207681_10010266 3300025923 Bacteria 5734
140 Ga0207681_10013486 3300025923 Bacteria 5059
141 Ga0207694_11393873 3300025924 Bacteria 592
142 Ga0207650_10008025 3300025925 Bacteria 7194
143 Ga0207650_10313318 3300025925 Bacteria 1284
144 Ga0207650_10669602 3300025925 Bacteria 875
145 Ga0207659_10021013 3300025926 Bacteria 4326
146 Ga0207687_10142748 3300025927 Bacteria 1818
147 Ga0207644_10000170 3300025931 Bacteria 46372
148 Ga0207690_10138414 3300025932 Bacteria 1791
149 Ga0207690_10472420 3300025932 Bacteria 1011
150 Ga0207690_10838719 3300025932 Bacteria 761
151 Ga0207690_11231251 3300025932 Bacteria 625
152 Ga0207706_10136202 3300025933 Bacteria 2160
153 Ga0207706_11033027 3300025933 Bacteria 689
154 Ga0207709_10962876 3300025935 Bacteria 696
155 Ga0207691_10031662 3300025940 Bacteria 4935
156 Ga0207711_10072735 3300025941 Bacteria 2987
157 Ga0207679_10185494 3300025945 Bacteria 1724
158 Ga0207679_10879483 3300025945 Bacteria 819
159 Ga0207667_10008982 3300025949 Bacteria 11823
160 Ga0207667_10035456 3300025949 Bacteria 5352
161 Ga0207667_10051252 3300025949 Bacteria 4352
162 Ga0207667_11000714 3300025949 Bacteria 823
163 Ga0207712_10360908 3300025961 Bacteria 1210
164 Ga0207712_11167822 3300025961 Bacteria 686
165 Ga0207668_10000024 3300025972 Bacteria 131871
166 Ga0207668_10071492 3300025972 Bacteria 2478
167 Ga0207640_10060669 3300025981 Bacteria 2501
168 Ga0207658_10000002 3300025986 Bacteria 1364188
169 Ga0207658_10000213 3300025986 Bacteria 60739
170 Ga0207658_10452969 3300025986 Bacteria 1136
171 Ga0207703_10001689 3300026035 Bacteria 19855
172 Ga0207703_10007175 3300026035 Bacteria 8863
173 Ga0207703_11115129 3300026035 Bacteria 758
174 Ga0207639_10000220 3300026041 Bacteria 42726
175 Ga0207639_10024208 3300026041 Bacteria 4391
176 Ga0207639_10061065 3300026041 Bacteria 2909
177 Ga0207639_10607912 3300026041 Bacteria 1009
178 Ga0207678_10413599 3300026067 Bacteria 1169
179 Ga0207678_10996338 3300026067 Bacteria 742
180 Ga0207678_11495409 3300026067 Bacteria 596
181 Ga0207702_10014421 3300026078 Bacteria 6560
182 Ga0207702_11270178 3300026078 Bacteria 730
183 Ga0207702_11518007 3300026078 Bacteria 663
184 Ga0207641_10004408 3300026088 Bacteria 12197
185 Ga0207641_10027405 3300026088 Bacteria 4705
186 Ga0207676_10001553 3300026095 Bacteria 16924
187 Ga0207674_10015757 3300026116 Bacteria 8292
188 Ga0207674_10019715 3300026116 Bacteria 7300
189 Ga0207674_10023698 3300026116 Bacteria 6570
190 Ga0207674_10863111 3300026116 Bacteria 873
191 Ga0207675_100016337 3300026118 Bacteria 6928
192 Ga0207675_100394860 3300026118 Bacteria 1362
193 Ga0207683_10025233 3300026121 Bacteria 5125
194 Ga0207698_10019023 3300026142 Bacteria 4692
195 Ga0207698_10020680 3300026142 Bacteria 4535
196 Ga0207698_10299584 3300026142 Bacteria 1496
197 Ga0209974_10002045 3300027876 Bacteria 7363
198 Ga0209974_10134135 3300027876 Bacteria 884
199 Ga0207428_10059040 3300027907 Bacteria 3042
200 Ga0268266_10000019 3300028379 Bacteria 556465
201 Ga0268265_10000358 3300028380 Bacteria 49394
202 Ga0268265_10019436 3300028380 Bacteria 4722
203 Ga0268264_10000001 3300028381 Bacteria 1221000
204 Ga0268264_10000087 3300028381 Bacteria 236696
205 Ga0265327_10174363 3300031251 Bacteria 986
206 Ga0307513_10169713 3300031456 Bacteria 2061
207 Ga0307408_100122826 3300031548 Bacteria 2014
208 Ga0307408_101054806 3300031548 Bacteria 752
209 Ga0307508_10020043 3300031616 Bacteria 6074
210 Ga0307405_10000687 3300031731 Bacteria 13090
211 Ga0307405_10113573 3300031731 Bacteria 1839
212 Ga0307405_10224308 3300031731 Bacteria 1381
213 Ga0307405_10471295 3300031731 Bacteria 1000
214 Ga0307413_10177836 3300031824 Bacteria 1513
215 Ga0307410_10060030 3300031852 Bacteria 2598
216 Ga0307410_10071100 3300031852 Bacteria 2412
217 Ga0307406_10033225 3300031901 Bacteria 3156
218 Ga0307406_11453633 3300031901 Bacteria 602
219 Ga0307407_11276838 3300031903 Bacteria 576
220 Ga0307412_10422544 3300031911 Bacteria 1091
221 Ga0307409_100608334 3300031995 Bacteria 1081
222 Ga0307416_100205954 3300032002 Bacteria 1871
223 Ga0307416_100699025 3300032002 Bacteria 1103
224 Ga0307416_101935056 3300032002 Bacteria 693
225 Ga0307414_10039185 3300032004 Bacteria 3190
226 Ga0307414_10128365 3300032004 Bacteria 1963
227 Ga0307414_10217431 3300032004 Bacteria 1566
228 Ga0307414_10297426 3300032004 Bacteria 1364
229 Ga0307414_10355801 3300032004 Bacteria 1258
230 Ga0307411_10042392 3300032005 Bacteria 2903
231 Ga0307411_10194639 3300032005 Bacteria 1551
232 Ga0307411_10247244 3300032005 Bacteria 1400
233 Ga0307415_101167708 3300032126 Bacteria 724
234 Ga0395899_0004135 3300037312 Bacteria 11414
235 Ga0395900_0277988 3300037418 Bacteria 1667
236 Ga0395900_0390322 3300037418 Bacteria 1358
237 Ga0395898_0607544 3300037466 Bacteria 1036
238 Ga0395901_1176523 3300038443 Bacteria 734
239 Ga0451793_1332807 3300041452 Bacteria 587
240 Ga0451806_558808 3300041462 Bacteria 727
241 Ga0439448_0001541 3300042005 Bacteria 6023
242 Ga0439455_0001033 3300042012 Bacteria 4398
243 Ga0439455_0004526 3300042012 Bacteria 2761
244 Ga0450892_009523 3300042130 Bacteria 841
245 Ga0439446_0020707 3300042156 Bacteria 1854
246 Ga0439458_0001791 3300042157 Bacteria 5345
247 Ga0439458_0005023 3300042157 Bacteria 2990
248 Ga0466965_0044219 3300044683 Bacteria 2200
249 Ga0466961_0000685 3300044693 Bacteria 21410
250 Ga0466957_0297012 3300044842 Bacteria 1084
251 Ga0466959_0003259 3300045049 Bacteria 10573
252 Ga0466958_0009427 3300045836 Bacteria 5440
253 Ga0466967_0335097 3300045976 Bacteria 1462
254 Ga0495627_001122 3300046453 Bacteria 17400
255 Ga0495650_0001724 3300046471 Bacteria 20022
256 Ga0495639_0126358 3300046475 Bacteria 1222
257 Ga0495607_0273437 3300046501 Bacteria 804
258 Ga0495583_0023296 3300046506 Bacteria 3135
259 Ga0495648_0318987 3300046524 Bacteria 721
260 Ga0495633_0084541 3300046558 Unclassified 1476
261 Ga0495625_0114256 3300046660 Bacteria 1843
262 Ga0495687_055204 3300047443 Bacteria 1662
263 Ga0495677_0008628 3300047445 Bacteria 3784
264 Ga0495673_0041907 3300047469 Bacteria 2058
265 Ga0495681_0000472 3300047470 Bacteria 30863
266 Ga0495686_0007875 3300047472 Bacteria 7915
267 Ga0496101_0594737 3300048904 Bacteria 875
268 Ga0496113_1186848 3300048916 Bacteria 596
269 Ga0496117_0027892 3300048920 Bacteria 4384
270 Ga0496118_0035090 3300048921 Bacteria 4079
271 Ga0496118_0114142 3300048921 Bacteria 1782
272 Ga0496120_0067524 3300048923 Bacteria 1975
273 Ga0496121_0000158 3300048924 Bacteria 148917
274 Ga0496121_0016467 3300048924 Bacteria 7632
275 Ga0496121_0019723 3300048924 Bacteria 6725
276 Ga0496121_0244610 3300048924 Bacteria 1248
277 Ga0496124_0145438 3300048927 Bacteria 1866
278 Ga0496125_0066591 3300048928 Bacteria 2845
279 Ga0496125_0313059 3300048928 Bacteria 956
280 Ga0496126_0016057 3300048929 Bacteria 7507
281 Ga0496126_0163620 3300048929 Bacteria 1900
282 Ga0496126_0350193 3300048929 Bacteria 1208
283 Ga0496126_0469795 3300048929 Bacteria 1010
284 Ga0496126_0774742 3300048929 Unclassified 738
285 Ga0496126_1329444 3300048929 Bacteria 522
286 Ga0501031_0920303 3300049568 Bacteria 559
287 Ga0501032_0003860 3300049569 Bacteria 11378
288 Ga0501033_0000720 3300049570 Bacteria 30337
289 Ga0501033_0420824 3300049570 Bacteria 930
290 Ga0501034_0004188 3300049571 Bacteria 16100
291 Ga0501034_1159480 3300049571 Bacteria 652
292 Ga0501036_0004881 3300049572 Bacteria 10832
293 Ga0501037_0002331 3300049573 Bacteria 13712
294 Ga0501038_0004437 3300049574 Bacteria 13039
295 Ga0501039_0039145 3300049575 Bacteria 3661
296 Ga0501043_0052126 3300049579 Bacteria 3214
297 Ga0501046_0006002 3300049580 Bacteria 10805
298 Ga0501046_0814764 3300049580 Bacteria 654
299 Ga0501047_0003486 3300049581 Bacteria 14871
300 Ga0501047_0465739 3300049581 Bacteria 1092
301 Ga0501067_0079487 3300049583 Bacteria 1817
302 Ga0501069_0024847 3300049585 Bacteria 3271
303 Ga0501070_0063599 3300049586 Bacteria 3056
304 Ga0501072_0231557 3300049588 Bacteria 1472
305 Ga0501073_0003125 3300049589 Bacteria 12413
306 Ga0501074_0006172 3300049590 Bacteria 8650
307 Ga0501249_157442 3300049679 Bacteria 575
308 Ga0501080_0002682 3300049742 Bacteria 15585
309 Ga0501083_0051253 3300049744 Bacteria 2776
310 Ga0501241_026838 3300049758 Unclassified 1075
311 Ga0501035_0300848 3300049822 Bacteria 1351
312 Ga0501044_0070339 3300049823 Bacteria 3559
313 Ga0501045_0299340 3300049824 Bacteria 1197
314 nmdc:mga0k408_94001_c1 3300050493 Bacteria 1763
315 nmdc:mga07m45_12319_c2 3300050496 Bacteria 3868
316 nmdc:mga0rr50_1236887_c1 3300050513 Bacteria 634
317 Ga0500643_000548 3300053087 Bacteria 26252
318 Ga0500643_014388 3300053087 Bacteria 2753
319 Ga0500594_0020940 3300053118 Bacteria 1636
320 Ga0500608_000223 3300053122 Bacteria 22281
321 Ga0500614_009487 3300053123 Bacteria 2077
322 Ga0500652_047177 3300053131 Bacteria 1750
323 Ga0500559_0018397 3300053136 Bacteria 2953
324 Ga0500559_0402640 3300053136 Bacteria 636
325 Ga0500564_007099 3300053138 Bacteria 4726
326 Ga0500573_0272477 3300053140 Bacteria 861
327 Ga0500577_0266195 3300053142 Bacteria 746
328 Ga0500624_000100 3300053157 Bacteria 41296
329 Ga0500636_0030944 3300053177 Bacteria 3167
330 Ga0500567_018705 3300053723 Bacteria 3332
331 Ga0500625_000017 3300053729 Bacteria 96168
332 Ga0501082_0020721 3300060353 Bacteria 5669
333 Ga0466962_0375656 3300061719 Bacteria 710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10669602 Ga0207650_106696022 129
2 3300047445 Ga0495677_0008628 Ga0495677_0008628_753_1151 132
3 iso_pu_bacteria 2808606379 2808940381 136
4 iso_pu_bacteria 3003665799 3003666191 136
5 iso_pu_bacteria 3007872151 3007873700 136
6 iso_pu_bacteria 2739367664 2739649823 137
7 iso_pu_bacteria 2739367865 2740028296 137
8 iso_pu_bacteria 2861691609 2861692284 137
9 iso_pu_bacteria 2896184354 2896185990 137
10 iso_pu_bacteria 2946787523 2946789715 137
11 iso_pu_bacteria 2990265787 2990268810 137
12 iso_pu_bacteria 2993693658 2993694483 137
13 3300006058 Ga0075432_10041751 Ga0075432_100417511 139
14 3300006353 Ga0075370_10066201 Ga0075370_100662012 139
15 3300007076 Ga0075435_101311383 Ga0075435_1013113832 139
16 3300027907 Ga0207428_10059040 Ga0207428_100590403 139
17 3300050513 nmdc:mga0rr50_1236887_c1 nmdc:mga0rr50_1236887_c1_158_577 139
18 3300005336 Ga0070680_100977681 Ga0070680_1009776812 140
19 3300005355 Ga0070671_100876159 Ga0070671_1008761591 140
20 3300005455 Ga0070663_100676770 Ga0070663_1006767702 140
21 3300005471 Ga0070698_100259468 Ga0070698_1002594683 140
22 3300005530 Ga0070679_101144895 Ga0070679_1011448951 140
23 3300005539 Ga0068853_100288393 Ga0068853_1002883933 140
24 3300005563 Ga0068855_100000333 Ga0068855_10000033323 140
25 3300005577 Ga0068857_100024487 Ga0068857_1000244874 140
26 3300005578 Ga0068854_100021148 Ga0068854_1000211487 140
27 3300005578 Ga0068854_101192230 Ga0068854_1011922302 140
28 3300005614 Ga0068856_101464729 Ga0068856_1014647292 140
29 3300009093 Ga0105240_10010962 Ga0105240_1001096210 140
30 3300009093 Ga0105240_10070160 Ga0105240_100701609 140
31 3300009174 Ga0105241_10102057 Ga0105241_101020572 140
32 3300009545 Ga0105237_10006257 Ga0105237_100062577 140
33 3300009551 Ga0105238_11470541 Ga0105238_114705412 140
34 3300010375 Ga0105239_10000438 Ga0105239_1000043855 140
35 3300010375 Ga0105239_10086519 Ga0105239_100865193 140
36 3300025911 Ga0207654_10201948 Ga0207654_102019481 140
37 3300025913 Ga0207695_10040337 Ga0207695_100403373 140
38 3300025913 Ga0207695_10087579 Ga0207695_100875794 140
39 3300025914 Ga0207671_10004244 Ga0207671_100042447 140
40 3300025917 Ga0207660_10588967 Ga0207660_105889672 140
41 3300025919 Ga0207657_10024261 Ga0207657_100242616 140
42 3300025920 Ga0207649_10399051 Ga0207649_103990512 140
43 3300025921 Ga0207652_11000575 Ga0207652_110005752 140
44 3300025924 Ga0207694_11393873 Ga0207694_113938731 140
45 3300025935 Ga0207709_10962876 Ga0207709_109628761 140
46 3300025945 Ga0207679_10879483 Ga0207679_108794831 140
47 3300025949 Ga0207667_10008982 Ga0207667_1000898213 140
48 3300025981 Ga0207640_10060669 Ga0207640_100606693 140
49 3300026041 Ga0207639_10061065 Ga0207639_100610651 140
50 3300026067 Ga0207678_10996338 Ga0207678_109963381 140
51 3300026078 Ga0207702_11270178 Ga0207702_112701781 140
52 3300026116 Ga0207674_10015757 Ga0207674_100157572 140
53 3300027876 Ga0209974_10002045 Ga0209974_1000204510 140
54 3300031548 Ga0307408_100122826 Ga0307408_1001228263 140
55 3300031731 Ga0307405_10113573 Ga0307405_101135733 140
56 3300031824 Ga0307413_10177836 Ga0307413_101778363 140
57 3300031852 Ga0307410_10071100 Ga0307410_100711006 140
58 3300031901 Ga0307406_10033225 Ga0307406_100332256 140
59 3300031995 Ga0307409_100608334 Ga0307409_1006083342 140
60 3300032002 Ga0307416_100205954 Ga0307416_1002059541 140
61 3300032002 Ga0307416_100699025 Ga0307416_1006990252 140
62 3300032004 Ga0307414_10039185 Ga0307414_100391855 140
63 3300032004 Ga0307414_10128365 Ga0307414_101283652 140
64 3300032004 Ga0307414_10217431 Ga0307414_102174313 140
65 3300032004 Ga0307414_10297426 Ga0307414_102974261 140
66 3300032004 Ga0307414_10355801 Ga0307414_103558012 140
67 3300032005 Ga0307411_10042392 Ga0307411_100423926 140
68 3300032005 Ga0307411_10247244 Ga0307411_102472442 140
69 3300032126 Ga0307415_101167708 Ga0307415_1011677082 140
70 3300042156 Ga0439446_0020707 Ga0439446_0020707_1067_1492 140
71 3300048920 Ga0496117_0027892 Ga0496117_0027892_3059_3484 140
72 3300048921 Ga0496118_0035090 Ga0496118_0035090_976_1401 140
73 3300048921 Ga0496118_0114142 Ga0496118_0114142_157_582 140
74 3300048924 Ga0496121_0016467 Ga0496121_0016467_1929_2354 140
75 3300048924 Ga0496121_0019723 Ga0496121_0019723_2102_2527 140
76 3300048928 Ga0496125_0313059 Ga0496125_0313059_70_492 140
77 3300048929 Ga0496126_0016057 Ga0496126_0016057_5182_5607 140
78 3300048929 Ga0496126_0774742 Ga0496126_0774742_205_630 140
79 3300049569 Ga0501032_0003860 Ga0501032_0003860_7387_7812 140
80 3300049570 Ga0501033_0000720 Ga0501033_0000720_14584_15009 140
81 3300049570 Ga0501033_0420824 Ga0501033_0420824_88_513 140
82 3300049571 Ga0501034_0004188 Ga0501034_0004188_14712_15137 140
83 3300049572 Ga0501036_0004881 Ga0501036_0004881_5135_5560 140
84 3300049573 Ga0501037_0002331 Ga0501037_0002331_6105_6530 140
85 3300049574 Ga0501038_0004437 Ga0501038_0004437_12460_12885 140
86 3300049575 Ga0501039_0039145 Ga0501039_0039145_139_564 140
87 3300049579 Ga0501043_0052126 Ga0501043_0052126_2179_2604 140
88 3300049580 Ga0501046_0006002 Ga0501046_0006002_3560_3985 140
89 3300049581 Ga0501047_0003486 Ga0501047_0003486_14222_14647 140
90 3300049581 Ga0501047_0465739 Ga0501047_0465739_222_647 140
91 3300049583 Ga0501067_0079487 Ga0501067_0079487_19_444 140
92 3300049585 Ga0501069_0024847 Ga0501069_0024847_827_1252 140
93 3300049586 Ga0501070_0063599 Ga0501070_0063599_2492_2917 140
94 3300049588 Ga0501072_0231557 Ga0501072_0231557_54_479 140
95 3300049589 Ga0501073_0003125 Ga0501073_0003125_1302_1727 140
96 3300049590 Ga0501074_0006172 Ga0501074_0006172_2590_3015 140
97 3300049679 Ga0501249_157442 Ga0501249_157442_128_559 140
98 3300049742 Ga0501080_0002682 Ga0501080_0002682_3503_3928 140
99 3300049744 Ga0501083_0051253 Ga0501083_0051253_361_786 140
100 3300049758 Ga0501241_026838 Ga0501241_026838_101_526 140
101 3300049822 Ga0501035_0300848 Ga0501035_0300848_99_524 140
102 3300049823 Ga0501044_0070339 Ga0501044_0070339_828_1253 140
103 3300049824 Ga0501045_0299340 Ga0501045_0299340_85_510 140
104 3300053136 Ga0500559_0402640 Ga0500559_0402640_83_505 140
105 3300060353 Ga0501082_0020721 Ga0501082_0020721_4598_5023 140
106 3300001990 JGI24737J22298_10010214 JGI24737J22298_100102143 141
107 3300002067 JGI24735J21928_10005602 JGI24735J21928_100056022 141
108 3300002459 JGI24751J29686_10026964 JGI24751J29686_100269642 141
109 3300002741 JGI25157J39369_1009084 JGI25157J39369_10090842 141
110 3300003214 JGI25165J46597_1000040 JGI25165J46597_100004021 141
111 3300003762 Ga0055542_1017717 Ga0055542_10177172 141
112 3300003762 Ga0055542_1038047 Ga0055542_10380471 141
113 3300003763 Ga0055529_1009510 Ga0055529_10095102 141
114 3300005327 Ga0070658_10017406 Ga0070658_100174068 141
115 3300005327 Ga0070658_10318381 Ga0070658_103183812 141
116 3300005328 Ga0070676_10064052 Ga0070676_100640522 141
117 3300005331 Ga0070670_100009377 Ga0070670_1000093778 141
118 3300005331 Ga0070670_100174906 Ga0070670_1001749061 141
119 3300005335 Ga0070666_10093098 Ga0070666_100930982 141
120 3300005335 Ga0070666_10160913 Ga0070666_101609132 141
121 3300005335 Ga0070666_11261076 Ga0070666_112610761 141
122 3300005337 Ga0070682_100718943 Ga0070682_1007189432 141
123 3300005337 Ga0070682_100788244 Ga0070682_1007882442 141
124 3300005339 Ga0070660_100002182 Ga0070660_10000218212 141
125 3300005339 Ga0070660_100103332 Ga0070660_1001033321 141
126 3300005339 Ga0070660_100986734 Ga0070660_1009867341 141
127 3300005339 Ga0070660_101266608 Ga0070660_1012666081 141
128 3300005344 Ga0070661_100309293 Ga0070661_1003092932 141
129 3300005347 Ga0070668_100000031 Ga0070668_10000003133 141
130 3300005347 Ga0070668_100388973 Ga0070668_1003889732 141
131 3300005353 Ga0070669_100054146 Ga0070669_1000541461 141
132 3300005353 Ga0070669_100055501 Ga0070669_1000555013 141
133 3300005354 Ga0070675_100017835 Ga0070675_1000178357 141
134 3300005355 Ga0070671_100000265 Ga0070671_1000002654 141
135 3300005366 Ga0070659_100034224 Ga0070659_1000342243 141
136 3300005366 Ga0070659_100070098 Ga0070659_1000700983 141
137 3300005366 Ga0070659_100096446 Ga0070659_1000964462 141
138 3300005366 Ga0070659_100386927 Ga0070659_1003869272 141
139 3300005366 Ga0070659_100553703 Ga0070659_1005537031 141
140 3300005367 Ga0070667_100000004 Ga0070667_10000000433 141
141 3300005367 Ga0070667_100000016 Ga0070667_100000016244 141
142 3300005455 Ga0070663_100394814 Ga0070663_1003948142 141
143 3300005456 Ga0070678_100299181 Ga0070678_1002991812 141
144 3300005457 Ga0070662_100048470 Ga0070662_1000484702 141
145 3300005457 Ga0070662_100233401 Ga0070662_1002334014 141
146 3300005535 Ga0070684_100472480 Ga0070684_1004724801 141
147 3300005539 Ga0068853_100002170 Ga0068853_10000217014 141
148 3300005539 Ga0068853_102260034 Ga0068853_1022600341 141
149 3300005548 Ga0070665_100000024 Ga0070665_100000024296 141
150 3300005563 Ga0068855_100000954 Ga0068855_10000095426 141
151 3300005563 Ga0068855_100093622 Ga0068855_1000936222 141
152 3300005563 Ga0068855_100302261 Ga0068855_1003022613 141
153 3300005563 Ga0068855_100441044 Ga0068855_1004410441 141
154 3300005564 Ga0070664_100117765 Ga0070664_1001177652 141
155 3300005577 Ga0068857_100014552 Ga0068857_1000145529 141
156 3300005577 Ga0068857_100034750 Ga0068857_1000347503 141
157 3300005577 Ga0068857_100230799 Ga0068857_1002307992 141
158 3300005577 Ga0068857_102155877 Ga0068857_1021558771 141
159 3300005616 Ga0068852_100019458 Ga0068852_1000194582 141
160 3300005616 Ga0068852_100077003 Ga0068852_1000770035 141
161 3300005616 Ga0068852_100373423 Ga0068852_1003734232 141
162 3300005616 Ga0068852_101867650 Ga0068852_1018676501 141
163 3300005617 Ga0068859_100016599 Ga0068859_1000165998 141
164 3300005618 Ga0068864_100007001 Ga0068864_1000070018 141
165 3300005719 Ga0068861_100008877 Ga0068861_1000088776 141
166 3300005719 Ga0068861_100367255 Ga0068861_1003672552 141
167 3300005842 Ga0068858_100000771 Ga0068858_10000077125 141
168 3300005843 Ga0068860_100000002 Ga0068860_10000000218 141
169 3300005843 Ga0068860_100000256 Ga0068860_10000025673 141
170 3300005844 Ga0068862_100000721 Ga0068862_10000072118 141
171 3300005844 Ga0068862_100000928 Ga0068862_1000009288 141
172 3300006195 Ga0075366_10047608 Ga0075366_100476082 141
173 3300006237 Ga0097621_100197883 Ga0097621_1001978833 141
174 3300006353 Ga0075370_10003378 Ga0075370_100033782 141
175 3300006931 Ga0097620_100016599 Ga0097620_1000165993 141
176 3300009093 Ga0105240_10156274 Ga0105240_101562742 141
177 3300009093 Ga0105240_11175618 Ga0105240_111756181 141
178 3300009093 Ga0105240_11819406 Ga0105240_118194062 141
179 3300009148 Ga0105243_10821933 Ga0105243_108219332 141
180 3300009177 Ga0105248_10039358 Ga0105248_100393582 141
181 3300009553 Ga0105249_10624713 Ga0105249_106247132 141
182 3300010375 Ga0105239_10252287 Ga0105239_102522873 141
183 3300010375 Ga0105239_10954796 Ga0105239_109547961 141
184 3300013102 Ga0157371_10151961 Ga0157371_101519613 141
185 3300013104 Ga0157370_10002056 Ga0157370_1000205621 141
186 3300013105 Ga0157369_10181650 Ga0157369_101816502 141
187 3300013306 Ga0163162_10004509 Ga0163162_1000450913 141
188 3300013306 Ga0163162_10159106 Ga0163162_101591063 141
189 3300013306 Ga0163162_11559218 Ga0163162_115592181 141
190 3300013307 Ga0157372_11373678 Ga0157372_113736781 141
191 3300022467 Ga0224712_10252504 Ga0224712_102525041 141
192 3300025231 Ga0207427_100661 Ga0207427_10066114 141
193 3300025250 Ga0209026_1000440 Ga0209026_100044032 141
194 3300025254 Ga0209148_1000457 Ga0209148_100045728 141
195 3300025254 Ga0209148_1001408 Ga0209148_10014088 141
196 3300025261 Ga0209233_1000003 Ga0209233_1000003462 141
197 3300025272 Ga0209455_1000848 Ga0209455_100084814 141
198 3300025315 Ga0207697_10021626 Ga0207697_100216263 141
199 3300025903 Ga0207680_10078841 Ga0207680_100788413 141
200 3300025903 Ga0207680_10442242 Ga0207680_104422422 141
201 3300025904 Ga0207647_10008761 Ga0207647_100087619 141
202 3300025904 Ga0207647_10059157 Ga0207647_100591572 141
203 3300025904 Ga0207647_10077900 Ga0207647_100779002 141
204 3300025904 Ga0207647_10126814 Ga0207647_101268142 141
205 3300025907 Ga0207645_10122635 Ga0207645_101226352 141
206 3300025909 Ga0207705_10001476 Ga0207705_1000147620 141
207 3300025909 Ga0207705_10274002 Ga0207705_102740022 141
208 3300025913 Ga0207695_10019508 Ga0207695_100195083 141
209 3300025913 Ga0207695_10497492 Ga0207695_104974922 141
210 3300025919 Ga0207657_10010927 Ga0207657_100109279 141
211 3300025919 Ga0207657_10025068 Ga0207657_100250689 141
212 3300025919 Ga0207657_10068468 Ga0207657_100684684 141
213 3300025919 Ga0207657_10257601 Ga0207657_102576012 141
214 3300025920 Ga0207649_10077148 Ga0207649_100771483 141
215 3300025923 Ga0207681_10010266 Ga0207681_100102666 141
216 3300025923 Ga0207681_10013486 Ga0207681_100134867 141
217 3300025925 Ga0207650_10008025 Ga0207650_100080257 141
218 3300025925 Ga0207650_10313318 Ga0207650_103133181 141
219 3300025926 Ga0207659_10021013 Ga0207659_100210134 141
220 3300025927 Ga0207687_10142748 Ga0207687_101427481 141
221 3300025931 Ga0207644_10000170 Ga0207644_1000017017 141
222 3300025932 Ga0207690_10138414 Ga0207690_101384141 141
223 3300025932 Ga0207690_10472420 Ga0207690_104724202 141
224 3300025932 Ga0207690_10838719 Ga0207690_108387191 141
225 3300025932 Ga0207690_11231251 Ga0207690_112312511 141
226 3300025933 Ga0207706_10136202 Ga0207706_101362022 141
227 3300025933 Ga0207706_11033027 Ga0207706_110330272 141
228 3300025940 Ga0207691_10031662 Ga0207691_100316623 141
229 3300025941 Ga0207711_10072735 Ga0207711_100727354 141
230 3300025945 Ga0207679_10185494 Ga0207679_101854942 141
231 3300025949 Ga0207667_10035456 Ga0207667_100354562 141
232 3300025949 Ga0207667_10051252 Ga0207667_100512522 141
233 3300025949 Ga0207667_11000714 Ga0207667_110007142 141
234 3300025961 Ga0207712_10360908 Ga0207712_103609082 141
235 3300025961 Ga0207712_11167822 Ga0207712_111678221 141
236 3300025972 Ga0207668_10000024 Ga0207668_1000002432 141
237 3300025972 Ga0207668_10071492 Ga0207668_100714924 141
238 3300025986 Ga0207658_10000002 Ga0207658_10000002325 141
239 3300025986 Ga0207658_10000213 Ga0207658_1000021326 141
240 3300025986 Ga0207658_10452969 Ga0207658_104529692 141
241 3300026035 Ga0207703_10001689 Ga0207703_1000168915 141
242 3300026035 Ga0207703_10007175 Ga0207703_100071754 141
243 3300026035 Ga0207703_11115129 Ga0207703_111151291 141
244 3300026041 Ga0207639_10000220 Ga0207639_100002208 141
245 3300026041 Ga0207639_10024208 Ga0207639_100242082 141
246 3300026041 Ga0207639_10607912 Ga0207639_106079122 141
247 3300026067 Ga0207678_10413599 Ga0207678_104135992 141
248 3300026067 Ga0207678_11495409 Ga0207678_114954091 141
249 3300026078 Ga0207702_10014421 Ga0207702_100144218 141
250 3300026078 Ga0207702_11518007 Ga0207702_115180071 141
251 3300026088 Ga0207641_10004408 Ga0207641_100044088 141
252 3300026088 Ga0207641_10027405 Ga0207641_100274057 141
253 3300026095 Ga0207676_10001553 Ga0207676_100015535 141
254 3300026116 Ga0207674_10019715 Ga0207674_100197155 141
255 3300026116 Ga0207674_10023698 Ga0207674_100236983 141
256 3300026116 Ga0207674_10863111 Ga0207674_108631112 141
257 3300026118 Ga0207675_100016337 Ga0207675_1000163376 141
258 3300026118 Ga0207675_100394860 Ga0207675_1003948602 141
259 3300026121 Ga0207683_10025233 Ga0207683_100252332 141
260 3300026142 Ga0207698_10019023 Ga0207698_100190232 141
261 3300026142 Ga0207698_10020680 Ga0207698_100206804 141
262 3300026142 Ga0207698_10299584 Ga0207698_102995844 141
263 3300027876 Ga0209974_10134135 Ga0209974_101341351 141
264 3300028379 Ga0268266_10000019 Ga0268266_1000001973 141
265 3300028380 Ga0268265_10000358 Ga0268265_1000035832 141
266 3300028380 Ga0268265_10019436 Ga0268265_100194362 141
267 3300028381 Ga0268264_10000001 Ga0268264_10000001650 141
268 3300028381 Ga0268264_10000087 Ga0268264_10000087246 141
269 3300031251 Ga0265327_10174363 Ga0265327_101743632 141
270 3300031456 Ga0307513_10169713 Ga0307513_101697131 141
271 3300031548 Ga0307408_101054806 Ga0307408_1010548061 141
272 3300031616 Ga0307508_10020043 Ga0307508_100200437 141
273 3300031731 Ga0307405_10000687 Ga0307405_1000068714 141
274 3300031731 Ga0307405_10224308 Ga0307405_102243082 141
275 3300031731 Ga0307405_10471295 Ga0307405_104712952 141
276 3300031852 Ga0307410_10060030 Ga0307410_100600301 141
277 3300031901 Ga0307406_11453633 Ga0307406_114536331 141
278 3300031903 Ga0307407_11276838 Ga0307407_112768381 141
279 3300031911 Ga0307412_10422544 Ga0307412_104225442 141
280 3300032002 Ga0307416_101935056 Ga0307416_1019350561 141
281 3300032005 Ga0307411_10194639 Ga0307411_101946393 141
282 3300037312 Ga0395899_0004135 Ga0395899_0004135_10337_10762 141
283 3300037418 Ga0395900_0277988 Ga0395900_0277988_604_1029 141
284 3300037418 Ga0395900_0390322 Ga0395900_0390322_76_513 141
285 3300037466 Ga0395898_0607544 Ga0395898_0607544_518_943 141
286 3300038443 Ga0395901_1176523 Ga0395901_1176523_44_469 141
287 3300041452 Ga0451793_1332807 Ga0451793_1332807_52_477 141
288 3300041462 Ga0451806_558808 Ga0451806_558808_142_570 141
289 3300042005 Ga0439448_0001541 Ga0439448_0001541_2292_2717 141
290 3300042012 Ga0439455_0001033 Ga0439455_0001033_3137_3562 141
291 3300042012 Ga0439455_0004526 Ga0439455_0004526_782_1207 141
292 3300042130 Ga0450892_009523 Ga0450892_009523_112_543 141
293 3300042157 Ga0439458_0001791 Ga0439458_0001791_2076_2501 141
294 3300042157 Ga0439458_0005023 Ga0439458_0005023_828_1253 141
295 3300044683 Ga0466965_0044219 Ga0466965_0044219_1751_2179 141
296 3300044693 Ga0466961_0000685 Ga0466961_0000685_915_1343 141
297 3300044842 Ga0466957_0297012 Ga0466957_0297012_648_1073 141
298 3300045049 Ga0466959_0003259 Ga0466959_0003259_5715_6143 141
299 3300045836 Ga0466958_0009427 Ga0466958_0009427_1276_1704 141
300 3300045976 Ga0466967_0335097 Ga0466967_0335097_616_1041 141
301 3300046453 Ga0495627_001122 Ga0495627_001122_15747_16175 141
302 3300046471 Ga0495650_0001724 Ga0495650_0001724_14701_15129 141
303 3300046475 Ga0495639_0126358 Ga0495639_0126358_709_1137 141
304 3300046501 Ga0495607_0273437 Ga0495607_0273437_75_500 141
305 3300046506 Ga0495583_0023296 Ga0495583_0023296_2677_3105 141
306 3300046524 Ga0495648_0318987 Ga0495648_0318987_161_589 141
307 3300046558 Ga0495633_0084541 Ga0495633_0084541_51_479 141
308 3300046660 Ga0495625_0114256 Ga0495625_0114256_1301_1729 141
309 3300047443 Ga0495687_055204 Ga0495687_055204_1087_1515 141
310 3300047469 Ga0495673_0041907 Ga0495673_0041907_1537_1965 141
311 3300047470 Ga0495681_0000472 Ga0495681_0000472_15735_16163 141
312 3300047472 Ga0495686_0007875 Ga0495686_0007875_4249_4677 141
313 3300048904 Ga0496101_0594737 Ga0496101_0594737_427_855 141
314 3300048916 Ga0496113_1186848 Ga0496113_1186848_98_523 141
315 3300048923 Ga0496120_0067524 Ga0496120_0067524_438_893 141
316 3300048924 Ga0496121_0000158 Ga0496121_0000158_90674_91099 141
317 3300048924 Ga0496121_0244610 Ga0496121_0244610_700_1125 141
318 3300048927 Ga0496124_0145438 Ga0496124_0145438_889_1314 141
319 3300048928 Ga0496125_0066591 Ga0496125_0066591_1306_1731 141
320 3300048929 Ga0496126_0163620 Ga0496126_0163620_1239_1757 141
321 3300048929 Ga0496126_0350193 Ga0496126_0350193_703_1131 141
322 3300048929 Ga0496126_0469795 Ga0496126_0469795_539_964 141
323 3300048929 Ga0496126_1329444 Ga0496126_1329444_63_488 141
324 3300049568 Ga0501031_0920303 Ga0501031_0920303_32_463 141
325 3300049571 Ga0501034_1159480 Ga0501034_1159480_50_481 141
326 3300049580 Ga0501046_0814764 Ga0501046_0814764_119_547 141
327 3300050493 nmdc:mga0k408_94001_c1 nmdc:mga0k408_94001_c1_972_1397 141
328 3300050496 nmdc:mga07m45_12319_c2 nmdc:mga07m45_12319_c2_3081_3506 141
329 3300053087 Ga0500643_000548 Ga0500643_000548_22210_22638 141
330 3300053087 Ga0500643_014388 Ga0500643_014388_1254_1682 141
331 3300053118 Ga0500594_0020940 Ga0500594_0020940_555_983 141
332 3300053122 Ga0500608_000223 Ga0500608_000223_13083_13511 141
333 3300053123 Ga0500614_009487 Ga0500614_009487_233_661 141
334 3300053131 Ga0500652_047177 Ga0500652_047177_698_1126 141
335 3300053136 Ga0500559_0018397 Ga0500559_0018397_1038_1466 141
336 3300053138 Ga0500564_007099 Ga0500564_007099_1393_1821 141
337 3300053140 Ga0500573_0272477 Ga0500573_0272477_133_561 141
338 3300053142 Ga0500577_0266195 Ga0500577_0266195_177_605 141
339 3300053157 Ga0500624_000100 Ga0500624_000100_10633_11061 141
340 3300053177 Ga0500636_0030944 Ga0500636_0030944_929_1357 141
341 3300053723 Ga0500567_018705 Ga0500567_018705_1418_1846 141
342 3300053729 Ga0500625_000017 Ga0500625_000017_13282_13710 141
343 3300061719 Ga0466962_0375656 Ga0466962_0375656_84_512 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

38

137

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nye-assembly2.cif.gz_C crystal structure of osmc from e. coli 0.9772 1 141
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.977 1 141
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.975 1 141
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9748 1 141
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9741 1 141
ID Description Score Start End Superfamily
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9784 1 141 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9716 1 141 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9252 2 141 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9189 2 141 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9154 5 141 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A4Q2IUN9-F1-model_v4 OsmC family peroxiredoxin 0.9964 2 141 GO:0004601
GO:0006979
AF-A0A6J4U590-F1-model_v4 Peroxiredoxin OsmC (EC 1.11.1.15) 0.9949 1 141 GO:0004601
GO:0006979
AF-A0A4Q3U8V3-F1-model_v4 deleted 0.9896 2 65
AF-A0A7W6SJG2-F1-model_v4 Osmotically inducible protein OsmC 0.9894 2 141 GO:0004601
GO:0006979
AF-A0A0Q7D4B0-F1-model_v4 Osmotically inducible protein OsmC 0.9879 2 141 GO:0004601
GO:0006979

Feature Viewer

pLDDT pTM Quality
96.24 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map