F415082

General Info

Members Datasets Scaffolds Average Seq Length
342 196 684 264

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100039324|Ga0070704_1000393241
Length 311
Sequence LRVLRRSALKQPFNAECARTAEKHLQIATSPFSEFCIIRASETIRMTTTLFSGSKPVIGVIHVGALPGTPRSSQTVTELVALAKSEAALYRESGVDGVIIENMHDVPYLRGEVGPEIVAAMTAIAIEVKHECRLPLGVQILAGANIEAMAVAHAAGLDFIRAEGYAYAHVADEGLIQSSAARLLRYRKMIGATVQVWADVKKKHAAHAITADVSLGETAETIEFMGADCVIVTGSATGKAPAIADVQEAKSHCRLPVFLGSGITAENIGEFYEYADGFIVGSAFKVDGGWLNTIDPSRVDGFMKVVRKYSS

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
179 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
180 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
181 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
182 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
183 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
184 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
185 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
186 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 2.34
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 20.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100039324 3300005549 Unclassified 3247
2 MRS1b_contig_8512381 2162886011 Bacteria 3101
3 Ga0065714_10002198 3300005288 Bacteria 90565
4 Ga0065712_10000119 3300005290 Bacteria 137052
5 Ga0065712_10005904 3300005290 Unclassified 3883
6 Ga0065715_10003036 3300005293 Bacteria 4236
7 Ga0065715_10093197 3300005293 Bacteria 4771
8 Ga0065715_10106977 3300005293 Bacteria 2789
9 Ga0065707_10111680 3300005295 Bacteria 2386
10 Ga0070676_10052988 3300005328 Bacteria 2388
11 Ga0070690_100087689 3300005330 Bacteria 2044
12 Ga0070670_100084438 3300005331 Bacteria 2728
13 Ga0070670_100412699 3300005331 Unclassified 1193
14 Ga0068869_100271815 3300005334 Bacteria 1360
15 Ga0070680_100419349 3300005336 Bacteria 1142
16 Ga0070680_100514724 3300005336 Bacteria 1024
17 Ga0070682_100008023 3300005337 Bacteria 5945
18 Ga0068868_100465203 3300005338 Unclassified 1102
19 Ga0068868_100511976 3300005338 Bacteria 1052
20 Ga0070660_100030236 3300005339 Bacteria 4063
21 Ga0070660_100070648 3300005339 Bacteria 2725
22 Ga0070689_100000172 3300005340 Bacteria 38591
23 Ga0070689_100009459 3300005340 Bacteria 6909
24 Ga0070689_100065012 3300005340 Bacteria 2840
25 Ga0070689_100240157 3300005340 Unclassified 1492
26 Ga0070687_100017256 3300005343 Bacteria 3314
27 Ga0070661_100185303 3300005344 Bacteria 1585
28 Ga0070669_100003621 3300005353 Bacteria 11145
29 Ga0070669_100529795 3300005353 Unclassified 980
30 Ga0070675_100036360 3300005354 Bacteria 4007
31 Ga0070675_100104686 3300005354 Unclassified 2387
32 Ga0070675_100220458 3300005354 Unclassified 1652
33 Ga0070675_100286325 3300005354 Unclassified 1449
34 Ga0070671_100026905 3300005355 Bacteria 4732
35 Ga0070673_100048162 3300005364 Bacteria 3321
36 Ga0070673_100102815 3300005364 Unclassified 2356
37 Ga0070673_100339548 3300005364 Unclassified 1331
38 Ga0070673_100707468 3300005364 Bacteria 925
39 Ga0070688_100236108 3300005365 Bacteria 1295
40 Ga0070659_100106109 3300005366 Bacteria 2264
41 Ga0070667_100028996 3300005367 Bacteria 4609
42 Ga0070667_100069971 3300005367 Bacteria 2987
43 Ga0070701_10005687 3300005438 Bacteria 5178
44 Ga0070701_10285836 3300005438 Bacteria 1009
45 Ga0070705_100023640 3300005440 Bacteria 3304
46 Ga0070705_100237305 3300005440 Unclassified 1272
47 Ga0070700_100000136 3300005441 Bacteria 44059
48 Ga0070700_100089948 3300005441 Unclassified 2001
49 Ga0070700_100377155 3300005441 Bacteria 1059
50 Ga0070694_100301068 3300005444 Bacteria 1229
51 Ga0070708_100004212 3300005445 Bacteria 11300
52 Ga0070678_100007885 3300005456 Bacteria 6338
53 Ga0070678_100146541 3300005456 Unclassified 1896
54 Ga0070662_100001369 3300005457 Bacteria 14981
55 Ga0070662_100313132 3300005457 Bacteria 1278
56 Ga0070681_10007299 3300005458 Bacteria 10787
57 Ga0070681_10434712 3300005458 Bacteria 1224
58 Ga0068867_100036459 3300005459 Bacteria 3570
59 Ga0068867_100070588 3300005459 Bacteria 2612
60 Ga0068867_100404321 3300005459 Unclassified 1152
61 Ga0070685_10005137 3300005466 Bacteria 6634
62 Ga0070685_10017160 3300005466 Bacteria 3871
63 Ga0070706_100022648 3300005467 Bacteria 5785
64 Ga0070707_100000201 3300005468 Bacteria 59927
65 Ga0070707_100028544 3300005468 Bacteria 5311
66 Ga0070707_100098189 3300005468 Bacteria 2837
67 Ga0070707_100502628 3300005468 Bacteria 1174
68 Ga0070698_100039811 3300005471 Bacteria 4834
69 Ga0070698_100384834 3300005471 Bacteria 1335
70 Ga0070699_100019017 3300005518 Bacteria 5907
71 Ga0070679_100418692 3300005530 Bacteria 1285
72 Ga0070684_100785275 3300005535 Bacteria 890
73 Ga0070697_100054021 3300005536 Bacteria 3265
74 Ga0068853_100038650 3300005539 Bacteria 4065
75 Ga0068853_100516556 3300005539 Bacteria 1129
76 Ga0070672_100025859 3300005543 Unclassified 4360
77 Ga0070686_100016602 3300005544 Bacteria 4285
78 Ga0070695_100098469 3300005545 Unclassified 1965
79 Ga0070695_100147775 3300005545 Unclassified 1637
80 Ga0070696_100295637 3300005546 Unclassified 1239
81 Ga0070696_100303291 3300005546 Unclassified 1224
82 Ga0070696_100453071 3300005546 Unclassified 1013
83 Ga0070665_100469872 3300005548 Bacteria 1268
84 Ga0070704_100050330 3300005549 Unclassified 2928
85 Ga0070664_100007199 3300005564 Bacteria 8972
86 Ga0070664_100145328 3300005564 Bacteria 2091
87 Ga0070664_100360028 3300005564 Bacteria 1325
88 Ga0068857_100006103 3300005577 Bacteria 10294
89 Ga0068857_100232699 3300005577 Bacteria 1686
90 Ga0068856_100001463 3300005614 Bacteria 24731
91 Ga0068856_100129771 3300005614 Bacteria 2525
92 Ga0070702_100006596 3300005615 Bacteria 5506
93 Ga0068859_100005663 3300005617 Bacteria 12715
94 Ga0068859_100021556 3300005617 Bacteria 6468
95 Ga0068859_100066068 3300005617 Unclassified 3651
96 Ga0068859_100117065 3300005617 Bacteria 2730
97 Ga0068859_100294007 3300005617 Bacteria 1717
98 Ga0068859_100316903 3300005617 Bacteria 1653
99 Ga0068859_100604399 3300005617 Bacteria 1190
100 Ga0068864_100002479 3300005618 Bacteria 15239
101 Ga0068864_100054009 3300005618 Bacteria 3467
102 Ga0068864_100381276 3300005618 Bacteria 1336
103 Ga0068861_100003135 3300005719 Bacteria 10923
104 Ga0068861_100290480 3300005719 Bacteria 1412
105 Ga0068870_10009567 3300005840 Bacteria 4415
106 Ga0068870_10027567 3300005840 Unclassified 2843
107 Ga0068858_100098859 3300005842 Unclassified 2721
108 Ga0068860_100096580 3300005843 Bacteria 2817
109 Ga0068860_100620829 3300005843 Bacteria 1087
110 Ga0068862_100007002 3300005844 Bacteria 9361
111 Ga0068862_100269042 3300005844 Unclassified 1558
112 Ga0081455_10362493 3300005937 Bacteria 1018
113 Ga0070716_100015206 3300006173 Bacteria 3950
114 Ga0097621_100043501 3300006237 Bacteria 3620
115 Ga0097621_100065416 3300006237 Bacteria 2992
116 Ga0068871_100013651 3300006358 Bacteria 6033
117 Ga0068871_100057776 3300006358 Bacteria 3157
118 Ga0075431_100064624 3300006847 Unclassified 3778
119 Ga0075431_100235101 3300006847 Bacteria 1866
120 Ga0075433_10006516 3300006852 Bacteria 9237
121 Ga0075433_10032937 3300006852 Bacteria 4440
122 Ga0075433_10468215 3300006852 Bacteria 1110
123 Ga0075433_10473265 3300006852 Unclassified 1104
124 Ga0075434_100003778 3300006871 Bacteria 13525
125 Ga0075434_100372554 3300006871 Unclassified 1449
126 Ga0075429_100103310 3300006880 Bacteria 2489
127 Ga0075429_100140581 3300006880 Bacteria 2113
128 Ga0075436_100050326 3300006914 Bacteria 2875
129 Ga0097620_100005663 3300006931 Bacteria 12715
130 Ga0097620_100021556 3300006931 Bacteria 6468
131 Ga0097620_100066068 3300006931 Unclassified 3651
132 Ga0097620_100117065 3300006931 Bacteria 2730
133 Ga0097620_100294005 3300006931 Bacteria 1717
134 Ga0097620_100316893 3300006931 Bacteria 1653
135 Ga0097620_100604416 3300006931 Bacteria 1190
136 Ga0075435_100435551 3300007076 Bacteria 1130
137 Ga0111539_10075141 3300009094 Bacteria 3981
138 Ga0111539_11015087 3300009094 Bacteria 964
139 Ga0114129_10026128 3300009147 Bacteria 8268
140 Ga0114129_10071208 3300009147 Bacteria 4848
141 Ga0114129_10081033 3300009147 Bacteria 4512
142 Ga0114129_10874749 3300009147 Unclassified 1140
143 Ga0105243_10003036 3300009148 Bacteria 13844
144 Ga0105243_10572465 3300009148 Bacteria 1083
145 Ga0105241_10091135 3300009174 Bacteria 2404
146 Ga0105242_10078505 3300009176 Bacteria 2756
147 Ga0105248_10002996 3300009177 Bacteria 18729
148 Ga0105248_10057559 3300009177 Bacteria 4364
149 Ga0105248_10093865 3300009177 Bacteria 3379
150 Ga0105248_10103935 3300009177 Bacteria 3202
151 Ga0105248_10155956 3300009177 Bacteria 2576
152 Ga0105248_10464955 3300009177 Bacteria 1426
153 Ga0105237_10166807 3300009545 Bacteria 2201
154 Ga0105238_10048113 3300009551 Unclassified 4299
155 Ga0105249_10010325 3300009553 Bacteria 8207
156 Ga0105249_10327208 3300009553 Unclassified 1545
157 Ga0105239_10047863 3300010375 Bacteria 4687
158 Ga0105246_10040687 3300011119 Bacteria 3139
159 Ga0105246_10121422 3300011119 Unclassified 1937
160 Ga0157373_10564381 3300013100 Unclassified 826
161 Ga0157378_10012645 3300013297 Bacteria 7386
162 Ga0163162_10052777 3300013306 Bacteria 4084
163 Ga0163162_10071877 3300013306 Bacteria 3514
164 Ga0157372_10358986 3300013307 Bacteria 1698
165 Ga0157372_10642522 3300013307 Bacteria 1236
166 Ga0157375_10004678 3300013308 Bacteria 11904
167 Ga0157375_10007053 3300013308 Bacteria 9816
168 Ga0157375_10020799 3300013308 Bacteria 6006
169 Ga0157375_10211415 3300013308 Unclassified 2097
170 Ga0163163_10001344 3300014325 Bacteria 20761
171 Ga0163163_10005140 3300014325 Bacteria 11280
172 Ga0163163_10028746 3300014325 Bacteria 5343
173 Ga0163163_10354203 3300014325 Bacteria 1524
174 Ga0157380_10092553 3300014326 Bacteria 2498
175 Ga0157377_10098547 3300014745 Bacteria 1737
176 Ga0157377_10203346 3300014745 Bacteria 1259
177 Ga0157376_10027290 3300014969 Bacteria 4524
178 Ga0157376_10077644 3300014969 Bacteria 2841
179 Ga0207697_10003804 3300025315 Bacteria 7368
180 Ga0207642_10080315 3300025899 Bacteria 1581
181 Ga0207647_10001031 3300025904 Bacteria 21586
182 Ga0207645_10023890 3300025907 Bacteria 3967
183 Ga0207643_10002976 3300025908 Bacteria 9137
184 Ga0207643_10010380 3300025908 Bacteria 5015
185 Ga0207643_10063709 3300025908 Bacteria 2109
186 Ga0207705_10361500 3300025909 Bacteria 1119
187 Ga0207707_10042744 3300025912 Bacteria 3954
188 Ga0207695_10255310 3300025913 Unclassified 1652
189 Ga0207693_10354809 3300025915 Bacteria 1147
190 Ga0207660_10037294 3300025917 Unclassified 3386
191 Ga0207662_10008723 3300025918 Bacteria 5560
192 Ga0207662_10009039 3300025918 Bacteria 5473
193 Ga0207657_10040743 3300025919 Bacteria 4113
194 Ga0207646_10000362 3300025922 Bacteria 61074
195 Ga0207646_10237053 3300025922 Unclassified 1648
196 Ga0207681_10007850 3300025923 Bacteria 6532
197 Ga0207681_10456571 3300025923 Unclassified 1040
198 Ga0207694_10014613 3300025924 Bacteria 5920
199 Ga0207650_10337158 3300025925 Bacteria 1238
200 Ga0207659_10171422 3300025926 Unclassified 1712
201 Ga0207644_10010429 3300025931 Bacteria 6123
202 Ga0207690_10098014 3300025932 Bacteria 2087
203 Ga0207706_10003484 3300025933 Bacteria 15020
204 Ga0207686_10181414 3300025934 Bacteria 1493
205 Ga0207709_10011886 3300025935 Bacteria 4802
206 Ga0207670_10000260 3300025936 Bacteria 33119
207 Ga0207670_10028285 3300025936 Bacteria 3557
208 Ga0207670_10042423 3300025936 Unclassified 2997
209 Ga0207670_10112728 3300025936 Bacteria 1963
210 Ga0207704_10115244 3300025938 Unclassified 1826
211 Ga0207665_10013301 3300025939 Bacteria 5410
212 Ga0207691_10029962 3300025940 Bacteria 5089
213 Ga0207691_10137991 3300025940 Bacteria 2150
214 Ga0207691_10432072 3300025940 Bacteria 1121
215 Ga0207711_10007482 3300025941 Bacteria 9133
216 Ga0207711_10103999 3300025941 Unclassified 2515
217 Ga0207711_10262895 3300025941 Unclassified 1586
218 Ga0207689_10011113 3300025942 Bacteria 7731
219 Ga0207689_10034905 3300025942 Unclassified 4177
220 Ga0207689_10074860 3300025942 Bacteria 2782
221 Ga0207679_10113164 3300025945 Bacteria 2146
222 Ga0207679_10484050 3300025945 Bacteria 1102
223 Ga0207667_10179525 3300025949 Bacteria 2174
224 Ga0207667_10252103 3300025949 Unclassified 1806
225 Ga0207651_10157955 3300025960 Unclassified 1774
226 Ga0207651_10310337 3300025960 Unclassified 1315
227 Ga0207712_10130633 3300025961 Bacteria 1914
228 Ga0207668_10031743 3300025972 Bacteria 3483
229 Ga0207658_10027215 3300025986 Bacteria 4015
230 Ga0207658_10051507 3300025986 Unclassified 3035
231 Ga0207658_10570357 3300025986 Bacteria 1014
232 Ga0207703_10030086 3300026035 Bacteria 4289
233 Ga0207639_10408379 3300026041 Bacteria 1225
234 Ga0207708_10000101 3300026075 Bacteria 64996
235 Ga0207708_10017919 3300026075 Bacteria 5329
236 Ga0207708_10026161 3300026075 Bacteria 4414
237 Ga0207708_10040320 3300026075 Bacteria 3560
238 Ga0207702_10002750 3300026078 Bacteria 16457
239 Ga0207641_10046014 3300026088 Bacteria 3677
240 Ga0207648_10012624 3300026089 Bacteria 7903
241 Ga0207648_10207389 3300026089 Unclassified 1739
242 Ga0207648_10259542 3300026089 Unclassified 1550
243 Ga0207676_10027700 3300026095 Bacteria 4223
244 Ga0207676_10030793 3300026095 Bacteria 4030
245 Ga0207676_10701560 3300026095 Bacteria 980
246 Ga0207674_10000206 3300026116 Bacteria 73345
247 Ga0207674_10186611 3300026116 Unclassified 2024
248 Ga0207674_10314562 3300026116 Unclassified 1515
249 Ga0207675_100012414 3300026118 Bacteria 7957
250 Ga0207675_100029648 3300026118 Bacteria 5095
251 Ga0207675_100183534 3300026118 Bacteria 2004
252 Ga0207675_100205183 3300026118 Bacteria 1894
253 Ga0207675_100279383 3300026118 Bacteria 1622
254 Ga0207683_10063793 3300026121 Bacteria 3246
255 Ga0207683_10109805 3300026121 Bacteria 2469
256 Ga0207698_10296071 3300026142 Bacteria 1504
257 Ga0207428_10398777 3300027907 Bacteria 1007
258 Ga0268265_10006097 3300028380 Bacteria 8181
259 Ga0268265_10031651 3300028380 Bacteria 3822
260 Ga0268265_10094051 3300028380 Unclassified 2403
261 Ga0268265_10661950 3300028380 Bacteria 1005
262 Ga0268264_10160640 3300028381 Unclassified 2024
263 Ga0265338_10003727 3300028800 Bacteria 21199
264 Ga0314311_1261863 3300030733 Bacteria 2152
265 Ga0307408_100196747 3300031548 Bacteria 1628
266 Ga0307413_10006917 3300031824 Bacteria 5221
267 Ga0307410_10080805 3300031852 Bacteria 2282
268 Ga0307406_10032033 3300031901 Bacteria 3206
269 Ga0307406_10114955 3300031901 Unclassified 1860
270 Ga0307407_10005746 3300031903 Bacteria 5422
271 Ga0307412_10013619 3300031911 Bacteria 4775
272 Ga0307409_100007855 3300031995 Bacteria 6421
273 Ga0307409_100263464 3300031995 Bacteria 1583
274 Ga0307416_100000914 3300032002 Bacteria 15587
275 Ga0307416_100135764 3300032002 Bacteria 2225
276 Ga0307416_100249032 3300032002 Bacteria 1728
277 Ga0307414_10161018 3300032004 Bacteria 1783
278 Ga0307411_10000339 3300032005 Bacteria 15753
279 Ga0307411_10425411 3300032005 Unclassified 1104
280 Ga0307415_100013660 3300032126 Bacteria 4747
281 Ga0307415_100020903 3300032126 Bacteria 4009
282 Ga0373959_0000577 3300034820 Bacteria 6412
283 Ga0373923_0154697 3300035111 Bacteria 1043
284 Ga0373943_0074973 3300035170 Bacteria 1722
285 Ga0373925_0321682 3300037068 Bacteria 1252
286 Ga0395900_0028437 3300037418 Bacteria 5726
287 Ga0395900_0105560 3300037418 Bacteria 2894
288 Ga0395905_0006635 3300037471 Bacteria 11603
289 Ga0395905_0211901 3300037471 Bacteria 1815
290 Ga0395901_0014412 3300038443 Bacteria 8046
291 Ga0242420_008371 3300038996 Bacteria 1676
292 Ga0436365_1740655 3300039437 Bacteria 1128
293 Ga0451807_1030458 3300041486 Bacteria 2271
294 Ga0439458_0073603 3300042157 Unclassified 865
295 Ga0451577_0009838 3300042876 Bacteria 9162
296 Ga0466969_0124972 3300044656 Bacteria 1195
297 Ga0466961_0000631 3300044693 Bacteria 22058
298 Ga0466963_0161055 3300044694 Bacteria 1562
299 Ga0451576_0522401 3300045051 Unclassified 1247
300 Ga0451576_0534214 3300045051 Bacteria 1232
301 Ga0466958_0223592 3300045836 Bacteria 1201
302 Ga0495662_0178295 3300046476 Bacteria 1047
303 Ga0495594_0061333 3300046499 Bacteria 2081
304 Ga0495669_0116206 3300046684 Bacteria 1252
305 Ga0496102_0017812 3300048905 Bacteria 6228
306 Ga0496104_0110283 3300048907 Bacteria 2638
307 Ga0496104_0259199 3300048907 Bacteria 1652
308 Ga0496106_0424301 3300048909 Bacteria 1069
309 Ga0496111_0526113 3300048914 Bacteria 869
310 Ga0496112_0351645 3300048915 Bacteria 1416
311 Ga0496113_0217359 3300048916 Bacteria 1523
312 Ga0501292_009019 3300049515 Unclassified 1473
313 Ga0501293_004873 3300049516 Unclassified 1065
314 Ga0501295_009651 3300049518 Unclassified 1492
315 Ga0501298_002204 3300049521 Unclassified 2933
316 Ga0501223_015724 3300049663 Bacteria 1498
317 Ga0501235_018591 3300049669 Bacteria 1540
318 Ga0501260_000195 3300049689 Bacteria 4641
319 Ga0501234_030988 3300049707 Unclassified 864
320 Ga0501271_007300 3300049768 Unclassified 1111
321 Ga0501283_000950 3300049779 Unclassified 3846
322 nmdc:mga05p37_103673_c1 3300050507 Bacteria 3500
323 nmdc:mga09592_140509_c1 3300050508 Bacteria 2081
324 nmdc:mga09592_270182_c1 3300050508 Unclassified 1475
325 nmdc:mga09592_45646_c1 3300050508 Unclassified 3691
326 nmdc:mga0qj67_21412_c1 3300050509 Bacteria 4960
327 nmdc:mga0qj67_73301_c1 3300050509 Bacteria 2735
328 nmdc:mga06r32_236784_c1 3300050510 Bacteria 1813
329 nmdc:mga06r32_367415_c1 3300050510 Bacteria 1422
330 nmdc:mga06r32_52728_c1 3300050510 Unclassified 3896
331 nmdc:mga08y16_220410_c1 3300050511 Bacteria 1964
332 nmdc:mga08y16_49842_c1 3300050511 Bacteria 4381
333 nmdc:mga0n895_865_c1 3300050512 Bacteria 21747
334 nmdc:mga0rr50_450365_c1 3300050513 Bacteria 1091
335 nmdc:mga0rr50_587377_c1 3300050513 Unclassified 949
336 nmdc:mga08x19_41232_c1 3300050514 Bacteria 2940
337 nmdc:mga0a205_1201_c1 3300050515 Bacteria 21664
338 nmdc:mga0a205_485597_c1 3300050515 Bacteria 1093
339 nmdc:mga0a205_61337_c1 3300050515 Bacteria 3632
340 nmdc:mga0a205_8701_c1 3300050515 Bacteria 9243
341 nmdc:mga0a205_88901_c1 3300050515 Bacteria 2986
342 Ga0500616_0003776 3300053153 Bacteria 11269
343 Ga0070704_100039324
344 MRS1b_contig_8512381
345 Ga0065714_10002198
346 Ga0065712_10000119
347 Ga0065712_10005904
348 Ga0065715_10003036
349 Ga0065715_10093197
350 Ga0065715_10106977
351 Ga0065707_10111680
352 Ga0070676_10052988
353 Ga0070690_100087689
354 Ga0070670_100084438
355 Ga0070670_100412699
356 Ga0068869_100271815
357 Ga0070680_100419349
358 Ga0070680_100514724
359 Ga0070682_100008023
360 Ga0068868_100465203
361 Ga0068868_100511976
362 Ga0070660_100030236
363 Ga0070660_100070648
364 Ga0070689_100000172
365 Ga0070689_100009459
366 Ga0070689_100065012
367 Ga0070689_100240157
368 Ga0070687_100017256
369 Ga0070661_100185303
370 Ga0070669_100003621
371 Ga0070669_100529795
372 Ga0070675_100036360
373 Ga0070675_100104686
374 Ga0070675_100220458
375 Ga0070675_100286325
376 Ga0070671_100026905
377 Ga0070673_100048162
378 Ga0070673_100102815
379 Ga0070673_100339548
380 Ga0070673_100707468
381 Ga0070688_100236108
382 Ga0070659_100106109
383 Ga0070667_100028996
384 Ga0070667_100069971
385 Ga0070701_10005687
386 Ga0070701_10285836
387 Ga0070705_100023640
388 Ga0070705_100237305
389 Ga0070700_100000136
390 Ga0070700_100089948
391 Ga0070700_100377155
392 Ga0070694_100301068
393 Ga0070708_100004212
394 Ga0070678_100007885
395 Ga0070678_100146541
396 Ga0070662_100001369
397 Ga0070662_100313132
398 Ga0070681_10007299
399 Ga0070681_10434712
400 Ga0068867_100036459
401 Ga0068867_100070588
402 Ga0068867_100404321
403 Ga0070685_10005137
404 Ga0070685_10017160
405 Ga0070706_100022648
406 Ga0070707_100000201
407 Ga0070707_100028544
408 Ga0070707_100098189
409 Ga0070707_100502628
410 Ga0070698_100039811
411 Ga0070698_100384834
412 Ga0070699_100019017
413 Ga0070679_100418692
414 Ga0070684_100785275
415 Ga0070697_100054021
416 Ga0068853_100038650
417 Ga0068853_100516556
418 Ga0070672_100025859
419 Ga0070686_100016602
420 Ga0070695_100098469
421 Ga0070695_100147775
422 Ga0070696_100295637
423 Ga0070696_100303291
424 Ga0070696_100453071
425 Ga0070665_100469872
426 Ga0070704_100050330
427 Ga0070664_100007199
428 Ga0070664_100145328
429 Ga0070664_100360028
430 Ga0068857_100006103
431 Ga0068857_100232699
432 Ga0068856_100001463
433 Ga0068856_100129771
434 Ga0070702_100006596
435 Ga0068859_100005663
436 Ga0068859_100021556
437 Ga0068859_100066068
438 Ga0068859_100117065
439 Ga0068859_100294007
440 Ga0068859_100316903
441 Ga0068859_100604399
442 Ga0068864_100002479
443 Ga0068864_100054009
444 Ga0068864_100381276
445 Ga0068861_100003135
446 Ga0068861_100290480
447 Ga0068870_10009567
448 Ga0068870_10027567
449 Ga0068858_100098859
450 Ga0068860_100096580
451 Ga0068860_100620829
452 Ga0068862_100007002
453 Ga0068862_100269042
454 Ga0081455_10362493
455 Ga0070716_100015206
456 Ga0097621_100043501
457 Ga0097621_100065416
458 Ga0068871_100013651
459 Ga0068871_100057776
460 Ga0075431_100064624
461 Ga0075431_100235101
462 Ga0075433_10006516
463 Ga0075433_10032937
464 Ga0075433_10468215
465 Ga0075433_10473265
466 Ga0075434_100003778
467 Ga0075434_100372554
468 Ga0075429_100103310
469 Ga0075429_100140581
470 Ga0075436_100050326
471 Ga0097620_100005663
472 Ga0097620_100021556
473 Ga0097620_100066068
474 Ga0097620_100117065
475 Ga0097620_100294005
476 Ga0097620_100316893
477 Ga0097620_100604416
478 Ga0075435_100435551
479 Ga0111539_10075141
480 Ga0111539_11015087
481 Ga0114129_10026128
482 Ga0114129_10071208
483 Ga0114129_10081033
484 Ga0114129_10874749
485 Ga0105243_10003036
486 Ga0105243_10572465
487 Ga0105241_10091135
488 Ga0105242_10078505
489 Ga0105248_10002996
490 Ga0105248_10057559
491 Ga0105248_10093865
492 Ga0105248_10103935
493 Ga0105248_10155956
494 Ga0105248_10464955
495 Ga0105237_10166807
496 Ga0105238_10048113
497 Ga0105249_10010325
498 Ga0105249_10327208
499 Ga0105239_10047863
500 Ga0105246_10040687
501 Ga0105246_10121422
502 Ga0157373_10564381
503 Ga0157378_10012645
504 Ga0163162_10052777
505 Ga0163162_10071877
506 Ga0157372_10358986
507 Ga0157372_10642522
508 Ga0157375_10004678
509 Ga0157375_10007053
510 Ga0157375_10020799
511 Ga0157375_10211415
512 Ga0163163_10001344
513 Ga0163163_10005140
514 Ga0163163_10028746
515 Ga0163163_10354203
516 Ga0157380_10092553
517 Ga0157377_10098547
518 Ga0157377_10203346
519 Ga0157376_10027290
520 Ga0157376_10077644
521 Ga0207697_10003804
522 Ga0207642_10080315
523 Ga0207647_10001031
524 Ga0207645_10023890
525 Ga0207643_10002976
526 Ga0207643_10010380
527 Ga0207643_10063709
528 Ga0207705_10361500
529 Ga0207707_10042744
530 Ga0207695_10255310
531 Ga0207693_10354809
532 Ga0207660_10037294
533 Ga0207662_10008723
534 Ga0207662_10009039
535 Ga0207657_10040743
536 Ga0207646_10000362
537 Ga0207646_10237053
538 Ga0207681_10007850
539 Ga0207681_10456571
540 Ga0207694_10014613
541 Ga0207650_10337158
542 Ga0207659_10171422
543 Ga0207644_10010429
544 Ga0207690_10098014
545 Ga0207706_10003484
546 Ga0207686_10181414
547 Ga0207709_10011886
548 Ga0207670_10000260
549 Ga0207670_10028285
550 Ga0207670_10042423
551 Ga0207670_10112728
552 Ga0207704_10115244
553 Ga0207665_10013301
554 Ga0207691_10029962
555 Ga0207691_10137991
556 Ga0207691_10432072
557 Ga0207711_10007482
558 Ga0207711_10103999
559 Ga0207711_10262895
560 Ga0207689_10011113
561 Ga0207689_10034905
562 Ga0207689_10074860
563 Ga0207679_10113164
564 Ga0207679_10484050
565 Ga0207667_10179525
566 Ga0207667_10252103
567 Ga0207651_10157955
568 Ga0207651_10310337
569 Ga0207712_10130633
570 Ga0207668_10031743
571 Ga0207658_10027215
572 Ga0207658_10051507
573 Ga0207658_10570357
574 Ga0207703_10030086
575 Ga0207639_10408379
576 Ga0207708_10000101
577 Ga0207708_10017919
578 Ga0207708_10026161
579 Ga0207708_10040320
580 Ga0207702_10002750
581 Ga0207641_10046014
582 Ga0207648_10012624
583 Ga0207648_10207389
584 Ga0207648_10259542
585 Ga0207676_10027700
586 Ga0207676_10030793
587 Ga0207676_10701560
588 Ga0207674_10000206
589 Ga0207674_10186611
590 Ga0207674_10314562
591 Ga0207675_100012414
592 Ga0207675_100029648
593 Ga0207675_100183534
594 Ga0207675_100205183
595 Ga0207675_100279383
596 Ga0207683_10063793
597 Ga0207683_10109805
598 Ga0207698_10296071
599 Ga0207428_10398777
600 Ga0268265_10006097
601 Ga0268265_10031651
602 Ga0268265_10094051
603 Ga0268265_10661950
604 Ga0268264_10160640
605 Ga0265338_10003727
606 Ga0314311_1261863
607 Ga0307408_100196747
608 Ga0307413_10006917
609 Ga0307410_10080805
610 Ga0307406_10032033
611 Ga0307406_10114955
612 Ga0307407_10005746
613 Ga0307412_10013619
614 Ga0307409_100007855
615 Ga0307409_100263464
616 Ga0307416_100000914
617 Ga0307416_100135764
618 Ga0307416_100249032
619 Ga0307414_10161018
620 Ga0307411_10000339
621 Ga0307411_10425411
622 Ga0307415_100013660
623 Ga0307415_100020903
624 Ga0373959_0000577
625 Ga0373923_0154697
626 Ga0373943_0074973
627 Ga0373925_0321682
628 Ga0395900_0028437
629 Ga0395900_0105560
630 Ga0395905_0006635
631 Ga0395905_0211901
632 Ga0395901_0014412
633 Ga0242420_008371
634 Ga0436365_1740655
635 Ga0451807_1030458
636 Ga0439458_0073603
637 Ga0451577_0009838
638 Ga0466969_0124972
639 Ga0466961_0000631
640 Ga0466963_0161055
641 Ga0451576_0522401
642 Ga0451576_0534214
643 Ga0466958_0223592
644 Ga0495662_0178295
645 Ga0495594_0061333
646 Ga0495669_0116206
647 Ga0496102_0017812
648 Ga0496104_0110283
649 Ga0496104_0259199
650 Ga0496106_0424301
651 Ga0496111_0526113
652 Ga0496112_0351645
653 Ga0496113_0217359
654 Ga0501292_009019
655 Ga0501293_004873
656 Ga0501295_009651
657 Ga0501298_002204
658 Ga0501223_015724
659 Ga0501235_018591
660 Ga0501260_000195
661 Ga0501234_030988
662 Ga0501271_007300
663 Ga0501283_000950
664 nmdc:mga05p37_103673_c1
665 nmdc:mga09592_140509_c1
666 nmdc:mga09592_270182_c1
667 nmdc:mga09592_45646_c1
668 nmdc:mga0qj67_21412_c1
669 nmdc:mga0qj67_73301_c1
670 nmdc:mga06r32_236784_c1
671 nmdc:mga06r32_367415_c1
672 nmdc:mga06r32_52728_c1
673 nmdc:mga08y16_220410_c1
674 nmdc:mga08y16_49842_c1
675 nmdc:mga0n895_865_c1
676 nmdc:mga0rr50_450365_c1
677 nmdc:mga0rr50_587377_c1
678 nmdc:mga08x19_41232_c1
679 nmdc:mga0a205_1201_c1
680 nmdc:mga0a205_485597_c1
681 nmdc:mga0a205_61337_c1
682 nmdc:mga0a205_8701_c1
683 nmdc:mga0a205_88901_c1
684 Ga0500616_0003776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03437

BtpA

BtpA family

53

308

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3na8-assembly1.cif.gz_B crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa 0.6827 14 188
1zp4-assembly1.cif.gz_B glu28gln mutant of e. coli methylenetetrahydrofolate reductase (oxidized) complex with methyltetrahydrofolate 0.6546 9 215
3t7v-assembly1.cif.gz_A crystal structure of methylornithine synthase (pylb) 0.6535 4 216
3mi3-assembly1.cif.gz_B homocitrate synthase lys4 bound to lysine 0.652 8 214
2eja-assembly1.cif.gz_B crystal structure of uroporphyrinogen decarboxylase from aquifex aeolicus 0.6502 33 209
ID Description Score Start End Superfamily
af_Q1NZ26_14_274_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.92 7 226 3.20.20.70
af_A0A0R4ISR8_10_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9189 7 226 3.20.20.70
af_Q9VS44_1_141_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8893 2 132 3.20.20.70
af_Q58515_8_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8772 9 226 3.20.20.70
af_Q58515_37_229_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.856 39 228 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7T9GKF9-F1-model_v4 deleted 0.9524 16 132
AF-A0A7M4E8N1-F1-model_v4 Uncharacterized protein 0.944 22 159
AF-A0A7V5N8Q5-F1-model_v4 BtpA/SgcQ family protein 0.9435 9 219
AF-E9J7K8-F1-model_v4 Uncharacterized protein 0.9421 94 159
AF-A0A660QC54-F1-model_v4 Phosphorybosylanthranilate isomerase 0.9416 12 155 GO:0016853

Map