F415002

General Info

Members Datasets Scaffolds Average Seq Length
342 245 684 128

Family's Representative Sequence

Representative Sequence 3300003373|JGI25407J50210_10017153|JGI25407J50210_100171531
Length 136
Sequence MAITTRKEQRMRIYITSVLVDDQEEALRFYTDVLGFVKKTDVPLGEARWLTVVSPEAPEGPELALEPGNPAAGXYKAALVADGIPATSFAVEDVQAEFQRLRGLGVRFTQEPLDMGGVTTAVFDDTCGNLIQIAKA

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
128 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
131 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
132 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
133 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
137 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
138 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
139 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
140 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
148 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
239 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
240 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
241 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
242 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
243 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
244 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
245 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0
Isolates 2.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 2.05
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10017153 3300003373 Bacteria 1878
2 JGI25406J46586_10029172 3300003203 Bacteria 2092
3 JGI25406J46586_10068797 3300003203 Bacteria 1117
4 JGI25407J50210_10016384 3300003373 Bacteria 1920
5 JGI25407J50210_10021923 3300003373 Bacteria 1660
6 JGI25407J50210_10068303 3300003373 Bacteria 888
7 JGI25407J50210_10180701 3300003373 Bacteria 520
8 Ga0065704_10072773 3300005289 Bacteria 8031
9 Ga0070676_10011530 3300005328 Bacteria 4806
10 Ga0070683_100089559 3300005329 Bacteria 2888
11 Ga0070670_100108318 3300005331 Bacteria 2394
12 Ga0070670_100869790 3300005331 Bacteria 816
13 Ga0068869_100019245 3300005334 Bacteria 4660
14 Ga0068868_100006079 3300005338 Bacteria 8524
15 Ga0070660_100096666 3300005339 Bacteria 2336
16 Ga0070661_100060791 3300005344 Bacteria 2772
17 Ga0070692_10043772 3300005345 Bacteria 2304
18 Ga0070668_100086416 3300005347 Bacteria 2466
19 Ga0070669_100457068 3300005353 Bacteria 1053
20 Ga0070675_100001985 3300005354 Bacteria 15169
21 Ga0070688_100802797 3300005365 Bacteria 736
22 Ga0070667_100264077 3300005367 Bacteria 1542
23 Ga0070667_101033633 3300005367 Bacteria 767
24 Ga0070709_10200742 3300005434 Bacteria 1412
25 Ga0070714_101184618 3300005435 Bacteria 745
26 Ga0070701_10973513 3300005438 Bacteria 590
27 Ga0070701_11142529 3300005438 Bacteria 550
28 Ga0070700_100009287 3300005441 Bacteria 5392
29 Ga0070663_100031277 3300005455 Bacteria 3657
30 Ga0070678_100178911 3300005456 Bacteria 1734
31 Ga0070662_100035134 3300005457 Bacteria 3538
32 Ga0070698_100753295 3300005471 Bacteria 917
33 Ga0070684_100013714 3300005535 Bacteria 6541
34 Ga0070672_100088458 3300005543 Bacteria 2494
35 Ga0070693_100110917 3300005547 Bacteria 1687
36 Ga0070704_101141122 3300005549 Bacteria 709
37 Ga0070664_100003931 3300005564 Bacteria 11986
38 Ga0068857_100014729 3300005577 Bacteria 6823
39 Ga0068854_100036481 3300005578 Bacteria 3447
40 Ga0068856_100221780 3300005614 Bacteria 1906
41 Ga0070702_100127567 3300005615 Bacteria 1602
42 Ga0068852_100048464 3300005616 Bacteria 3630
43 Ga0068864_100332782 3300005618 Bacteria 1429
44 Ga0068861_100045422 3300005719 Bacteria 3308
45 Ga0068861_100215305 3300005719 Bacteria 1620
46 Ga0068861_101759637 3300005719 Bacteria 614
47 Ga0068870_10086691 3300005840 Bacteria 1742
48 Ga0068858_101014942 3300005842 Bacteria 813
49 Ga0068860_100119860 3300005843 Bacteria 2519
50 Ga0068862_100030324 3300005844 Bacteria 4557
51 Ga0081538_10001699 3300005981 Bacteria 22436
52 Ga0081538_10002638 3300005981 Bacteria 17324
53 Ga0081538_10019862 3300005981 Bacteria 4970
54 Ga0081538_10041385 3300005981 Bacteria 2925
55 Ga0081538_10046122 3300005981 Bacteria 2693
56 Ga0081538_10056381 3300005981 Bacteria 2302
57 Ga0081539_10000445 3300005985 Bacteria 88000
58 Ga0081539_10001508 3300005985 Bacteria 39310
59 Ga0081539_10002895 3300005985 Bacteria 22739
60 Ga0075432_10105545 3300006058 Bacteria 1045
61 Ga0068871_100668837 3300006358 Bacteria 949
62 Ga0075428_100297480 3300006844 Bacteria 1736
63 Ga0075428_100547144 3300006844 Bacteria 1237
64 Ga0075430_100135342 3300006846 Bacteria 2053
65 Ga0075431_100080796 3300006847 Bacteria 3357
66 Ga0075431_100109370 3300006847 Bacteria 2853
67 Ga0075431_100697202 3300006847 Bacteria 993
68 Ga0075429_100015378 3300006880 Bacteria 6631
69 Ga0075429_100035467 3300006880 Bacteria 4338
70 Ga0068865_100236943 3300006881 Bacteria 1434
71 Ga0111539_10000214 3300009094 Bacteria 69062
72 Ga0111539_10017067 3300009094 Bacteria 8987
73 Ga0105245_10026549 3300009098 Bacteria 5098
74 Ga0114129_10049044 3300009147 Bacteria 5934
75 Ga0114129_10053866 3300009147 Bacteria 5642
76 Ga0114129_12181099 3300009147 Bacteria 667
77 Ga0105241_10266149 3300009174 Bacteria 1458
78 Ga0105249_10074288 3300009553 Bacteria 3147
79 Ga0105028_107307 3300009993 Bacteria 1154
80 Ga0105239_10269089 3300010375 Bacteria 1916
81 Ga0105246_10110527 3300011119 Bacteria 2018
82 Ga0157371_10336574 3300013102 Bacteria 1097
83 Ga0157370_10172967 3300013104 Bacteria 2007
84 Ga0157374_10383248 3300013296 Bacteria 1401
85 Ga0163162_10105684 3300013306 Bacteria 2909
86 Ga0163162_10547121 3300013306 Bacteria 1286
87 Ga0157372_11173439 3300013307 Bacteria 888
88 Ga0163163_12082160 3300014325 Bacteria 627
89 Ga0157380_10065591 3300014326 Bacteria 2919
90 Ga0157377_10019623 3300014745 Bacteria 3533
91 Ga0163161_10562673 3300017792 Bacteria 936
92 Ga0207688_10246370 3300025901 Bacteria 1081
93 Ga0207699_11230614 3300025906 Bacteria 554
94 Ga0207645_10015382 3300025907 Bacteria 5085
95 Ga0207643_10063253 3300025908 Bacteria 2115
96 Ga0207657_10113989 3300025919 Bacteria 2230
97 Ga0207649_10011099 3300025920 Bacteria 4959
98 Ga0207646_10478744 3300025922 Bacteria 1123
99 Ga0207681_10345165 3300025923 Bacteria 1190
100 Ga0207650_10045037 3300025925 Bacteria 3245
101 Ga0207659_10002212 3300025926 Bacteria 11575
102 Ga0207687_10445574 3300025927 Bacteria 1073
103 Ga0207687_11179808 3300025927 Bacteria 658
104 Ga0207706_10030298 3300025933 Bacteria 4827
105 Ga0207704_10375722 3300025938 Bacteria 1114
106 Ga0207691_10106915 3300025940 Bacteria 2491
107 Ga0207689_10017699 3300025942 Bacteria 6022
108 Ga0207661_10003978 3300025944 Bacteria 10325
109 Ga0207679_10027421 3300025945 Bacteria 3939
110 Ga0207668_10378606 3300025972 Bacteria 1191
111 Ga0207658_10439508 3300025986 Bacteria 1153
112 Ga0207677_10003114 3300026023 Bacteria 8756
113 Ga0207678_10175947 3300026067 Bacteria 1827
114 Ga0207708_10004314 3300026075 Bacteria 10470
115 Ga0207702_10189545 3300026078 Bacteria 1899
116 Ga0207676_10060136 3300026095 Bacteria 3004
117 Ga0207674_10003908 3300026116 Bacteria 18130
118 Ga0207675_100018524 3300026118 Bacteria 6494
119 Ga0207675_101254059 3300026118 Bacteria 762
120 Ga0207683_10350921 3300026121 Bacteria 1354
121 Ga0207698_10200166 3300026142 Bacteria 1788
122 Ga0207428_10022996 3300027907 Bacteria 5249
123 Ga0207428_10784278 3300027907 Bacteria 678
124 Ga0268265_10022487 3300028380 Bacteria 4431
125 Ga0307513_10037406 3300031456 Bacteria 5402
126 Ga0307509_10155374 3300031507 Bacteria 2195
127 Ga0307408_100028468 3300031548 Bacteria 3861
128 Ga0307408_100170918 3300031548 Bacteria 1735
129 Ga0307408_102437283 3300031548 Bacteria 508
130 Ga0307405_10028321 3300031731 Bacteria 3261
131 Ga0307405_10163790 3300031731 Bacteria 1578
132 Ga0307405_10336872 3300031731 Bacteria 1158
133 Ga0307405_10932482 3300031731 Bacteria 736
134 Ga0307405_11423651 3300031731 Bacteria 607
135 Ga0307405_11746942 3300031731 Bacteria 552
136 Ga0307413_10033625 3300031824 Bacteria 2922
137 Ga0307413_10042326 3300031824 Bacteria 2676
138 Ga0307413_12160643 3300031824 Bacteria 504
139 Ga0307410_10021593 3300031852 Bacteria 3962
140 Ga0307410_10066062 3300031852 Bacteria 2490
141 Ga0307410_10071847 3300031852 Bacteria 2401
142 Ga0307410_10210358 3300031852 Bacteria 1490
143 Ga0307406_10001367 3300031901 Bacteria 13632
144 Ga0307406_10011374 3300031901 Bacteria 5049
145 Ga0307406_10016848 3300031901 Bacteria 4252
146 Ga0307406_10024847 3300031901 Bacteria 3582
147 Ga0307406_10428173 3300031901 Bacteria 1056
148 Ga0307406_10629156 3300031901 Bacteria 888
149 Ga0307406_11309580 3300031901 Bacteria 632
150 Ga0307407_10007938 3300031903 Bacteria 4837
151 Ga0307407_10031687 3300031903 Bacteria 2866
152 Ga0307407_10044883 3300031903 Bacteria 2494
153 Ga0307407_11600402 3300031903 Bacteria 517
154 Ga0307412_10010371 3300031911 Bacteria 5364
155 Ga0307412_10138659 3300031911 Bacteria 1778
156 Ga0307412_10237064 3300031911 Bacteria 1409
157 Ga0307412_11936816 3300031911 Bacteria 544
158 Ga0307409_100004114 3300031995 Bacteria 8099
159 Ga0307409_100012536 3300031995 Bacteria 5407
160 Ga0307409_100168834 3300031995 Bacteria 1923
161 Ga0307409_100224092 3300031995 Bacteria 1699
162 Ga0307409_100384043 3300031995 Bacteria 1336
163 Ga0307409_100765327 3300031995 Bacteria 970
164 Ga0307409_101399659 3300031995 Bacteria 726
165 Ga0307416_100000862 3300032002 Bacteria 15945
166 Ga0307416_100074835 3300032002 Bacteria 2831
167 Ga0307416_100082578 3300032002 Bacteria 2722
168 Ga0307416_100207934 3300032002 Bacteria 1864
169 Ga0307416_100516246 3300032002 Bacteria 1262
170 Ga0307416_100519215 3300032002 Bacteria 1259
171 Ga0307416_102881058 3300032002 Bacteria 575
172 Ga0307416_103143277 3300032002 Bacteria 552
173 Ga0307414_10014794 3300032004 Bacteria 4690
174 Ga0307414_10091312 3300032004 Bacteria 2263
175 Ga0307414_10248825 3300032004 Bacteria 1476
176 Ga0307411_10015594 3300032005 Bacteria 4274
177 Ga0307411_10050040 3300032005 Bacteria 2719
178 Ga0307411_10668135 3300032005 Bacteria 901
179 Ga0307415_100005437 3300032126 Bacteria 6766
180 Ga0307415_100062565 3300032126 Bacteria 2582
181 Ga0307415_100067184 3300032126 Bacteria 2504
182 Ga0307415_100079460 3300032126 Bacteria 2337
183 Ga0307415_100280924 3300032126 Bacteria 1369
184 Ga0307415_100556635 3300032126 Bacteria 1013
185 Ga0307415_100564620 3300032126 Bacteria 1006
186 Ga0307415_101743944 3300032126 Bacteria 601
187 Ga0307510_10277799 3300033180 Bacteria 1147
188 Ga0373926_0057647 3300035083 Bacteria 1411
189 Ga0373944_0034844 3300035089 Bacteria 1532
190 Ga0373951_0000003 3300035091 Bacteria 99610
191 Ga0373945_0024008 3300035116 Bacteria 2110
192 Ga0373946_0081435 3300035171 Bacteria 1418
193 Ga0373955_0040904 3300035172 Bacteria 2482
194 Ga0373935_0024553 3300035692 Bacteria 3711
195 Ga0373927_0091257 3300035695 Bacteria 1978
196 Ga0373927_0976349 3300035695 Bacteria 559
197 Ga0373933_0077922 3300035724 Bacteria 2027
198 Ga0373947_0965137 3300035725 Bacteria 581
199 Ga0373937_1628479 3300036401 Bacteria 593
200 Ga0373925_0023140 3300037068 Bacteria 4533
201 Ga0395905_0324793 3300037471 Bacteria 1429
202 Ga0395905_0430684 3300037471 Bacteria 1216
203 Ga0436364_1130457 3300037853 Bacteria 820
204 Ga0395901_1333786 3300038443 Bacteria 678
205 Ga0395901_1615194 3300038443 Bacteria 601
206 Ga0237819_00469 3300038705 Bacteria 13739
207 Ga0237816_02679 3300039145 Bacteria 1344
208 Ga0439466_0195258 3300041411 Bacteria 616
209 Ga0451793_0529869 3300041452 Bacteria 647
210 Ga0451800_0768973 3300041459 Bacteria 836
211 Ga0451847_0723301 3300041503 Bacteria 1212
212 Ga0439443_001391 3300042003 Bacteria 2644
213 Ga0439448_0003685 3300042005 Bacteria 4264
214 Ga0439450_005308 3300042008 Bacteria 2260
215 Ga0439450_135558 3300042008 Bacteria 640
216 Ga0439455_0001221 3300042012 Bacteria 4199
217 Ga0439463_001269 3300042016 Bacteria 6743
218 Ga0450914_000325 3300042118 Bacteria 2065
219 Ga0450904_002568 3300042139 Bacteria 2119
220 Ga0450905_007435 3300042142 Bacteria 1492
221 Ga0439458_0068559 3300042157 Bacteria 893
222 Ga0439435_0047659 3300042436 Bacteria 1218
223 Ga0439444_0000048 3300042437 Bacteria 8580
224 Ga0439459_0141402 3300042438 Bacteria 622
225 Ga0439464_0000328 3300042439 Bacteria 9098
226 Ga0439464_0068809 3300042439 Bacteria 1045
227 Ga0439464_0071632 3300042439 Bacteria 1026
228 Ga0439460_0000986 3300042461 Bacteria 6563
229 Ga0439460_0043916 3300042461 Bacteria 1322
230 Ga0439460_0268241 3300042461 Bacteria 592
231 Ga0451577_0018784 3300042876 Bacteria 6360
232 Ga0439440_0000139 3300042993 Bacteria 10437
233 Ga0453683_0825972 3300044673 Bacteria 611
234 Ga0466965_0036387 3300044683 Bacteria 2415
235 Ga0466965_0213240 3300044683 Bacteria 1027
236 Ga0466966_0667632 3300044684 Bacteria 626
237 Ga0466961_0728703 3300044693 Bacteria 593
238 Ga0453684_0344571 3300044712 Bacteria 1681
239 Ga0466971_0346086 3300044719 Bacteria 719
240 Ga0466970_0035284 3300044765 Bacteria 2650
241 Ga0466960_0127943 3300044901 Bacteria 1337
242 Ga0466960_0452041 3300044901 Bacteria 747
243 Ga0466959_0539066 3300045049 Bacteria 787
244 Ga0466959_0719421 3300045049 Bacteria 669
245 Ga0451576_0211208 3300045051 Bacteria 2027
246 Ga0495592_0600386 3300046454 Bacteria 671
247 Ga0495603_0041426 3300046455 Bacteria 2754
248 Ga0495629_0003711 3300046459 Bacteria 11507
249 Ga0495641_0080962 3300046461 Bacteria 1454
250 Ga0495651_0091643 3300046462 Bacteria 2278
251 Ga0495653_0010942 3300046463 Bacteria 7429
252 Ga0495580_0007571 3300046472 Bacteria 8711
253 Ga0495605_0133123 3300046474 Bacteria 1120
254 Ga0495639_0175207 3300046475 Bacteria 1042
255 Ga0495662_0005895 3300046476 Bacteria 6128
256 Ga0495664_0184217 3300046477 Bacteria 1266
257 Ga0495584_0059688 3300046491 Bacteria 1918
258 Ga0495594_0160443 3300046499 Bacteria 1278
259 Ga0495594_0643558 3300046499 Bacteria 600
260 Ga0495596_0104916 3300046500 Bacteria 1098
261 Ga0495607_0129361 3300046501 Bacteria 1316
262 Ga0495608_0287132 3300046511 Bacteria 1020
263 Ga0495618_0013030 3300046514 Bacteria 5054
264 Ga0495628_0162048 3300046516 Bacteria 1699
265 Ga0495630_0082314 3300046517 Bacteria 2429
266 Ga0495631_0093019 3300046518 Bacteria 1298
267 Ga0495644_0096688 3300046523 Bacteria 1116
268 Ga0495663_0042832 3300046525 Bacteria 1381
269 Ga0495666_0010736 3300046526 Bacteria 4569
270 Ga0495652_0102146 3300046529 Bacteria 2323
271 Ga0495665_0007641 3300046531 Bacteria 5852
272 Ga0495586_0373494 3300046535 Bacteria 820
273 Ga0495621_0058530 3300046539 Bacteria 1394
274 Ga0495656_0426212 3300046615 Bacteria 697
275 Ga0495634_0006694 3300046642 Bacteria 8729
276 Ga0495635_0078596 3300046663 Bacteria 2258
277 Ga0495588_0137843 3300046674 Bacteria 1288
278 Ga0495657_0065669 3300046675 Bacteria 2386
279 Ga0495599_0075811 3300046678 Bacteria 2100
280 Ga0495647_0009456 3300046681 Bacteria 3304
281 Ga0495658_0013854 3300046683 Bacteria 4109
282 Ga0495613_0011742 3300046689 Bacteria 6509
283 Ga0495670_0309434 3300046691 Bacteria 847
284 Ga0495670_0584665 3300046691 Bacteria 608
285 Ga0495649_0472829 3300046694 Bacteria 625
286 Ga0495600_0100136 3300046809 Bacteria 1889
287 Ga0495581_0001784 3300047315 Bacteria 12021
288 Ga0495604_0340947 3300047317 Bacteria 998
289 Ga0495674_0007008 3300047319 Bacteria 10783
290 Ga0495676_0125304 3300047321 Bacteria 1862
291 Ga0495676_0520009 3300047321 Bacteria 780
292 Ga0495680_0007274 3300047322 Bacteria 10188
293 Ga0495677_0123062 3300047445 Bacteria 990
294 Ga0495684_0029667 3300047471 Bacteria 4197
295 Ga0495593_0037414 3300047673 Bacteria 2625
296 Ga0495614_0012406 3300048089 Bacteria 3738
297 Ga0496102_1513168 3300048905 Bacteria 590
298 Ga0496102_1966742 3300048905 Bacteria 501
299 Ga0496109_1313969 3300048912 Bacteria 659
300 Ga0496110_1220477 3300048913 Bacteria 661
301 Ga0496113_0524662 3300048916 Bacteria 951
302 Ga0501031_0188048 3300049568 Bacteria 1349
303 Ga0501031_0199459 3300049568 Bacteria 1306
304 Ga0501032_0250664 3300049569 Bacteria 1149
305 Ga0501036_0200098 3300049572 Bacteria 1680
306 Ga0501037_0230445 3300049573 Bacteria 1301
307 Ga0501038_0176951 3300049574 Bacteria 1724
308 Ga0501039_0787444 3300049575 Bacteria 742
309 Ga0501041_0380127 3300049577 Bacteria 894
310 Ga0501043_0088604 3300049579 Bacteria 2432
311 Ga0501046_0433934 3300049580 Bacteria 946
312 Ga0501047_0177192 3300049581 Bacteria 1999
313 Ga0501067_0120175 3300049583 Bacteria 1462
314 Ga0501070_0644508 3300049586 Bacteria 842
315 Ga0501072_0203209 3300049588 Bacteria 1580
316 Ga0501077_0125641 3300049593 Bacteria 1626
317 Ga0501035_1103977 3300049822 Bacteria 619
318 Ga0501044_0028616 3300049823 Bacteria 5881
319 nmdc:mga05p37_2177344_c1 3300050507 Bacteria 516
320 nmdc:mga05p37_306641_c1 3300050507 Bacteria 1884
321 nmdc:mga09592_140708_c1 3300050508 Bacteria 2080
322 nmdc:mga09592_36861_c1 3300050508 Bacteria 4098
323 nmdc:mga0qj67_121658_c1 3300050509 Bacteria 2112
324 nmdc:mga06r32_306892_c1 3300050510 Bacteria 1572
325 nmdc:mga06r32_337188_c1 3300050510 Bacteria 1493
326 nmdc:mga06r32_847080_c1 3300050510 Bacteria 873
327 nmdc:mga08y16_13214_c1 3300050511 Bacteria 8684
328 nmdc:mga08y16_344449_c1 3300050511 Bacteria 1532
329 nmdc:mga0a205_680225_c1 3300050515 Bacteria 879
330 Ga0495601_0018356 3300053077 Bacteria 4256
331 Ga0495612_0255123 3300053078 Bacteria 781
332 Ga0495619_0011645 3300053085 Bacteria 5540
333 Ga0500645_000007 3300053730 Bacteria 233700
334 Ga0501084_0122675 3300054114 Bacteria 2185
335 2515723004 2515154129 Bacteria 5584369
336 2516083150 2515154202 Bacteria 5471270
337 2738705809 2738541274 Bacteria 6909446
338 2739330299 2738543028 Bacteria 6917070
339 2819693288 2818991463 Bacteria 7948711
340 2862292869 2862290372 Bacteria 7471434
341 3006394650 3006393351 Bacteria 6615579
342 3006427017 3006425503 Bacteria 6491253
343 JGI25407J50210_10017153
344 JGI25406J46586_10029172
345 JGI25406J46586_10068797
346 JGI25407J50210_10016384
347 JGI25407J50210_10021923
348 JGI25407J50210_10068303
349 JGI25407J50210_10180701
350 Ga0065704_10072773
351 Ga0070676_10011530
352 Ga0070683_100089559
353 Ga0070670_100108318
354 Ga0070670_100869790
355 Ga0068869_100019245
356 Ga0068868_100006079
357 Ga0070660_100096666
358 Ga0070661_100060791
359 Ga0070692_10043772
360 Ga0070668_100086416
361 Ga0070669_100457068
362 Ga0070675_100001985
363 Ga0070688_100802797
364 Ga0070667_100264077
365 Ga0070667_101033633
366 Ga0070709_10200742
367 Ga0070714_101184618
368 Ga0070701_10973513
369 Ga0070701_11142529
370 Ga0070700_100009287
371 Ga0070663_100031277
372 Ga0070678_100178911
373 Ga0070662_100035134
374 Ga0070698_100753295
375 Ga0070684_100013714
376 Ga0070672_100088458
377 Ga0070693_100110917
378 Ga0070704_101141122
379 Ga0070664_100003931
380 Ga0068857_100014729
381 Ga0068854_100036481
382 Ga0068856_100221780
383 Ga0070702_100127567
384 Ga0068852_100048464
385 Ga0068864_100332782
386 Ga0068861_100045422
387 Ga0068861_100215305
388 Ga0068861_101759637
389 Ga0068870_10086691
390 Ga0068858_101014942
391 Ga0068860_100119860
392 Ga0068862_100030324
393 Ga0081538_10001699
394 Ga0081538_10002638
395 Ga0081538_10019862
396 Ga0081538_10041385
397 Ga0081538_10046122
398 Ga0081538_10056381
399 Ga0081539_10000445
400 Ga0081539_10001508
401 Ga0081539_10002895
402 Ga0075432_10105545
403 Ga0068871_100668837
404 Ga0075428_100297480
405 Ga0075428_100547144
406 Ga0075430_100135342
407 Ga0075431_100080796
408 Ga0075431_100109370
409 Ga0075431_100697202
410 Ga0075429_100015378
411 Ga0075429_100035467
412 Ga0068865_100236943
413 Ga0111539_10000214
414 Ga0111539_10017067
415 Ga0105245_10026549
416 Ga0114129_10049044
417 Ga0114129_10053866
418 Ga0114129_12181099
419 Ga0105241_10266149
420 Ga0105249_10074288
421 Ga0105028_107307
422 Ga0105239_10269089
423 Ga0105246_10110527
424 Ga0157371_10336574
425 Ga0157370_10172967
426 Ga0157374_10383248
427 Ga0163162_10105684
428 Ga0163162_10547121
429 Ga0157372_11173439
430 Ga0163163_12082160
431 Ga0157380_10065591
432 Ga0157377_10019623
433 Ga0163161_10562673
434 Ga0207688_10246370
435 Ga0207699_11230614
436 Ga0207645_10015382
437 Ga0207643_10063253
438 Ga0207657_10113989
439 Ga0207649_10011099
440 Ga0207646_10478744
441 Ga0207681_10345165
442 Ga0207650_10045037
443 Ga0207659_10002212
444 Ga0207687_10445574
445 Ga0207687_11179808
446 Ga0207706_10030298
447 Ga0207704_10375722
448 Ga0207691_10106915
449 Ga0207689_10017699
450 Ga0207661_10003978
451 Ga0207679_10027421
452 Ga0207668_10378606
453 Ga0207658_10439508
454 Ga0207677_10003114
455 Ga0207678_10175947
456 Ga0207708_10004314
457 Ga0207702_10189545
458 Ga0207676_10060136
459 Ga0207674_10003908
460 Ga0207675_100018524
461 Ga0207675_101254059
462 Ga0207683_10350921
463 Ga0207698_10200166
464 Ga0207428_10022996
465 Ga0207428_10784278
466 Ga0268265_10022487
467 Ga0307513_10037406
468 Ga0307509_10155374
469 Ga0307408_100028468
470 Ga0307408_100170918
471 Ga0307408_102437283
472 Ga0307405_10028321
473 Ga0307405_10163790
474 Ga0307405_10336872
475 Ga0307405_10932482
476 Ga0307405_11423651
477 Ga0307405_11746942
478 Ga0307413_10033625
479 Ga0307413_10042326
480 Ga0307413_12160643
481 Ga0307410_10021593
482 Ga0307410_10066062
483 Ga0307410_10071847
484 Ga0307410_10210358
485 Ga0307406_10001367
486 Ga0307406_10011374
487 Ga0307406_10016848
488 Ga0307406_10024847
489 Ga0307406_10428173
490 Ga0307406_10629156
491 Ga0307406_11309580
492 Ga0307407_10007938
493 Ga0307407_10031687
494 Ga0307407_10044883
495 Ga0307407_11600402
496 Ga0307412_10010371
497 Ga0307412_10138659
498 Ga0307412_10237064
499 Ga0307412_11936816
500 Ga0307409_100004114
501 Ga0307409_100012536
502 Ga0307409_100168834
503 Ga0307409_100224092
504 Ga0307409_100384043
505 Ga0307409_100765327
506 Ga0307409_101399659
507 Ga0307416_100000862
508 Ga0307416_100074835
509 Ga0307416_100082578
510 Ga0307416_100207934
511 Ga0307416_100516246
512 Ga0307416_100519215
513 Ga0307416_102881058
514 Ga0307416_103143277
515 Ga0307414_10014794
516 Ga0307414_10091312
517 Ga0307414_10248825
518 Ga0307411_10015594
519 Ga0307411_10050040
520 Ga0307411_10668135
521 Ga0307415_100005437
522 Ga0307415_100062565
523 Ga0307415_100067184
524 Ga0307415_100079460
525 Ga0307415_100280924
526 Ga0307415_100556635
527 Ga0307415_100564620
528 Ga0307415_101743944
529 Ga0307510_10277799
530 Ga0373926_0057647
531 Ga0373944_0034844
532 Ga0373951_0000003
533 Ga0373945_0024008
534 Ga0373946_0081435
535 Ga0373955_0040904
536 Ga0373935_0024553
537 Ga0373927_0091257
538 Ga0373927_0976349
539 Ga0373933_0077922
540 Ga0373947_0965137
541 Ga0373937_1628479
542 Ga0373925_0023140
543 Ga0395905_0324793
544 Ga0395905_0430684
545 Ga0436364_1130457
546 Ga0395901_1333786
547 Ga0395901_1615194
548 Ga0237819_00469
549 Ga0237816_02679
550 Ga0439466_0195258
551 Ga0451793_0529869
552 Ga0451800_0768973
553 Ga0451847_0723301
554 Ga0439443_001391
555 Ga0439448_0003685
556 Ga0439450_005308
557 Ga0439450_135558
558 Ga0439455_0001221
559 Ga0439463_001269
560 Ga0450914_000325
561 Ga0450904_002568
562 Ga0450905_007435
563 Ga0439458_0068559
564 Ga0439435_0047659
565 Ga0439444_0000048
566 Ga0439459_0141402
567 Ga0439464_0000328
568 Ga0439464_0068809
569 Ga0439464_0071632
570 Ga0439460_0000986
571 Ga0439460_0043916
572 Ga0439460_0268241
573 Ga0451577_0018784
574 Ga0439440_0000139
575 Ga0453683_0825972
576 Ga0466965_0036387
577 Ga0466965_0213240
578 Ga0466966_0667632
579 Ga0466961_0728703
580 Ga0453684_0344571
581 Ga0466971_0346086
582 Ga0466970_0035284
583 Ga0466960_0127943
584 Ga0466960_0452041
585 Ga0466959_0539066
586 Ga0466959_0719421
587 Ga0451576_0211208
588 Ga0495592_0600386
589 Ga0495603_0041426
590 Ga0495629_0003711
591 Ga0495641_0080962
592 Ga0495651_0091643
593 Ga0495653_0010942
594 Ga0495580_0007571
595 Ga0495605_0133123
596 Ga0495639_0175207
597 Ga0495662_0005895
598 Ga0495664_0184217
599 Ga0495584_0059688
600 Ga0495594_0160443
601 Ga0495594_0643558
602 Ga0495596_0104916
603 Ga0495607_0129361
604 Ga0495608_0287132
605 Ga0495618_0013030
606 Ga0495628_0162048
607 Ga0495630_0082314
608 Ga0495631_0093019
609 Ga0495644_0096688
610 Ga0495663_0042832
611 Ga0495666_0010736
612 Ga0495652_0102146
613 Ga0495665_0007641
614 Ga0495586_0373494
615 Ga0495621_0058530
616 Ga0495656_0426212
617 Ga0495634_0006694
618 Ga0495635_0078596
619 Ga0495588_0137843
620 Ga0495657_0065669
621 Ga0495599_0075811
622 Ga0495647_0009456
623 Ga0495658_0013854
624 Ga0495613_0011742
625 Ga0495670_0309434
626 Ga0495670_0584665
627 Ga0495649_0472829
628 Ga0495600_0100136
629 Ga0495581_0001784
630 Ga0495604_0340947
631 Ga0495674_0007008
632 Ga0495676_0125304
633 Ga0495676_0520009
634 Ga0495680_0007274
635 Ga0495677_0123062
636 Ga0495684_0029667
637 Ga0495593_0037414
638 Ga0495614_0012406
639 Ga0496102_1513168
640 Ga0496102_1966742
641 Ga0496109_1313969
642 Ga0496110_1220477
643 Ga0496113_0524662
644 Ga0501031_0188048
645 Ga0501031_0199459
646 Ga0501032_0250664
647 Ga0501036_0200098
648 Ga0501037_0230445
649 Ga0501038_0176951
650 Ga0501039_0787444
651 Ga0501041_0380127
652 Ga0501043_0088604
653 Ga0501046_0433934
654 Ga0501047_0177192
655 Ga0501067_0120175
656 Ga0501070_0644508
657 Ga0501072_0203209
658 Ga0501077_0125641
659 Ga0501035_1103977
660 Ga0501044_0028616
661 nmdc:mga05p37_2177344_c1
662 nmdc:mga05p37_306641_c1
663 nmdc:mga09592_140708_c1
664 nmdc:mga09592_36861_c1
665 nmdc:mga0qj67_121658_c1
666 nmdc:mga06r32_306892_c1
667 nmdc:mga06r32_337188_c1
668 nmdc:mga06r32_847080_c1
669 nmdc:mga08y16_13214_c1
670 nmdc:mga08y16_344449_c1
671 nmdc:mga0a205_680225_c1
672 Ga0495601_0018356
673 Ga0495612_0255123
674 Ga0495619_0011645
675 Ga0500645_000007
676 Ga0501084_0122675
677 2515723004
678 2516083150
679 2738705809
680 2739330299
681 2819693288
682 2862292869
683 3006394650
684 3006427017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

133

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9907 1 127
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.983 1 127
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8896 1 126
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8647 1 126
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8597 1 125
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9921 2 127 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9688 2 127 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9364 79 124 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8844 78 127 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8768 76 126 3.30.720.110
ID Description Score Start End GO Terms
AF-V6JSP7-F1-model_v4 deleted 0.9983 1 127
AF-A0A2S8BSB0-F1-model_v4 VOC domain-containing protein 0.9981 1 126
AF-A0A445NH35-F1-model_v4 deleted 0.998 1 126
AF-A0A5E9G346-F1-model_v4 Catechol 2,3-dioxygenase 0.9978 1 125 GO:0051213
AF-A0A3D9ZSM2-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9975 1 126 GO:0016829
GO:0051213

Map