F415027

General Info

Members Datasets Scaffolds Average Seq Length
342 223 684 155

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100018846|Ga0070680_1000188464
Length 175
Sequence MSAAQPPPWDFPAPHVVTLEVLPADIDAYDHVNNSIYLAWFDRAAWSHSATLGITLEQCVKTLRRGMAAHRTEIDYLRAAVLGDRVLVGTWIAGTDSKLRVQRRFQVRRAADGETLVQARTDYVCINLDSGRAARMPDVFQRAYIVTQPVPAGHPLASRSVGGTDGPAHPAITPK

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
128 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
129 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
217 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 7.89
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 8.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100018846 3300005336 Bacteria 5459
2 JGI25406J46586_10002815 3300003203 Bacteria 8181
3 rootH1_10007364 3300003316 Bacteria 2597
4 rootH1_10194968 3300003323 Bacteria 2856
5 Ga0070658_10972798 3300005327 Unclassified 738
6 Ga0070683_101421178 3300005329 Unclassified 667
7 Ga0070690_100407758 3300005330 Bacteria 999
8 Ga0070670_100075642 3300005331 Bacteria 2893
9 Ga0068869_100973966 3300005334 Bacteria 737
10 Ga0070666_10403756 3300005335 Bacteria 983
11 Ga0070666_10544981 3300005335 Bacteria 843
12 Ga0070680_100250582 3300005336 Bacteria 1497
13 Ga0068868_100119416 3300005338 Bacteria 2149
14 Ga0070661_100960558 3300005344 Unclassified 707
15 Ga0070668_100742038 3300005347 Bacteria 869
16 Ga0070675_100004080 3300005354 Bacteria 11087
17 Ga0070671_100000751 3300005355 Bacteria 23255
18 Ga0070671_100011956 3300005355 Bacteria 6983
19 Ga0070671_100158030 3300005355 Bacteria 1916
20 Ga0070674_100364915 3300005356 Bacteria 1170
21 Ga0070674_100393908 3300005356 Bacteria 1130
22 Ga0070667_100021888 3300005367 Bacteria 5305
23 Ga0070667_100042177 3300005367 Bacteria 3828
24 Ga0070667_100114886 3300005367 Bacteria 2337
25 Ga0070709_10035310 3300005434 Bacteria 3038
26 Ga0070713_100000417 3300005436 Bacteria 27109
27 Ga0070710_10576484 3300005437 Unclassified 780
28 Ga0070711_100110015 3300005439 Bacteria 2021
29 Ga0070711_101095381 3300005439 Unclassified 686
30 Ga0070705_100242916 3300005440 Bacteria 1259
31 Ga0070694_100462164 3300005444 Bacteria 1004
32 Ga0070694_100477689 3300005444 Bacteria 988
33 Ga0070663_100138511 3300005455 Bacteria 1855
34 Ga0070678_100002149 3300005456 Bacteria 10689
35 Ga0070681_10030408 3300005458 Bacteria 5418
36 Ga0070681_10066590 3300005458 Bacteria 3571
37 Ga0068867_100051698 3300005459 Bacteria 3031
38 Ga0068867_101296383 3300005459 Bacteria 672
39 Ga0070679_100083920 3300005530 Bacteria 3174
40 Ga0070684_100073810 3300005535 Bacteria 3006
41 Ga0068853_101114833 3300005539 Unclassified 761
42 Ga0070686_100508283 3300005544 Bacteria 936
43 Ga0070695_100060747 3300005545 Bacteria 2450
44 Ga0070696_100000849 3300005546 Bacteria 19716
45 Ga0070696_100729151 3300005546 Unclassified 810
46 Ga0070665_100000853 3300005548 Bacteria 39671
47 Ga0070665_100002714 3300005548 Bacteria 19192
48 Ga0070665_100020795 3300005548 Bacteria 6596
49 Ga0070665_100025908 3300005548 Bacteria 5906
50 Ga0070665_101305739 3300005548 Unclassified 735
51 Ga0070704_101071412 3300005549 Bacteria 731
52 Ga0068855_100005679 3300005563 Bacteria 15242
53 Ga0068855_100427424 3300005563 Bacteria 1448
54 Ga0070664_100100785 3300005564 Bacteria 2511
55 Ga0068854_100178178 3300005578 Bacteria 1659
56 Ga0068856_100042952 3300005614 Bacteria 4448
57 Ga0068856_101483462 3300005614 Unclassified 692
58 Ga0068852_100607508 3300005616 Bacteria 1098
59 Ga0068859_100000607 3300005617 Bacteria 35844
60 Ga0068859_100048383 3300005617 Bacteria 4272
61 Ga0068859_100139171 3300005617 Bacteria 2501
62 Ga0068859_100317679 3300005617 Bacteria 1651
63 Ga0068859_100428514 3300005617 Bacteria 1419
64 Ga0068861_100022152 3300005719 Bacteria 4574
65 Ga0068861_100188239 3300005719 Bacteria 1723
66 Ga0068851_10834502 3300005834 Unclassified 574
67 Ga0068863_100002143 3300005841 Bacteria 19588
68 Ga0068863_100007490 3300005841 Bacteria 10676
69 Ga0068858_100000426 3300005842 Bacteria 43886
70 Ga0068858_100015738 3300005842 Bacteria 7114
71 Ga0068858_100275753 3300005842 Bacteria 1601
72 Ga0068860_100000293 3300005843 Bacteria 70629
73 Ga0068860_100012670 3300005843 Bacteria 8295
74 Ga0068860_100799318 3300005843 Bacteria 956
75 Ga0068862_100014413 3300005844 Bacteria 6559
76 Ga0068862_101845075 3300005844 Unclassified 614
77 Ga0081455_10000040 3300005937 Bacteria 134280
78 Ga0081539_10000219 3300005985 Bacteria 134405
79 Ga0070715_10012210 3300006163 Bacteria 3119
80 Ga0070715_10140981 3300006163 Bacteria 1171
81 Ga0070716_100000520 3300006173 Bacteria 16068
82 Ga0070712_100003852 3300006175 Bacteria 9235
83 Ga0097621_100068336 3300006237 Bacteria 2930
84 Ga0097621_100254401 3300006237 Bacteria 1539
85 Ga0068871_100027114 3300006358 Bacteria 4478
86 Ga0068871_100226809 3300006358 Bacteria 1620
87 Ga0075430_100004226 3300006846 Bacteria 12123
88 Ga0075431_100006107 3300006847 Bacteria 11946
89 Ga0075433_10015508 3300006852 Bacteria 6254
90 Ga0075434_100014712 3300006871 Bacteria 7486
91 Ga0068865_100007325 3300006881 Bacteria 6781
92 Ga0097620_100000607 3300006931 Bacteria 35844
93 Ga0097620_100048384 3300006931 Bacteria 4272
94 Ga0097620_100139172 3300006931 Bacteria 2501
95 Ga0097620_100317703 3300006931 Bacteria 1651
96 Ga0097620_100428569 3300006931 Bacteria 1419
97 Ga0105250_10066074 3300009092 Bacteria 1458
98 Ga0105240_10004030 3300009093 Bacteria 22598
99 Ga0105240_10145035 3300009093 Bacteria 2834
100 Ga0105240_10245117 3300009093 Bacteria 2075
101 Ga0111539_10399943 3300009094 Bacteria 1600
102 Ga0105245_10012385 3300009098 Bacteria 7423
103 Ga0105247_10000150 3300009101 Bacteria 68542
104 Ga0105241_10100007 3300009174 Bacteria 2304
105 Ga0105241_10219001 3300009174 Bacteria 1599
106 Ga0105242_10009645 3300009176 Bacteria 7399
107 Ga0105248_10016028 3300009177 Bacteria 8248
108 Ga0105248_10034729 3300009177 Bacteria 5641
109 Ga0105237_10040833 3300009545 Bacteria 4679
110 Ga0105237_10087504 3300009545 Bacteria 3105
111 Ga0105237_10312440 3300009545 Bacteria 1575
112 Ga0105237_11104799 3300009545 Bacteria 800
113 Ga0105238_10178811 3300009551 Bacteria 2098
114 Ga0105238_10365167 3300009551 Bacteria 1433
115 Ga0105238_10422744 3300009551 Bacteria 1327
116 Ga0105238_10433388 3300009551 Bacteria 1310
117 Ga0105249_10015881 3300009553 Bacteria 6673
118 Ga0105249_10038214 3300009553 Bacteria 4355
119 Ga0105249_10302256 3300009553 Bacteria 1605
120 Ga0105249_10417259 3300009553 Bacteria 1375
121 Ga0099796_10012959 3300010159 Bacteria 2370
122 Ga0105239_10344306 3300010375 Bacteria 1683
123 Ga0105239_10434522 3300010375 Bacteria 1488
124 Ga0105239_10615623 3300010375 Bacteria 1239
125 Ga0157369_11110282 3300013105 Bacteria 808
126 Ga0157374_10012194 3300013296 Bacteria 7469
127 Ga0157374_10229580 3300013296 Bacteria 1823
128 Ga0157378_10002944 3300013297 Bacteria 15145
129 Ga0163162_10136021 3300013306 Bacteria 2568
130 Ga0163162_10250934 3300013306 Bacteria 1901
131 Ga0157372_10477231 3300013307 Bacteria 1454
132 Ga0157375_10014834 3300013308 Bacteria 6962
133 Ga0163163_10009251 3300014325 Bacteria 8788
134 Ga0163163_10436395 3300014325 Bacteria 1369
135 Ga0157380_10046421 3300014326 Bacteria 3411
136 Ga0157380_10108290 3300014326 Bacteria 2329
137 Ga0157380_10265378 3300014326 Bacteria 1562
138 Ga0157377_10026150 3300014745 Bacteria 3120
139 Ga0157377_10107470 3300014745 Bacteria 1672
140 Ga0157379_10002635 3300014968 Bacteria 15097
141 Ga0157379_10017378 3300014968 Bacteria 6337
142 Ga0157379_10087704 3300014968 Bacteria 2790
143 Ga0157379_10136725 3300014968 Bacteria 2208
144 Ga0157376_10018418 3300014969 Bacteria 5353
145 Ga0213874_10001996 3300021377 Bacteria 4301
146 Ga0213874_10228612 3300021377 Bacteria 679
147 Ga0207696_1073954 3300025711 Bacteria 945
148 Ga0207710_10001288 3300025900 Bacteria 12673
149 Ga0207680_10016226 3300025903 Bacteria 3905
150 Ga0207680_10287517 3300025903 Bacteria 1144
151 Ga0207699_10030452 3300025906 Bacteria 3020
152 Ga0207654_10208997 3300025911 Bacteria 1289
153 Ga0207654_10827630 3300025911 Unclassified 669
154 Ga0207707_10148300 3300025912 Bacteria 2051
155 Ga0207707_11002085 3300025912 Unclassified 685
156 Ga0207695_10008168 3300025913 Bacteria 13152
157 Ga0207695_10065528 3300025913 Bacteria 3735
158 Ga0207695_10152204 3300025913 Bacteria 2251
159 Ga0207671_10050299 3300025914 Bacteria 3086
160 Ga0207671_10080826 3300025914 Bacteria 2437
161 Ga0207671_10725521 3300025914 Bacteria 790
162 Ga0207693_10000211 3300025915 Bacteria 53479
163 Ga0207663_10078191 3300025916 Bacteria 2156
164 Ga0207660_10095912 3300025917 Bacteria 2207
165 Ga0207660_10214073 3300025917 Bacteria 1510
166 Ga0207649_10425517 3300025920 Bacteria 998
167 Ga0207652_10072671 3300025921 Bacteria 2991
168 Ga0207694_10083116 3300025924 Bacteria 2518
169 Ga0207694_10239402 3300025924 Bacteria 1483
170 Ga0207694_10353286 3300025924 Bacteria 1217
171 Ga0207650_10447134 3300025925 Bacteria 1075
172 Ga0207659_10002770 3300025926 Bacteria 10454
173 Ga0207687_10056996 3300025927 Bacteria 2743
174 Ga0207644_10003235 3300025931 Bacteria 10497
175 Ga0207704_10053341 3300025938 Bacteria 2457
176 Ga0207665_10001664 3300025939 Bacteria 14962
177 Ga0207711_10575961 3300025941 Bacteria 1050
178 Ga0207661_10403347 3300025944 Unclassified 1240
179 Ga0207679_10139606 3300025945 Bacteria 1957
180 Ga0207667_10001029 3300025949 Bacteria 35522
181 Ga0207651_10052536 3300025960 Bacteria 2779
182 Ga0207712_10019287 3300025961 Bacteria 4452
183 Ga0207712_10810076 3300025961 Bacteria 824
184 Ga0207640_10021998 3300025981 Bacteria 3810
185 Ga0207658_10007661 3300025986 Bacteria 7352
186 Ga0207658_10070507 3300025986 Bacteria 2644
187 Ga0207658_10210625 3300025986 Bacteria 1628
188 Ga0207677_10203386 3300026023 Bacteria 1576
189 Ga0207703_10000893 3300026035 Bacteria 29266
190 Ga0207703_10063430 3300026035 Bacteria 3030
191 Ga0207702_10023534 3300026078 Bacteria 5109
192 Ga0207641_10000350 3300026088 Bacteria 55088
193 Ga0207641_10019227 3300026088 Bacteria 5605
194 Ga0207641_10147820 3300026088 Bacteria 2126
195 Ga0207648_10013339 3300026089 Bacteria 7652
196 Ga0207648_10488073 3300026089 Bacteria 1126
197 Ga0207676_10295427 3300026095 Bacteria 1477
198 Ga0207676_10537641 3300026095 Bacteria 1115
199 Ga0207675_101144265 3300026118 Bacteria 798
200 Ga0207683_10002256 3300026121 Bacteria 16911
201 Ga0207698_10216161 3300026142 Bacteria 1728
202 Ga0207428_10349206 3300027907 Bacteria 1088
203 Ga0268266_10000228 3300028379 Bacteria 97214
204 Ga0268266_10004321 3300028379 Bacteria 13666
205 Ga0268266_10015518 3300028379 Bacteria 6535
206 Ga0268266_10057680 3300028379 Bacteria 3342
207 Ga0268265_10039310 3300028380 Bacteria 3487
208 Ga0268265_10576347 3300028380 Bacteria 1072
209 Ga0268264_10000824 3300028381 Bacteria 33279
210 Ga0268264_10126133 3300028381 Bacteria 2262
211 Ga0265334_10020750 3300028573 Bacteria 2688
212 Ga0307511_10000105 3300030521 Bacteria 75047
213 Ga0307511_10043249 3300030521 Bacteria 3768
214 Ga0307512_10193652 3300030522 Bacteria 1116
215 Ga0265339_10392980 3300031249 Unclassified 649
216 Ga0307509_10000017 3300031507 Bacteria 265012
217 Ga0307408_101071779 3300031548 Bacteria 746
218 Ga0307510_10000002 3300033180 Bacteria 801565
219 Ga0373954_0192042 3300035118 Bacteria 1003
220 Ga0373956_0229311 3300035119 Bacteria 882
221 Ga0373943_0256529 3300035170 Bacteria 983
222 Ga0373946_0068554 3300035171 Bacteria 1526
223 Ga0373924_0204267 3300035410 Bacteria 872
224 Ga0373935_0029163 3300035692 Bacteria 3415
225 Ga0373927_0402488 3300035695 Bacteria 903
226 Ga0373933_0099854 3300035724 Bacteria 1800
227 Ga0373937_0052859 3300036401 Bacteria 3726
228 Ga0373925_0101718 3300037068 Bacteria 2210
229 Ga0436365_0122571 3300039437 Bacteria 5215
230 Ga0436360_1014905 3300039438 Bacteria 3561
231 Ga0436360_1257747 3300039438 Bacteria 1144
232 Ga0436361_0694834 3300039447 Bacteria 1783
233 Ga0436361_0723837 3300039447 Bacteria 1154
234 Ga0436363_0064575 3300039450 Bacteria 8839
235 Ga0436363_0260549 3300039450 Bacteria 5798
236 Ga0466969_0014819 3300044656 Bacteria 4095
237 Ga0466969_0123051 3300044656 Bacteria 1206
238 Ga0466972_0122367 3300044658 Bacteria 1227
239 Ga0466965_0527586 3300044683 Unclassified 665
240 Ga0466961_0005084 3300044693 Bacteria 8275
241 Ga0466964_0001760 3300044706 Bacteria 7504
242 Ga0453684_0172028 3300044712 Bacteria 2552
243 Ga0466971_0002474 3300044719 Bacteria 7803
244 Ga0466968_0040953 3300044735 Bacteria 1954
245 Ga0466970_0178651 3300044765 Bacteria 1177
246 Ga0466959_0002661 3300045049 Bacteria 11462
247 Ga0466959_0014535 3300045049 Bacteria 5725
248 Ga0466959_0040533 3300045049 Bacteria 3440
249 Ga0466958_0063904 3300045836 Bacteria 2245
250 Ga0495629_0279338 3300046459 Bacteria 1146
251 Ga0495580_0012560 3300046472 Bacteria 6490
252 Ga0495580_0291369 3300046472 Bacteria 1113
253 Ga0495639_0246419 3300046475 Bacteria 883
254 Ga0495606_0074970 3300046507 Bacteria 2118
255 Ga0495628_0314954 3300046516 Bacteria 1156
256 Ga0495630_0632917 3300046517 Bacteria 819
257 Ga0495632_0028564 3300046519 Bacteria 2910
258 Ga0495643_0319525 3300046522 Unclassified 702
259 Ga0495586_0147390 3300046535 Bacteria 1323
260 Ga0495586_0656015 3300046535 Unclassified 606
261 Ga0495668_0064452 3300046616 Bacteria 2017
262 Ga0495634_0217091 3300046642 Bacteria 1182
263 Ga0495634_0372725 3300046642 Bacteria 852
264 Ga0495649_0233837 3300046694 Bacteria 948
265 Ga0495581_0246483 3300047315 Bacteria 1045
266 Ga0495687_011779 3300047443 Bacteria 4674
267 Ga0495687_181730 3300047443 Unclassified 686
268 Ga0495602_0582489 3300048088 Bacteria 772
269 Ga0496100_0007333 3300048903 Bacteria 6074
270 Ga0496100_0075340 3300048903 Bacteria 2263
271 Ga0496102_0008842 3300048905 Bacteria 8641
272 Ga0496102_0012615 3300048905 Bacteria 7320
273 Ga0496102_0525503 3300048905 Bacteria 1106
274 Ga0496103_0334441 3300048906 Bacteria 974
275 Ga0496104_0160470 3300048907 Bacteria 2156
276 Ga0496104_0441740 3300048907 Bacteria 1213
277 Ga0496105_0087973 3300048908 Bacteria 2566
278 Ga0496105_0162299 3300048908 Bacteria 1834
279 Ga0496106_0071900 3300048909 Bacteria 2644
280 Ga0496106_0484869 3300048909 Bacteria 993
281 Ga0496107_0003868 3300048910 Bacteria 10065
282 Ga0496108_0007679 3300048911 Bacteria 8735
283 Ga0496109_0260886 3300048912 Bacteria 1632
284 Ga0496109_1447273 3300048912 Unclassified 622
285 Ga0496110_0002124 3300048913 Bacteria 14797
286 Ga0496111_0144143 3300048914 Bacteria 1765
287 Ga0496112_0075086 3300048915 Bacteria 3343
288 Ga0496112_0102908 3300048915 Bacteria 2825
289 Ga0496113_0055925 3300048916 Bacteria 2960
290 Ga0496114_0003207 3300048917 Bacteria 12545
291 Ga0496114_0033086 3300048917 Bacteria 4258
292 Ga0496114_0086421 3300048917 Bacteria 2658
293 Ga0496115_0043076 3300048918 Bacteria 3598
294 Ga0496115_0143254 3300048918 Bacteria 1971
295 Ga0496115_0820888 3300048918 Bacteria 722
296 Ga0496119_0029863 3300048922 Bacteria 3685
297 Ga0496119_0156622 3300048922 Bacteria 1215
298 Ga0496119_0171512 3300048922 Bacteria 1145
299 Ga0496120_0008387 3300048923 Bacteria 7505
300 Ga0496120_0032356 3300048923 Bacteria 3154
301 Ga0496120_0083796 3300048923 Bacteria 1720
302 Ga0496121_0006857 3300048924 Bacteria 13925
303 Ga0496121_0113132 3300048924 Bacteria 2066
304 Ga0496124_0389916 3300048927 Bacteria 970
305 Ga0496125_0032883 3300048928 Bacteria 4599
306 Ga0496125_0257301 3300048928 Bacteria 1096
307 Ga0496126_0009283 3300048929 Bacteria 10478
308 Ga0496126_0011376 3300048929 Bacteria 9221
309 Ga0496126_0246297 3300048929 Bacteria 1491
310 Ga0496126_0426300 3300048929 Bacteria 1071
311 Ga0496126_1061283 3300048929 Unclassified 604
312 Ga0495682_0329022 3300049460 Unclassified 539
313 Ga0501038_0432716 3300049574 Bacteria 1014
314 Ga0501039_0175360 3300049575 Bacteria 1686
315 Ga0501040_0049683 3300049576 Bacteria 2868
316 Ga0501042_0666955 3300049578 Bacteria 756
317 Ga0501046_0478767 3300049580 Bacteria 893
318 Ga0501048_0371698 3300049582 Bacteria 1020
319 Ga0501069_0240434 3300049585 Bacteria 1055
320 Ga0501071_0030530 3300049587 Bacteria 3813
321 Ga0501076_0073628 3300049592 Bacteria 2735
322 Ga0501076_0370602 3300049592 Bacteria 1177
323 Ga0501079_0044100 3300049741 Bacteria 3442
324 Ga0501081_0023274 3300049743 Bacteria 4152
325 Ga0501035_0835154 3300049822 Unclassified 734
326 nmdc:mga09592_314965_c1 3300050508 Bacteria 1356
327 nmdc:mga0qj67_27486_c1 3300050509 Bacteria 4411
328 nmdc:mga06r32_29657_c1 3300050510 Bacteria 5130
329 nmdc:mga08y16_623336_c1 3300050511 Bacteria 1085
330 nmdc:mga0n895_80031_c1 3300050512 Bacteria 3255
331 nmdc:mga0rr50_124533_c1 3300050513 Bacteria 2056
332 nmdc:mga0a205_7454_c1 3300050515 Bacteria 9906
333 Ga0495601_0113322 3300053077 Unclassified 1758
334 Ga0500583_0039849 3300053092 Bacteria 2125
335 Ga0500648_272566 3300053097 Unclassified 772
336 Ga0500559_0110371 3300053136 Unclassified 1274
337 Ga0500639_291152 3300053163 Unclassified 621
338 Ga0500637_0008129 3300053178 Bacteria 5278
339 Ga0500637_0380744 3300053178 Unclassified 740
340 Ga0587090_036880 3300059510 Bacteria 844
341 Ga0501082_0196760 3300060353 Bacteria 1754
342 Ga0466962_0005222 3300061719 Bacteria 6246
343 Ga0070680_100018846
344 JGI25406J46586_10002815
345 rootH1_10007364
346 rootH1_10194968
347 Ga0070658_10972798
348 Ga0070683_101421178
349 Ga0070690_100407758
350 Ga0070670_100075642
351 Ga0068869_100973966
352 Ga0070666_10403756
353 Ga0070666_10544981
354 Ga0070680_100250582
355 Ga0068868_100119416
356 Ga0070661_100960558
357 Ga0070668_100742038
358 Ga0070675_100004080
359 Ga0070671_100000751
360 Ga0070671_100011956
361 Ga0070671_100158030
362 Ga0070674_100364915
363 Ga0070674_100393908
364 Ga0070667_100021888
365 Ga0070667_100042177
366 Ga0070667_100114886
367 Ga0070709_10035310
368 Ga0070713_100000417
369 Ga0070710_10576484
370 Ga0070711_100110015
371 Ga0070711_101095381
372 Ga0070705_100242916
373 Ga0070694_100462164
374 Ga0070694_100477689
375 Ga0070663_100138511
376 Ga0070678_100002149
377 Ga0070681_10030408
378 Ga0070681_10066590
379 Ga0068867_100051698
380 Ga0068867_101296383
381 Ga0070679_100083920
382 Ga0070684_100073810
383 Ga0068853_101114833
384 Ga0070686_100508283
385 Ga0070695_100060747
386 Ga0070696_100000849
387 Ga0070696_100729151
388 Ga0070665_100000853
389 Ga0070665_100002714
390 Ga0070665_100020795
391 Ga0070665_100025908
392 Ga0070665_101305739
393 Ga0070704_101071412
394 Ga0068855_100005679
395 Ga0068855_100427424
396 Ga0070664_100100785
397 Ga0068854_100178178
398 Ga0068856_100042952
399 Ga0068856_101483462
400 Ga0068852_100607508
401 Ga0068859_100000607
402 Ga0068859_100048383
403 Ga0068859_100139171
404 Ga0068859_100317679
405 Ga0068859_100428514
406 Ga0068861_100022152
407 Ga0068861_100188239
408 Ga0068851_10834502
409 Ga0068863_100002143
410 Ga0068863_100007490
411 Ga0068858_100000426
412 Ga0068858_100015738
413 Ga0068858_100275753
414 Ga0068860_100000293
415 Ga0068860_100012670
416 Ga0068860_100799318
417 Ga0068862_100014413
418 Ga0068862_101845075
419 Ga0081455_10000040
420 Ga0081539_10000219
421 Ga0070715_10012210
422 Ga0070715_10140981
423 Ga0070716_100000520
424 Ga0070712_100003852
425 Ga0097621_100068336
426 Ga0097621_100254401
427 Ga0068871_100027114
428 Ga0068871_100226809
429 Ga0075430_100004226
430 Ga0075431_100006107
431 Ga0075433_10015508
432 Ga0075434_100014712
433 Ga0068865_100007325
434 Ga0097620_100000607
435 Ga0097620_100048384
436 Ga0097620_100139172
437 Ga0097620_100317703
438 Ga0097620_100428569
439 Ga0105250_10066074
440 Ga0105240_10004030
441 Ga0105240_10145035
442 Ga0105240_10245117
443 Ga0111539_10399943
444 Ga0105245_10012385
445 Ga0105247_10000150
446 Ga0105241_10100007
447 Ga0105241_10219001
448 Ga0105242_10009645
449 Ga0105248_10016028
450 Ga0105248_10034729
451 Ga0105237_10040833
452 Ga0105237_10087504
453 Ga0105237_10312440
454 Ga0105237_11104799
455 Ga0105238_10178811
456 Ga0105238_10365167
457 Ga0105238_10422744
458 Ga0105238_10433388
459 Ga0105249_10015881
460 Ga0105249_10038214
461 Ga0105249_10302256
462 Ga0105249_10417259
463 Ga0099796_10012959
464 Ga0105239_10344306
465 Ga0105239_10434522
466 Ga0105239_10615623
467 Ga0157369_11110282
468 Ga0157374_10012194
469 Ga0157374_10229580
470 Ga0157378_10002944
471 Ga0163162_10136021
472 Ga0163162_10250934
473 Ga0157372_10477231
474 Ga0157375_10014834
475 Ga0163163_10009251
476 Ga0163163_10436395
477 Ga0157380_10046421
478 Ga0157380_10108290
479 Ga0157380_10265378
480 Ga0157377_10026150
481 Ga0157377_10107470
482 Ga0157379_10002635
483 Ga0157379_10017378
484 Ga0157379_10087704
485 Ga0157379_10136725
486 Ga0157376_10018418
487 Ga0213874_10001996
488 Ga0213874_10228612
489 Ga0207696_1073954
490 Ga0207710_10001288
491 Ga0207680_10016226
492 Ga0207680_10287517
493 Ga0207699_10030452
494 Ga0207654_10208997
495 Ga0207654_10827630
496 Ga0207707_10148300
497 Ga0207707_11002085
498 Ga0207695_10008168
499 Ga0207695_10065528
500 Ga0207695_10152204
501 Ga0207671_10050299
502 Ga0207671_10080826
503 Ga0207671_10725521
504 Ga0207693_10000211
505 Ga0207663_10078191
506 Ga0207660_10095912
507 Ga0207660_10214073
508 Ga0207649_10425517
509 Ga0207652_10072671
510 Ga0207694_10083116
511 Ga0207694_10239402
512 Ga0207694_10353286
513 Ga0207650_10447134
514 Ga0207659_10002770
515 Ga0207687_10056996
516 Ga0207644_10003235
517 Ga0207704_10053341
518 Ga0207665_10001664
519 Ga0207711_10575961
520 Ga0207661_10403347
521 Ga0207679_10139606
522 Ga0207667_10001029
523 Ga0207651_10052536
524 Ga0207712_10019287
525 Ga0207712_10810076
526 Ga0207640_10021998
527 Ga0207658_10007661
528 Ga0207658_10070507
529 Ga0207658_10210625
530 Ga0207677_10203386
531 Ga0207703_10000893
532 Ga0207703_10063430
533 Ga0207702_10023534
534 Ga0207641_10000350
535 Ga0207641_10019227
536 Ga0207641_10147820
537 Ga0207648_10013339
538 Ga0207648_10488073
539 Ga0207676_10295427
540 Ga0207676_10537641
541 Ga0207675_101144265
542 Ga0207683_10002256
543 Ga0207698_10216161
544 Ga0207428_10349206
545 Ga0268266_10000228
546 Ga0268266_10004321
547 Ga0268266_10015518
548 Ga0268266_10057680
549 Ga0268265_10039310
550 Ga0268265_10576347
551 Ga0268264_10000824
552 Ga0268264_10126133
553 Ga0265334_10020750
554 Ga0307511_10000105
555 Ga0307511_10043249
556 Ga0307512_10193652
557 Ga0265339_10392980
558 Ga0307509_10000017
559 Ga0307408_101071779
560 Ga0307510_10000002
561 Ga0373954_0192042
562 Ga0373956_0229311
563 Ga0373943_0256529
564 Ga0373946_0068554
565 Ga0373924_0204267
566 Ga0373935_0029163
567 Ga0373927_0402488
568 Ga0373933_0099854
569 Ga0373937_0052859
570 Ga0373925_0101718
571 Ga0436365_0122571
572 Ga0436360_1014905
573 Ga0436360_1257747
574 Ga0436361_0694834
575 Ga0436361_0723837
576 Ga0436363_0064575
577 Ga0436363_0260549
578 Ga0466969_0014819
579 Ga0466969_0123051
580 Ga0466972_0122367
581 Ga0466965_0527586
582 Ga0466961_0005084
583 Ga0466964_0001760
584 Ga0453684_0172028
585 Ga0466971_0002474
586 Ga0466968_0040953
587 Ga0466970_0178651
588 Ga0466959_0002661
589 Ga0466959_0014535
590 Ga0466959_0040533
591 Ga0466958_0063904
592 Ga0495629_0279338
593 Ga0495580_0012560
594 Ga0495580_0291369
595 Ga0495639_0246419
596 Ga0495606_0074970
597 Ga0495628_0314954
598 Ga0495630_0632917
599 Ga0495632_0028564
600 Ga0495643_0319525
601 Ga0495586_0147390
602 Ga0495586_0656015
603 Ga0495668_0064452
604 Ga0495634_0217091
605 Ga0495634_0372725
606 Ga0495649_0233837
607 Ga0495581_0246483
608 Ga0495687_011779
609 Ga0495687_181730
610 Ga0495602_0582489
611 Ga0496100_0007333
612 Ga0496100_0075340
613 Ga0496102_0008842
614 Ga0496102_0012615
615 Ga0496102_0525503
616 Ga0496103_0334441
617 Ga0496104_0160470
618 Ga0496104_0441740
619 Ga0496105_0087973
620 Ga0496105_0162299
621 Ga0496106_0071900
622 Ga0496106_0484869
623 Ga0496107_0003868
624 Ga0496108_0007679
625 Ga0496109_0260886
626 Ga0496109_1447273
627 Ga0496110_0002124
628 Ga0496111_0144143
629 Ga0496112_0075086
630 Ga0496112_0102908
631 Ga0496113_0055925
632 Ga0496114_0003207
633 Ga0496114_0033086
634 Ga0496114_0086421
635 Ga0496115_0043076
636 Ga0496115_0143254
637 Ga0496115_0820888
638 Ga0496119_0029863
639 Ga0496119_0156622
640 Ga0496119_0171512
641 Ga0496120_0008387
642 Ga0496120_0032356
643 Ga0496120_0083796
644 Ga0496121_0006857
645 Ga0496121_0113132
646 Ga0496124_0389916
647 Ga0496125_0032883
648 Ga0496125_0257301
649 Ga0496126_0009283
650 Ga0496126_0011376
651 Ga0496126_0246297
652 Ga0496126_0426300
653 Ga0496126_1061283
654 Ga0495682_0329022
655 Ga0501038_0432716
656 Ga0501039_0175360
657 Ga0501040_0049683
658 Ga0501042_0666955
659 Ga0501046_0478767
660 Ga0501048_0371698
661 Ga0501069_0240434
662 Ga0501071_0030530
663 Ga0501076_0073628
664 Ga0501076_0370602
665 Ga0501079_0044100
666 Ga0501081_0023274
667 Ga0501035_0835154
668 nmdc:mga09592_314965_c1
669 nmdc:mga0qj67_27486_c1
670 nmdc:mga06r32_29657_c1
671 nmdc:mga08y16_623336_c1
672 nmdc:mga0n895_80031_c1
673 nmdc:mga0rr50_124533_c1
674 nmdc:mga0a205_7454_c1
675 Ga0495601_0113322
676 Ga0500583_0039849
677 Ga0500648_272566
678 Ga0500559_0110371
679 Ga0500639_291152
680 Ga0500637_0008129
681 Ga0500637_0380744
682 Ga0587090_036880
683 Ga0501082_0196760
684 Ga0466962_0005222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

29

99

0.95

PF13279

4HBT_2

Thioesterase-like superfamily

21

144

0.91

PF01643

Acyl-ACP_TE

Acyl-ACP thioesterase N-terminal domain

15

144

0.9

PF20791

Acyl-ACP_TE_C

Acyl-ACP thioesterase C-terminal domain

13

124

0.51

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t06-assembly1.cif.gz_C crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with hexanoyl-coa 0.9706 8 136
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9643 7 138
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9591 8 138
5kl9-assembly1.cif.gz_B crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with coa 0.9571 7 138
5t07-assembly1.cif.gz_A crystal structure of a putative acyl-coa thioesterase ec709/eck0725 from escherichia coli in complex with decanoyl-coa 0.9526 8 138
ID Description Score Start End Superfamily
5t06C00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9706 8 136 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9591 8 138 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.952 8 138 3.10.129.10
3hm0D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9465 8 130 3.10.129.10
1z54D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9449 7 137 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A0R2P5R1-F1-model_v4 deleted 0.9968 2 139
AF-A0A1H7IM20-F1-model_v4 Acyl-CoA thioester hydrolase 0.9959 1 137 GO:0047617
AF-A0A2E3UN79-F1-model_v4 4-hydroxybenzoyl-CoA thioesterase 0.995 1 137 GO:0047617
AF-A0A845N6V1-F1-model_v4 deleted 0.9945 1 139
AF-A0A4T1ZQT7-F1-model_v4 Acyl-CoA thioesterase 0.9944 1 137 GO:0047617

Map