F415405

General Info

Members Datasets Scaffolds Average Seq Length
343 246 308 423

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1013996|Ga0055526_10139962
Length 439
Sequence MSGHSTYEPKTGFERWLDARLPIVRLGYDSFVDYPTPRNLNYWWTFGGILSLCLASQLITGIILVMHYTPSADHAFASVEHIMRDVNYGWLIRYMHANGASMFFIAVYIHMLRGLYYGSYKAPREVLWLLGCVIYLLMMATAFMGYVLPWGQMSFHGAVVITNLFGALPLVGESITTWLWGGFAVDNPTLNRFFSLHYLLPFMIAGVVILHIWALHVVGQNNPTGVEPKSKADTVPFTPYATVKDGFAMSVFLILFAWFVFFMPNALGHADNYIPANPLVTPSHIVPEWYFLPFYAILRAVPDKLMGVLAMFGAIACLFALPWLDTSKVRSMRYRPTAKIHFFIFVVACCILGVCGAKLPDDQVIPHLTTFQLMASDLNSFVWLSRVAALYYFAFFLVILPVLGLTEKTLPVPDSIASPALSHPAAAPAEATAAPEMKG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
15 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
16 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
17 2643221733 Bosea sp. Root381 Isolate Unclassified
18 2643221734 Bosea sp. Root670 Isolate Unclassified
19 2773857925 Microvirga vignae BR3299 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2818991435 Caulobacter henricii 536 Isolate Unclassified
22 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
23 2818991467 Bosea vestrisii 3192 Isolate Unclassified
24 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
25 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
26 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
27 2849560528 Caulobacter zeae 410 Isolate Unclassified
28 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
29 2851153111 Caulobacter radicis 736 Isolate Unclassified
30 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
31 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
32 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
33 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
34 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
35 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
36 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
38 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
194 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
229 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
232 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
237 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
241 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
244 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.13
Metatranscriptomes 4.66
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.16
Nodule 0.58
Rhizoplane 2.04
Rhizosphere 63.27
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006777J48905_1081508 3300003308 Eukaryota 1601
2 Ga0006562J51391_1028761 3300003578 Bacteria 2490
3 Ga0055526_1000150 3300003771 Bacteria 61554
4 Ga0055526_1000671 3300003771 Bacteria 26208
5 Ga0055526_1013996 3300003771 Bacteria 3341
6 Ga0055524_1000068 3300003775 Bacteria 130413
7 Ga0055528_1006412 3300003790 Bacteria 5338
8 Ga0058861_11935250 3300004800 Eukaryota 1584
9 Ga0058862_10011350 3300004803 Unclassified 4665
10 Ga0065165_1001609 3300005262 Bacteria 23073
11 Ga0070670_100000032 3300005331 Bacteria 158514
12 Ga0070680_100028667 3300005336 Bacteria 4467
13 Ga0070660_100016351 3300005339 Bacteria 5384
14 Ga0070668_100000975 3300005347 Bacteria 20042
15 Ga0070668_100014972 3300005347 Bacteria 5795
16 Ga0070668_100031168 3300005347 Bacteria 4056
17 Ga0070671_100059353 3300005355 Bacteria 3183
18 Ga0070667_100000110 3300005367 Bacteria 105201
19 Ga0070667_100024229 3300005367 Bacteria 5041
20 Ga0070681_10020584 3300005458 Bacteria 6611
21 Ga0070698_100008566 3300005471 Bacteria 11036
22 Ga0070679_100138407 3300005530 Bacteria 2415
23 Ga0070684_100025106 3300005535 Bacteria 5005
24 Ga0068864_100000184 3300005618 Bacteria 57553
25 Ga0068864_100000321 3300005618 Bacteria 42230
26 Ga0068863_100000037 3300005841 Bacteria 162638
27 Ga0068863_100001377 3300005841 Bacteria 24126
28 Ga0068863_100004617 3300005841 Bacteria 13569
29 Ga0068858_100000029 3300005842 Bacteria 144691
30 Ga0068858_100006036 3300005842 Bacteria 11808
31 Ga0068858_100018099 3300005842 Bacteria 6599
32 Ga0068858_100179631 3300005842 Bacteria 1998
33 Ga0068860_100000100 3300005843 Bacteria 144580
34 Ga0068860_100000167 3300005843 Bacteria 108234
35 Ga0068860_100005700 3300005843 Bacteria 12574
36 Ga0068860_100111872 3300005843 Bacteria 2611
37 Ga0068862_100008644 3300005844 Bacteria 8423
38 Ga0068862_100054175 3300005844 Bacteria 3434
39 Ga0081455_10019019 3300005937 Bacteria 6514
40 Ga0075368_10001626 3300006042 Bacteria 7216
41 Ga0075363_100004231 3300006048 Bacteria 6237
42 Ga0075364_10001989 3300006051 Bacteria 11387
43 Ga0075362_10012061 3300006177 Bacteria 3421
44 Ga0075367_10004580 3300006178 Bacteria 6767
45 Ga0075369_10002683 3300006186 Bacteria 6377
46 Ga0075369_10014928 3300006186 Bacteria 3110
47 Ga0075369_10027985 3300006186 Bacteria 2360
48 Ga0075366_10048926 3300006195 Bacteria 2508
49 Ga0097621_100162131 3300006237 Bacteria 1922
50 Ga0068871_100055355 3300006358 Bacteria 3220
51 Ga0068865_100030073 3300006881 Bacteria 3609
52 Ga0105250_10006833 3300009092 Bacteria 4954
53 Ga0105240_10099154 3300009093 Bacteria 3546
54 Ga0105242_10188899 3300009176 Bacteria 1822
55 Ga0105248_10024868 3300009177 Bacteria 6656
56 Ga0105248_10099751 3300009177 Bacteria 3272
57 Ga0105237_10063059 3300009545 Bacteria 3704
58 Ga0105237_10212016 3300009545 Bacteria 1937
59 Ga0105249_10110912 3300009553 Bacteria 2593
60 Ga0157369_10033563 3300013105 Bacteria 5639
61 Ga0171462_1006 3300013250 Bacteria 432986
62 Ga0157374_10251396 3300013296 Bacteria 1740
63 Ga0157375_10271393 3300013308 Bacteria 1858
64 Ga0163163_10000004 3300014325 Bacteria 416569
65 Ga0157380_10281972 3300014326 Bacteria 1521
66 Ga0157377_10185471 3300014745 Bacteria 1311
67 Ga0157379_10002605 3300014968 Bacteria 15162
68 Ga0157379_10016863 3300014968 Bacteria 6429
69 Ga0182007_10021788 3300015262 Bacteria 2270
70 Ga0163161_10027011 3300017792 Bacteria 4071
71 Ga0197907_11206118 3300020069 Eukaryota 1629
72 Ga0206356_10481053 3300020070 Eukaryota 2200
73 Ga0206349_1636510 3300020075 Eukaryota 9124
74 Ga0206351_10585159 3300020077 Eukaryota 3638
75 Ga0206351_10965601 3300020077 Eukaryota 4192
76 Ga0206350_10665434 3300020080 Unclassified 7523
77 Ga0206354_10629149 3300020081 Eukaryota 1281
78 Ga0213872_10034229 3300021361 Bacteria 2326
79 Ga0224712_10001644 3300022467 Eukaryota 5260
80 Ga0224712_10008092 3300022467 Unclassified 3094
81 Ga0209148_1005799 3300025254 Bacteria 2763
82 Ga0209233_1016404 3300025261 Bacteria 2041
83 Ga0209565_1000384 3300025263 Bacteria 37478
84 Ga0209673_1000956 3300025273 Bacteria 36077
85 Ga0209675_1000518 3300025291 Bacteria 28467
86 Ga0209675_1011558 3300025291 Bacteria 2920
87 Ga0209676_1000467 3300025292 Bacteria 67659
88 Ga0209025_1000008 3300025294 Bacteria 1130876
89 Ga0209564_1000015 3300025295 Bacteria 615324
90 Ga0209564_1000041 3300025295 Bacteria 405199
91 Ga0209564_1006954 3300025295 Bacteria 5943
92 Ga0209758_1006870 3300025297 Bacteria 7953
93 Ga0209050_1000461 3300025298 Bacteria 72912
94 Ga0209256_1000014 3300025299 Bacteria 687409
95 Ga0209256_1001342 3300025299 Bacteria 26115
96 Ga0209051_1009229 3300025303 Bacteria 5104
97 Ga0207713_1047813 3300025735 Bacteria 1728
98 Ga0207710_10037608 3300025900 Bacteria 2138
99 Ga0207680_10043668 3300025903 Bacteria 2630
100 Ga0207705_10000970 3300025909 Bacteria 23483
101 Ga0207707_10037873 3300025912 Bacteria 4213
102 Ga0207695_10011375 3300025913 Bacteria 10785
103 Ga0207695_10147019 3300025913 Bacteria 2300
104 Ga0207660_10015133 3300025917 Bacteria 5087
105 Ga0207657_10070812 3300025919 Bacteria 2954
106 Ga0207652_10004285 3300025921 Bacteria 11637
107 Ga0207646_10147420 3300025922 Bacteria 2121
108 Ga0207650_10000074 3300025925 Bacteria 134837
109 Ga0207644_10041388 3300025931 Bacteria 3259
110 Ga0207690_10006522 3300025932 Bacteria 6918
111 Ga0207690_10148896 3300025932 Bacteria 1733
112 Ga0207704_10008398 3300025938 Bacteria 4937
113 Ga0207711_10007049 3300025941 Bacteria 9418
114 Ga0207711_10103543 3300025941 Bacteria 2521
115 Ga0207711_10184327 3300025941 Bacteria 1899
116 Ga0207668_10000001 3300025972 Bacteria 266091
117 Ga0207668_10000246 3300025972 Bacteria 36387
118 Ga0207668_10018118 3300025972 Bacteria 4424
119 Ga0207668_10026970 3300025972 Bacteria 3737
120 Ga0207668_10031422 3300025972 Bacteria 3497
121 Ga0207658_10000275 3300025986 Bacteria 53906
122 Ga0207641_10000034 3300026088 Bacteria 217752
123 Ga0207641_10001197 3300026088 Bacteria 26009
124 Ga0207641_10001917 3300026088 Bacteria 19953
125 Ga0207648_10047240 3300026089 Bacteria 3774
126 Ga0207676_10000202 3300026095 Bacteria 51825
127 Ga0207676_10001101 3300026095 Bacteria 20425
128 Ga0207675_100017209 3300026118 Bacteria 6751
129 Ga0207683_10057586 3300026121 Bacteria 3411
130 Ga0209813_10003607 3300027866 Bacteria 3636
131 Ga0268266_10000289 3300028379 Bacteria 82515
132 Ga0268266_10038244 3300028379 Bacteria 4086
133 Ga0268266_10050459 3300028379 Bacteria 3570
134 Ga0268265_10000648 3300028380 Bacteria 34549
135 Ga0268265_10002515 3300028380 Bacteria 13726
136 Ga0268264_10000002 3300028381 Bacteria 1153045
137 Ga0268264_10000068 3300028381 Bacteria 275708
138 Ga0268264_10057511 3300028381 Bacteria 3253
139 Ga0268264_10057931 3300028381 Bacteria 3242
140 Ga0268264_10095551 3300028381 Bacteria 2572
141 Ga0268264_10135395 3300028381 Bacteria 2189
142 Ga0265337_1003068 3300028556 Bacteria 7372
143 Ga0307515_10012598 3300028794 Bacteria 15891
144 Ga0307515_10017065 3300028794 Bacteria 13254
145 Ga0265338_10024225 3300028800 Bacteria 6207
146 Ga0265328_10000028 3300031239 Bacteria 112296
147 Ga0265328_10000155 3300031239 Bacteria 32139
148 Ga0265328_10007852 3300031239 Bacteria 4432
149 Ga0265329_10005561 3300031242 Bacteria 5081
150 Ga0265331_10000437 3300031250 Bacteria 40997
151 Ga0265331_10001502 3300031250 Bacteria 17215
152 Ga0265327_10001631 3300031251 Bacteria 27036
153 Ga0265327_10003877 3300031251 Bacteria 13777
154 Ga0265327_10051285 3300031251 Bacteria 2154
155 Ga0265327_10061995 3300031251 Bacteria 1905
156 Ga0265316_10001118 3300031344 Bacteria 29088
157 Ga0265316_10092150 3300031344 Bacteria 2310
158 Ga0307513_10000045 3300031456 Bacteria 158626
159 Ga0265342_10069915 3300031712 Bacteria 2049
160 Ga0307413_10012170 3300031824 Bacteria 4271
161 Ga0373927_0000479 3300035695 Bacteria 30749
162 Ga0373925_0005838 3300037068 Bacteria 9133
163 Ga0395899_0004713 3300037312 Bacteria 10637
164 Ga0395899_0021296 3300037312 Bacteria 4918
165 Ga0395900_0001901 3300037418 Bacteria 23770
166 Ga0395900_0100671 3300037418 Bacteria 2968
167 Ga0395900_0143932 3300037418 Bacteria 2439
168 Ga0395898_0002582 3300037466 Bacteria 21175
169 Ga0395905_0000291 3300037471 Unclassified 73478
170 Ga0395905_0008664 3300037471 Unclassified 10021
171 Ga0395905_0075758 3300037471 Bacteria 3153
172 Ga0395901_0000870 3300038443 Unclassified 33324
173 Ga0395901_0006258 3300038443 Bacteria 12063
174 Ga0395901_0083653 3300038443 Eukaryota 3336
175 Ga0400483_018872 3300039062 Bacteria 11395
176 Ga0400483_277960 3300039062 Bacteria 10935
177 Ga0436365_0635493 3300039437 Bacteria 3062
178 Ga0436365_1347305 3300039437 Bacteria 1977
179 Ga0436360_0292789 3300039438 Bacteria 4190
180 Ga0436360_0442682 3300039438 Bacteria 3371
181 Ga0436361_0394147 3300039447 Bacteria 7521
182 Ga0436361_0672503 3300039447 Bacteria 2975
183 Ga0466967_0115764 3300045976 Bacteria 2469
184 Ga0495627_008977 3300046453 Bacteria 3697
185 Ga0495603_0035040 3300046455 Eukaryota 3016
186 Ga0495590_0001741 3300046457 Bacteria 9231
187 Ga0495629_0026670 3300046459 Bacteria 4104
188 Ga0495638_0000588 3300046460 Bacteria 41034
189 Ga0495638_0004112 3300046460 Bacteria 11128
190 Ga0495638_0009677 3300046460 Bacteria 6739
191 Ga0495641_0017974 3300046461 Eukaryota 3662
192 Ga0495650_0000114 3300046471 Bacteria 192527
193 Ga0495605_0000966 3300046474 Eukaryota 19541
194 Ga0495584_0000878 3300046491 Eukaryota 19407
195 Ga0495585_0003129 3300046492 Eukaryota 11347
196 Ga0495585_0051526 3300046492 Bacteria 2281
197 Ga0495607_0010068 3300046501 Bacteria 6367
198 Ga0495583_0000013 3300046506 Bacteria 323372
199 Ga0495606_0037933 3300046507 Bacteria 3267
200 Ga0495616_0000053 3300046513 Bacteria 104389
201 Ga0495628_0019068 3300046516 Eukaryota 5673
202 Ga0495631_0007232 3300046518 Eukaryota 5659
203 Ga0495632_0036021 3300046519 Bacteria 2519
204 Ga0495648_0000372 3300046524 Bacteria 49423
205 Ga0495654_0000082 3300046530 Bacteria 108599
206 Ga0495587_0040432 3300046536 Eukaryota 2787
207 Ga0495609_0008702 3300046538 Bacteria 4951
208 Ga0495609_0012485 3300046538 Bacteria 4030
209 Ga0495597_0018835 3300046542 Bacteria 3235
210 Ga0495622_0005584 3300046557 Bacteria 5832
211 Ga0495622_0009123 3300046557 Bacteria 4592
212 Ga0495656_0000083 3300046615 Eukaryota 42115
213 Ga0495668_0000342 3300046616 Bacteria 61973
214 Ga0495668_0020755 3300046616 Bacteria 3775
215 Ga0495611_0071767 3300046648 Bacteria 1583
216 Ga0495625_0000290 3300046660 Bacteria 77650
217 Ga0495625_0010575 3300046660 Bacteria 7620
218 Ga0495669_0000329 3300046684 Bacteria 25520
219 Ga0495613_0001323 3300046689 Bacteria 18949
220 Ga0495624_0045482 3300046690 Bacteria 2794
221 Ga0495670_0031372 3300046691 Eukaryota 2640
222 Ga0495671_0012771 3300046692 Eukaryota 4574
223 Ga0495649_0006696 3300046694 Bacteria 7147
224 Ga0495589_0003699 3300046794 Eukaryota 8252
225 Ga0495589_0017961 3300046794 Bacteria 3628
226 Ga0495581_0001020 3300047315 Eukaryota 15142
227 Ga0495672_0002135 3300047320 Bacteria 18531
228 Ga0495672_0008929 3300047320 Bacteria 7320
229 Ga0495676_0043322 3300047321 Eukaryota 3685
230 Ga0495680_0022162 3300047322 Bacteria 5303
231 Ga0495673_0000025 3300047469 Bacteria 512352
232 Ga0495673_0003311 3300047469 Eukaryota 10680
233 Ga0495673_0004316 3300047469 Bacteria 8951
234 Ga0495681_0014181 3300047470 Eukaryota 4584
235 Ga0495681_0050976 3300047470 Bacteria 1948
236 Ga0495686_0006216 3300047472 Bacteria 9206
237 Ga0495686_0006929 3300047472 Bacteria 8570
238 Ga0495593_0024764 3300047673 Bacteria 3323
239 Ga0496101_0171059 3300048904 Bacteria 1670
240 Ga0496101_0174443 3300048904 Bacteria 1653
241 Ga0496107_0000329 3300048910 Bacteria 25658
242 Ga0496107_0150173 3300048910 Bacteria 1723
243 Ga0496109_0136893 3300048912 Bacteria 2289
244 Ga0496111_0152396 3300048914 Bacteria 1715
245 Ga0496115_0002250 3300048918 Bacteria 13815
246 Ga0496117_0012409 3300048920 Bacteria 7515
247 Ga0496117_0075256 3300048920 Bacteria 2244
248 Ga0496118_0005681 3300048921 Bacteria 14053
249 Ga0496119_0015319 3300048922 Bacteria 5914
250 Ga0496121_0001066 3300048924 Bacteria 48544
251 Ga0496121_0001417 3300048924 Bacteria 40646
252 Ga0496122_0017375 3300048925 Bacteria 6729
253 Ga0496122_0051407 3300048925 Bacteria 3131
254 Ga0496123_0029975 3300048926 Bacteria 3992
255 Ga0496123_0052602 3300048926 Bacteria 2701
256 Ga0496125_0016135 3300048928 Bacteria 7184
257 Ga0496126_0026487 3300048929 Bacteria 5559
258 Ga0495678_001396 3300049459 Bacteria 19168
259 Ga0501047_0014685 3300049581 Bacteria 7452
260 Ga0501257_000824 3300049686 Bacteria 6198
261 Ga0501044_0197149 3300049823 Bacteria 1973
262 nmdc:mga03n38_3147_c1 3300050490 Bacteria 5253
263 nmdc:mga00v17_2988_c1 3300050491 Bacteria 8682
264 nmdc:mga0k408_24012_c2 3300050493 Bacteria 3023
265 nmdc:mga04h51_5853_c1 3300050495 Bacteria 3153
266 nmdc:mga07m45_132262_c1 3300050496 Bacteria 1444
267 nmdc:mga0sz30_17490_c1 3300050516 Bacteria 2860
268 nmdc:mga0sz30_24502_c1 3300050516 Bacteria 2463
269 Ga0500635_0000045 3300053080 Bacteria 87314
270 Ga0500578_0000102 3300053086 Bacteria 99108
271 Ga0500578_0100795 3300053086 Bacteria 1827
272 Ga0500643_001892 3300053087 Bacteria 11378
273 Ga0500644_0000287 3300053088 Bacteria 27540
274 Ga0500644_0000533 3300053088 Bacteria 15780
275 Ga0500583_0042763 3300053092 Bacteria 2066
276 Ga0500641_0047784 3300053096 Bacteria 1751
277 Ga0500556_0000558 3300053104 Bacteria 24866
278 Ga0500562_000146 3300053108 Bacteria 20862
279 Ga0500562_009046 3300053108 Bacteria 2517
280 Ga0500569_003672 3300053109 Bacteria 3164
281 Ga0500572_000189 3300053111 Bacteria 21822
282 Ga0500594_0000123 3300053118 Bacteria 21627
283 Ga0500595_000002 3300053119 Bacteria 1074388
284 Ga0500595_000109 3300053119 Bacteria 55874
285 Ga0500595_003186 3300053119 Bacteria 7763
286 Ga0500595_005023 3300053119 Bacteria 5823
287 Ga0500608_000187 3300053122 Bacteria 24884
288 Ga0500618_000319 3300053125 Bacteria 35375
289 Ga0500642_0039571 3300053130 Bacteria 2028
290 Ga0500559_0000010 3300053136 Bacteria 165569
291 Ga0500559_0000280 3300053136 Bacteria 39387
292 Ga0500559_0002775 3300053136 Bacteria 8869
293 Ga0500590_019652 3300053148 Bacteria 3501
294 Ga0500604_0030440 3300053151 Bacteria 1579
295 Ga0500616_0000002 3300053153 Bacteria 1611257
296 Ga0500622_0000611 3300053156 Bacteria 32433
297 Ga0500622_0015009 3300053156 Bacteria 4154
298 Ga0500622_0016204 3300053156 Bacteria 3984
299 Ga0500622_0061874 3300053156 Bacteria 1907
300 Ga0500636_0007042 3300053177 Bacteria 6485
301 Ga0500636_0015065 3300053177 Bacteria 4552
302 Ga0500636_0060966 3300053177 Bacteria 2202
303 Ga0500637_0038226 3300053178 Bacteria 2702
304 Ga0500645_000156 3300053730 Bacteria 53110
305 Ga0500596_001528 3300053735 Bacteria 4685
306 Ga0587084_000108 3300059477 Eukaryota 4549
307 Ga0587073_0002444 3300059492 Eukaryota 2379
308 Ga0587069_001182 3300059642 Bacteria 2312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0075758 Ga0395905_0075758_24_1028 315
2 3300020075 Ga0206349_1636510 Ga0206349_163651012 326
3 3300046648 Ga0495611_0071767 Ga0495611_0071767_53_1138 339
4 3300047322 Ga0495680_0022162 Ga0495680_0022162_4223_5293 339
5 3300048925 Ga0496122_0051407 Ga0496122_0051407_315_1484 341
6 3300048928 Ga0496125_0016135 Ga0496125_0016135_5638_6807 341
7 3300053136 Ga0500559_0002775 Ga0500559_0002775_5590_6912 345
8 3300006186 Ga0075369_10002683 Ga0075369_100026835 347
9 3300025292 Ga0209676_1000467 Ga0209676_100046735 347
10 3300025298 Ga0209050_1000461 Ga0209050_100046136 347
11 3300025303 Ga0209051_1009229 Ga0209051_10092292 347
12 3300050516 nmdc:mga0sz30_24502_c1 nmdc:mga0sz30_24502_c1_178_1464 347
13 3300053122 Ga0500608_000187 Ga0500608_000187_16277_17563 347
14 3300053156 Ga0500622_0015009 Ga0500622_0015009_1962_3248 347
15 3300037471 Ga0395905_0008664 Ga0395905_0008664_3207_4400 348
16 3300037471 Ga0395905_0000291 Ga0395905_0000291_12298_13464 350
17 3300038443 Ga0395901_0083653 Ga0395901_0083653_1737_2897 350
18 3300004800 Ga0058861_11935250 Ga0058861_119352501 354
19 3300004803 Ga0058862_10011350 Ga0058862_100113503 354
20 3300039438 Ga0436360_0442682 Ga0436360_0442682_1179_2501 355
21 3300046453 Ga0495627_008977 Ga0495627_008977_1036_2355 357
22 3300046794 Ga0495589_0017961 Ga0495589_0017961_1245_2564 357
23 3300047469 Ga0495673_0000025 Ga0495673_0000025_247704_249023 357
24 3300046506 Ga0495583_0000013 Ga0495583_0000013_163006_164325 358
25 3300046660 Ga0495625_0010575 Ga0495625_0010575_497_1816 358
26 3300048904 Ga0496101_0174443 Ga0496101_0174443_37_1356 358
27 3300048910 Ga0496107_0000329 Ga0496107_0000329_8174_9493 358
28 3300048924 Ga0496121_0001417 Ga0496121_0001417_10863_12182 358
29 3300053136 Ga0500559_0000280 Ga0500559_0000280_6640_7959 358
30 3300009545 Ga0105237_10063059 Ga0105237_100630593 359
31 3300005535 Ga0070684_100025106 Ga0070684_1000251062 360
32 3300009545 Ga0105237_10212016 Ga0105237_102120162 360
33 3300013105 Ga0157369_10033563 Ga0157369_100335636 360
34 3300037418 Ga0395900_0001901 Ga0395900_0001901_12196_13404 360
35 3300037466 Ga0395898_0002582 Ga0395898_0002582_8765_9973 360
36 3300006237 Ga0097621_100162131 Ga0097621_1001621312 361
37 3300006358 Ga0068871_100055355 Ga0068871_1000553552 361
38 3300006881 Ga0068865_100030073 Ga0068865_1000300733 361
39 3300009176 Ga0105242_10188899 Ga0105242_101888992 361
40 3300013296 Ga0157374_10251396 Ga0157374_102513962 361
41 3300013308 Ga0157375_10271393 Ga0157375_102713932 361
42 3300017792 Ga0163161_10027011 Ga0163161_100270113 361
43 3300025938 Ga0207704_10008398 Ga0207704_100083984 361
44 3300026089 Ga0207648_10047240 Ga0207648_100472402 361
45 3300026121 Ga0207683_10057586 Ga0207683_100575864 361
46 3300039062 Ga0400483_018872 Ga0400483_018872_5389_6657 361
47 3300039062 Ga0400483_277960 Ga0400483_277960_8564_9832 361
48 3300047673 Ga0495593_0024764 Ga0495593_0024764_574_1863 361
49 3300014326 Ga0157380_10281972 Ga0157380_102819722 362
50 3300014745 Ga0157377_10185471 Ga0157377_101854711 362
51 3300038443 Ga0395901_0000870 Ga0395901_0000870_15422_16594 364
52 3300037312 Ga0395899_0004713 Ga0395899_0004713_4123_5331 365
53 3300020069 Ga0197907_11206118 Ga0197907_112061181 369
54 3300020070 Ga0206356_10481053 Ga0206356_104810531 369
55 3300020077 Ga0206351_10585159 Ga0206351_105851591 369
56 3300020077 Ga0206351_10965601 Ga0206351_109656015 369
57 3300020081 Ga0206354_10629149 Ga0206354_106291492 369
58 3300031239 Ga0265328_10007852 Ga0265328_100078524 369
59 3300031250 Ga0265331_10001502 Ga0265331_1000150215 369
60 3300031251 Ga0265327_10051285 Ga0265327_100512852 369
61 3300031344 Ga0265316_10092150 Ga0265316_100921502 369
62 3300048920 Ga0496117_0075256 Ga0496117_0075256_262_1539 369
63 3300053119 Ga0500595_003186 Ga0500595_003186_5492_6775 369
64 3300059492 Ga0587073_0002444 Ga0587073_0002444_26_1192 369
65 3300005347 Ga0070668_100000975 Ga0070668_10000097510 370
66 3300005347 Ga0070668_100031168 Ga0070668_1000311683 370
67 3300005367 Ga0070667_100024229 Ga0070667_1000242292 370
68 3300005842 Ga0068858_100179631 Ga0068858_1001796312 370
69 3300005843 Ga0068860_100000100 Ga0068860_100000100106 370
70 3300005844 Ga0068862_100054175 Ga0068862_1000541754 370
71 3300006042 Ga0075368_10001626 Ga0075368_100016263 370
72 3300006048 Ga0075363_100004231 Ga0075363_1000042314 370
73 3300006051 Ga0075364_10001989 Ga0075364_100019899 370
74 3300006178 Ga0075367_10004580 Ga0075367_100045805 370
75 3300006186 Ga0075369_10027985 Ga0075369_100279852 370
76 3300006195 Ga0075366_10048926 Ga0075366_100489263 370
77 3300025972 Ga0207668_10018118 Ga0207668_100181182 370
78 3300025972 Ga0207668_10026970 Ga0207668_100269702 370
79 3300026118 Ga0207675_100017209 Ga0207675_1000172092 370
80 3300027866 Ga0209813_10003607 Ga0209813_100036073 370
81 3300028380 Ga0268265_10002515 Ga0268265_100025154 370
82 3300028381 Ga0268264_10000002 Ga0268264_10000002732 370
83 3300028381 Ga0268264_10135395 Ga0268264_101353952 370
84 3300031251 Ga0265327_10001631 Ga0265327_1000163115 370
85 3300031456 Ga0307513_10000045 Ga0307513_1000004563 370
86 3300039437 Ga0436365_0635493 Ga0436365_0635493_475_1773 370
87 3300046616 Ga0495668_0000342 Ga0495668_0000342_43640_44926 370
88 3300046684 Ga0495669_0000329 Ga0495669_0000329_17323_18639 370
89 3300048926 Ga0496123_0052602 Ga0496123_0052602_530_1816 370
90 3300049686 Ga0501257_000824 Ga0501257_000824_353_1669 370
91 3300050490 nmdc:mga03n38_3147_c1 nmdc:mga03n38_3147_c1_3429_4709 370
92 3300050491 nmdc:mga00v17_2988_c1 nmdc:mga00v17_2988_c1_1943_3223 370
93 3300050493 nmdc:mga0k408_24012_c2 nmdc:mga0k408_24012_c2_1057_2337 370
94 3300050495 nmdc:mga04h51_5853_c1 nmdc:mga04h51_5853_c1_1230_2510 370
95 3300050496 nmdc:mga07m45_132262_c1 nmdc:mga07m45_132262_c1_90_1370 370
96 3300050516 nmdc:mga0sz30_17490_c1 nmdc:mga0sz30_17490_c1_370_1650 370
97 3300053156 Ga0500622_0061874 Ga0500622_0061874_56_1342 370
98 3300059642 Ga0587069_001182 Ga0587069_001182_443_1759 370
99 iso_pu_bacteria 2582581279 2585148987 370
100 iso_pu_bacteria 2585428106 2587915357 370
101 iso_pu_bacteria 2643221640 2644223912 370
102 iso_pu_bacteria 2643221642 2644232898 370
103 iso_pu_bacteria 2857504554 2857508041 370
104 iso_pu_bacteria 2884960567 2884963133 370
105 iso_pu_bacteria 2928531327 2928534803 370
106 3300003578 Ga0006562J51391_1028761 Ga0006562J51391_10287611 371
107 3300003771 Ga0055526_1000150 Ga0055526_100015034 371
108 3300003771 Ga0055526_1000671 Ga0055526_100067113 371
109 3300003771 Ga0055526_1013996 Ga0055526_10139962 371
110 3300003775 Ga0055524_1000068 Ga0055524_100006813 371
111 3300003790 Ga0055528_1006412 Ga0055528_10064123 371
112 3300005262 Ga0065165_1001609 Ga0065165_100160923 371
113 3300005331 Ga0070670_100000032 Ga0070670_10000003245 371
114 3300005336 Ga0070680_100028667 Ga0070680_1000286675 371
115 3300005339 Ga0070660_100016351 Ga0070660_1000163516 371
116 3300005355 Ga0070671_100059353 Ga0070671_1000593532 371
117 3300005367 Ga0070667_100000110 Ga0070667_10000011026 371
118 3300005458 Ga0070681_10020584 Ga0070681_100205843 371
119 3300005471 Ga0070698_100008566 Ga0070698_10000856612 371
120 3300005530 Ga0070679_100138407 Ga0070679_1001384071 371
121 3300005618 Ga0068864_100000184 Ga0068864_10000018434 371
122 3300005618 Ga0068864_100000321 Ga0068864_1000003212 371
123 3300005841 Ga0068863_100000037 Ga0068863_10000003734 371
124 3300005841 Ga0068863_100001377 Ga0068863_1000013777 371
125 3300005841 Ga0068863_100004617 Ga0068863_10000461718 371
126 3300005842 Ga0068858_100000029 Ga0068858_100000029110 371
127 3300005842 Ga0068858_100006036 Ga0068858_1000060366 371
128 3300005842 Ga0068858_100018099 Ga0068858_1000180995 371
129 3300005843 Ga0068860_100000167 Ga0068860_10000016795 371
130 3300005843 Ga0068860_100005700 Ga0068860_1000057002 371
131 3300005844 Ga0068862_100008644 Ga0068862_10000864410 371
132 3300006186 Ga0075369_10014928 Ga0075369_100149282 371
133 3300009092 Ga0105250_10006833 Ga0105250_100068333 371
134 3300009177 Ga0105248_10024868 Ga0105248_100248681 371
135 3300009177 Ga0105248_10099751 Ga0105248_100997513 371
136 3300009553 Ga0105249_10110912 Ga0105249_101109122 371
137 3300013250 Ga0171462_1006 Ga0171462_1006281 371
138 3300014968 Ga0157379_10002605 Ga0157379_1000260520 371
139 3300014968 Ga0157379_10016863 Ga0157379_100168638 371
140 3300015262 Ga0182007_10021788 Ga0182007_100217882 371
141 3300025254 Ga0209148_1005799 Ga0209148_10057993 371
142 3300025261 Ga0209233_1016404 Ga0209233_10164042 371
143 3300025263 Ga0209565_1000384 Ga0209565_100038425 371
144 3300025273 Ga0209673_1000956 Ga0209673_10009569 371
145 3300025291 Ga0209675_1000518 Ga0209675_100051823 371
146 3300025291 Ga0209675_1011558 Ga0209675_10115583 371
147 3300025294 Ga0209025_1000008 Ga0209025_1000008496 371
148 3300025295 Ga0209564_1000015 Ga0209564_1000015573 371
149 3300025295 Ga0209564_1000041 Ga0209564_1000041153 371
150 3300025295 Ga0209564_1006954 Ga0209564_10069542 371
151 3300025297 Ga0209758_1006870 Ga0209758_10068709 371
152 3300025299 Ga0209256_1000014 Ga0209256_100001413 371
153 3300025299 Ga0209256_1001342 Ga0209256_100134214 371
154 3300025735 Ga0207713_1047813 Ga0207713_10478132 371
155 3300025900 Ga0207710_10037608 Ga0207710_100376082 371
156 3300025903 Ga0207680_10043668 Ga0207680_100436682 371
157 3300025909 Ga0207705_10000970 Ga0207705_1000097026 371
158 3300025912 Ga0207707_10037873 Ga0207707_100378733 371
159 3300025913 Ga0207695_10011375 Ga0207695_1001137512 371
160 3300025917 Ga0207660_10015133 Ga0207660_100151337 371
161 3300025919 Ga0207657_10070812 Ga0207657_100708122 371
162 3300025921 Ga0207652_10004285 Ga0207652_100042857 371
163 3300025922 Ga0207646_10147420 Ga0207646_101474202 371
164 3300025925 Ga0207650_10000074 Ga0207650_1000007496 371
165 3300025931 Ga0207644_10041388 Ga0207644_100413882 371
166 3300025932 Ga0207690_10006522 Ga0207690_100065224 371
167 3300025932 Ga0207690_10148896 Ga0207690_101488962 371
168 3300025941 Ga0207711_10007049 Ga0207711_100070495 371
169 3300025941 Ga0207711_10103543 Ga0207711_101035432 371
170 3300025941 Ga0207711_10184327 Ga0207711_101843272 371
171 3300025972 Ga0207668_10000001 Ga0207668_10000001182 371
172 3300025972 Ga0207668_10000246 Ga0207668_1000024628 371
173 3300025986 Ga0207658_10000275 Ga0207658_1000027517 371
174 3300026088 Ga0207641_10000034 Ga0207641_10000034164 371
175 3300026088 Ga0207641_10001197 Ga0207641_1000119721 371
176 3300026088 Ga0207641_10001917 Ga0207641_1000191719 371
177 3300026095 Ga0207676_10000202 Ga0207676_1000020228 371
178 3300026095 Ga0207676_10001101 Ga0207676_100011017 371
179 3300028379 Ga0268266_10000289 Ga0268266_100002894 371
180 3300028379 Ga0268266_10038244 Ga0268266_100382442 371
181 3300028379 Ga0268266_10050459 Ga0268266_100504594 371
182 3300028380 Ga0268265_10000648 Ga0268265_100006489 371
183 3300028381 Ga0268264_10000068 Ga0268264_1000006833 371
184 3300028381 Ga0268264_10057511 Ga0268264_100575113 371
185 3300028794 Ga0307515_10012598 Ga0307515_100125989 371
186 3300028794 Ga0307515_10017065 Ga0307515_100170658 371
187 3300028800 Ga0265338_10024225 Ga0265338_100242257 371
188 3300031251 Ga0265327_10003877 Ga0265327_1000387711 371
189 3300031712 Ga0265342_10069915 Ga0265342_100699152 371
190 3300031824 Ga0307413_10012170 Ga0307413_100121702 371
191 3300035695 Ga0373927_0000479 Ga0373927_0000479_3589_4908 371
192 3300037068 Ga0373925_0005838 Ga0373925_0005838_2485_3804 371
193 3300037312 Ga0395899_0021296 Ga0395899_0021296_2747_4069 371
194 3300037418 Ga0395900_0100671 Ga0395900_0100671_1553_2869 371
195 3300037418 Ga0395900_0143932 Ga0395900_0143932_716_2038 371
196 3300038443 Ga0395901_0006258 Ga0395901_0006258_5073_6395 371
197 3300039437 Ga0436365_1347305 Ga0436365_1347305_143_1462 371
198 3300046457 Ga0495590_0001741 Ga0495590_0001741_3327_4625 371
199 3300046459 Ga0495629_0026670 Ga0495629_0026670_68_1387 371
200 3300046460 Ga0495638_0000588 Ga0495638_0000588_30071_31369 371
201 3300046460 Ga0495638_0004112 Ga0495638_0004112_614_1933 371
202 3300046460 Ga0495638_0009677 Ga0495638_0009677_208_1527 371
203 3300046471 Ga0495650_0000114 Ga0495650_0000114_11115_12434 371
204 3300046492 Ga0495585_0051526 Ga0495585_0051526_29_1348 371
205 3300046501 Ga0495607_0010068 Ga0495607_0010068_2174_3493 371
206 3300046507 Ga0495606_0037933 Ga0495606_0037933_480_1799 371
207 3300046513 Ga0495616_0000053 Ga0495616_0000053_81406_82725 371
208 3300046519 Ga0495632_0036021 Ga0495632_0036021_371_1690 371
209 3300046524 Ga0495648_0000372 Ga0495648_0000372_12789_14087 371
210 3300046530 Ga0495654_0000082 Ga0495654_0000082_105629_106948 371
211 3300046538 Ga0495609_0012485 Ga0495609_0012485_1588_2907 371
212 3300046542 Ga0495597_0018835 Ga0495597_0018835_499_1818 371
213 3300046557 Ga0495622_0005584 Ga0495622_0005584_3162_4481 371
214 3300046616 Ga0495668_0020755 Ga0495668_0020755_1387_2706 371
215 3300046660 Ga0495625_0000290 Ga0495625_0000290_13418_14740 371
216 3300046689 Ga0495613_0001323 Ga0495613_0001323_11128_12450 371
217 3300046690 Ga0495624_0045482 Ga0495624_0045482_330_1649 371
218 3300047320 Ga0495672_0002135 Ga0495672_0002135_16608_17927 371
219 3300047469 Ga0495673_0004316 Ga0495673_0004316_392_1711 371
220 3300047470 Ga0495681_0050976 Ga0495681_0050976_302_1621 371
221 3300047472 Ga0495686_0006216 Ga0495686_0006216_2239_3537 371
222 3300047472 Ga0495686_0006929 Ga0495686_0006929_2534_3853 371
223 3300048904 Ga0496101_0171059 Ga0496101_0171059_60_1379 371
224 3300048918 Ga0496115_0002250 Ga0496115_0002250_4935_6254 371
225 3300048920 Ga0496117_0012409 Ga0496117_0012409_2888_4207 371
226 3300048921 Ga0496118_0005681 Ga0496118_0005681_3063_4382 371
227 3300048922 Ga0496119_0015319 Ga0496119_0015319_1025_2344 371
228 3300048924 Ga0496121_0001066 Ga0496121_0001066_26374_27693 371
229 3300048925 Ga0496122_0017375 Ga0496122_0017375_2823_4106 371
230 3300048926 Ga0496123_0029975 Ga0496123_0029975_1747_3030 371
231 3300049459 Ga0495678_001396 Ga0495678_001396_5115_6413 371
232 3300049581 Ga0501047_0014685 Ga0501047_0014685_875_2194 371
233 3300049823 Ga0501044_0197149 Ga0501044_0197149_512_1834 371
234 3300053080 Ga0500635_0000045 Ga0500635_0000045_56069_57388 371
235 3300053086 Ga0500578_0000102 Ga0500578_0000102_9866_11164 371
236 3300053086 Ga0500578_0100795 Ga0500578_0100795_462_1781 371
237 3300053088 Ga0500644_0000287 Ga0500644_0000287_9716_11014 371
238 3300053092 Ga0500583_0042763 Ga0500583_0042763_538_1857 371
239 3300053096 Ga0500641_0047784 Ga0500641_0047784_251_1570 371
240 3300053104 Ga0500556_0000558 Ga0500556_0000558_20897_22216 371
241 3300053108 Ga0500562_000146 Ga0500562_000146_14793_16112 371
242 3300053108 Ga0500562_009046 Ga0500562_009046_994_2292 371
243 3300053109 Ga0500569_003672 Ga0500569_003672_1674_2993 371
244 3300053111 Ga0500572_000189 Ga0500572_000189_2480_3769 371
245 3300053118 Ga0500594_0000123 Ga0500594_0000123_4846_6144 371
246 3300053119 Ga0500595_005023 Ga0500595_005023_1261_2580 371
247 3300053125 Ga0500618_000319 Ga0500618_000319_29304_30623 371
248 3300053130 Ga0500642_0039571 Ga0500642_0039571_500_1819 371
249 3300053136 Ga0500559_0000010 Ga0500559_0000010_110790_112112 371
250 3300053148 Ga0500590_019652 Ga0500590_019652_291_1610 371
251 3300053151 Ga0500604_0030440 Ga0500604_0030440_46_1365 371
252 3300053156 Ga0500622_0000611 Ga0500622_0000611_14025_15323 371
253 3300053156 Ga0500622_0016204 Ga0500622_0016204_2232_3515 371
254 3300053177 Ga0500636_0007042 Ga0500636_0007042_4257_5540 371
255 3300053177 Ga0500636_0015065 Ga0500636_0015065_705_1997 371
256 3300053177 Ga0500636_0060966 Ga0500636_0060966_841_2160 371
257 3300053735 Ga0500596_001528 Ga0500596_001528_2361_3680 371
258 iso_pu_bacteria 2510917020 2511121726 371
259 iso_pu_bacteria 2582581280 2585151607 371
260 iso_pu_bacteria 2582581293 2585195519 371
261 iso_pu_bacteria 2643221545 2643749233 371
262 iso_pu_bacteria 2643221552 2643781352 371
263 iso_pu_bacteria 2643221583 2643922932 371
264 iso_pu_bacteria 2643221584 2643927067 371
265 iso_pu_bacteria 2643221598 2643998403 371
266 iso_pu_bacteria 2643221614 2644086732 371
267 iso_pu_bacteria 2643221661 2644341686 371
268 iso_pu_bacteria 2643221666 2644367973 371
269 iso_pu_bacteria 2643221691 2644508992 371
270 iso_pu_bacteria 2643221733 2644731756 371
271 iso_pu_bacteria 2643221734 2644736703 371
272 iso_pu_bacteria 2773857925 2774873914 371
273 iso_pu_bacteria 2791355048 2792462918 371
274 iso_pu_bacteria 2818991435 2819536335 371
275 iso_pu_bacteria 2818991454 2819644590 371
276 iso_pu_bacteria 2818991467 2819719263 371
277 iso_pu_bacteria 2841911363 2841915831 371
278 iso_pu_bacteria 2841917233 2841921789 371
279 iso_pu_bacteria 2843744320 2843746465 371
280 iso_pu_bacteria 2849560528 2849561820 371
281 iso_pu_bacteria 2849573788 2849574114 371
282 iso_pu_bacteria 2851153111 2851157795 371
283 iso_pu_bacteria 2898329390 2898332561 371
284 iso_pu_bacteria 2917699015 2917704475 371
285 3300005347 Ga0070668_100014972 Ga0070668_1000149725 372
286 3300005843 Ga0068860_100111872 Ga0068860_1001118722 372
287 3300005937 Ga0081455_10019019 Ga0081455_100190194 372
288 3300006177 Ga0075362_10012061 Ga0075362_100120612 372
289 3300009093 Ga0105240_10099154 Ga0105240_100991543 372
290 3300014325 Ga0163163_10000004 Ga0163163_10000004220 372
291 3300021361 Ga0213872_10034229 Ga0213872_100342292 372
292 3300025913 Ga0207695_10147019 Ga0207695_101470192 372
293 3300025972 Ga0207668_10031422 Ga0207668_100314222 372
294 3300028381 Ga0268264_10057931 Ga0268264_100579312 372
295 3300028381 Ga0268264_10095551 Ga0268264_100955512 372
296 3300028556 Ga0265337_1003068 Ga0265337_10030682 372
297 3300031239 Ga0265328_10000028 Ga0265328_1000002841 372
298 3300031239 Ga0265328_10000155 Ga0265328_1000015523 372
299 3300031242 Ga0265329_10005561 Ga0265329_100055615 372
300 3300031250 Ga0265331_10000437 Ga0265331_1000043734 372
301 3300031251 Ga0265327_10061995 Ga0265327_100619952 372
302 3300031344 Ga0265316_10001118 Ga0265316_100011185 372
303 3300039438 Ga0436360_0292789 Ga0436360_0292789_132_1379 372
304 3300039447 Ga0436361_0394147 Ga0436361_0394147_5798_7051 372
305 3300039447 Ga0436361_0672503 Ga0436361_0672503_1078_2334 372
306 3300045976 Ga0466967_0115764 Ga0466967_0115764_1080_2336 372
307 3300046538 Ga0495609_0008702 Ga0495609_0008702_3236_4492 372
308 3300046557 Ga0495622_0009123 Ga0495622_0009123_3245_4501 372
309 3300046694 Ga0495649_0006696 Ga0495649_0006696_4760_6001 372
310 3300047320 Ga0495672_0008929 Ga0495672_0008929_5598_6839 372
311 3300048910 Ga0496107_0150173 Ga0496107_0150173_398_1648 372
312 3300048912 Ga0496109_0136893 Ga0496109_0136893_90_1340 372
313 3300048914 Ga0496111_0152396 Ga0496111_0152396_244_1494 372
314 3300048929 Ga0496126_0026487 Ga0496126_0026487_2226_3476 372
315 3300053087 Ga0500643_001892 Ga0500643_001892_267_1493 372
316 3300053088 Ga0500644_0000533 Ga0500644_0000533_4963_6189 372
317 3300053119 Ga0500595_000002 Ga0500595_000002_978565_979791 372
318 3300053119 Ga0500595_000109 Ga0500595_000109_1968_3224 372
319 3300053153 Ga0500616_0000002 Ga0500616_0000002_1089201_1090427 372
320 3300053178 Ga0500637_0038226 Ga0500637_0038226_33_1274 372
321 3300053730 Ga0500645_000156 Ga0500645_000156_26004_27230 372
322 iso_pu_bacteria 2891088606 2891091380 372
323 3300046455 Ga0495603_0035040 Ga0495603_0035040_995_2152 374
324 3300046461 Ga0495641_0017974 Ga0495641_0017974_351_1508 374
325 3300046474 Ga0495605_0000966 Ga0495605_0000966_1024_2181 374
326 3300046491 Ga0495584_0000878 Ga0495584_0000878_1243_2400 374
327 3300046492 Ga0495585_0003129 Ga0495585_0003129_1117_2274 374
328 3300046516 Ga0495628_0019068 Ga0495628_0019068_270_1427 374
329 3300046518 Ga0495631_0007232 Ga0495631_0007232_4155_5312 374
330 3300046536 Ga0495587_0040432 Ga0495587_0040432_387_1544 374
331 3300046615 Ga0495656_0000083 Ga0495656_0000083_1157_2314 374
332 3300046691 Ga0495670_0031372 Ga0495670_0031372_1118_2275 374
333 3300046692 Ga0495671_0012771 Ga0495671_0012771_580_1737 374
334 3300046794 Ga0495589_0003699 Ga0495589_0003699_5969_7126 374
335 3300047315 Ga0495581_0001020 Ga0495581_0001020_4375_5532 374
336 3300047321 Ga0495676_0043322 Ga0495676_0043322_995_2152 374
337 3300047469 Ga0495673_0003311 Ga0495673_0003311_8692_9849 374
338 3300047470 Ga0495681_0014181 Ga0495681_0014181_3065_4222 374
339 3300059477 Ga0587084_000108 Ga0587084_000108_3314_4471 374
340 3300020080 Ga0206350_10665434 Ga0206350_106654343 375
341 3300022467 Ga0224712_10008092 Ga0224712_100080923 375
342 3300003308 Ga0006777J48905_1081508 Ga0006777J48905_10815083 376
343 3300022467 Ga0224712_10001644 Ga0224712_100016445 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00033

Cytochrome_B

Cytochrome b/b6/petB

31

219

0.99

PF13631

Cytochrom_B_N_2

Cytochrome b(N-terminal)/b6/petB

101

270

0.96

PF00032

Cytochrom_B_C

Cytochrome b(C-terminal)/b6/petD

275

393

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bel-assembly1.cif.gz_M cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ciii membrane domain) 0.8528 6 363
1zrt-assembly1.cif.gz_P rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound 0.8428 2 362
2fyn-assembly1.cif.gz_A crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex 0.8345 2 365
2yiu-assembly1.cif.gz_D x-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution 0.8326 2 365
7jrg-assembly1.cif.gz_C plant mitochondrial complex iii2 from vigna radiata 0.832 6 365
ID Description Score Start End Superfamily
2fynA00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8345 2 365 1.20.810.10
af_Q7HP03_2_368_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8234 9 368 1.20.810.10
3cwbC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8231 5 373 1.20.810.10
1kyoC00 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.8229 1 374 1.20.810.10
af_P24890_1_369_1.20.810.10 Mainly Alpha;Up-down Bundle;Cytochrome Bc1 Complex; Chain C;Cytochrome Bc1 Complex; Chain C 0.818 1 373 1.20.810.10
ID Description Score Start End GO Terms
AF-A0A6F8Z1P1-F1-model_v4 Cytochrome b 0.8529 6 364 GO:0005743
GO:0009055
GO:0016491
GO:0022904
GO:0046872
AF-A7J1C0-F1-model_v4 Cytochrome b 0.8521 14 344 GO:0005743
GO:0006122
GO:0008121
GO:0045275
GO:0046872
AF-A0A2E4S603-F1-model_v4 Cytochrome b 0.8515 2 362 GO:0008121
GO:0022904
GO:0045275
GO:0046872
AF-A1C1F7-F1-model_v4 Cytochrome b 0.851 13 345 GO:0005743
GO:0006122
GO:0008121
GO:0045275
GO:0046872
AF-A0A424RUB0-F1-model_v4 Cytochrome b 0.8507 72 362 GO:0008121
GO:0022904
GO:0045275
GO:0046872

Feature Viewer

pLDDT pTM Quality
78.82 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map