F414825

General Info

Members Datasets Scaffolds Average Seq Length
341 242 319 188

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_020331|Ga0400483_020331_183_845
Length 220
Sequence LCEAWEGYLDDAQICPNRGYVMRCFDFIVSFVLLVILSPLMIIVGVLILFSIGWPIIFKQQRPGLLGKPFTLYKFRTMKNEFSSSGDLLPDSARLTKVGRLLRSTSLDELPELFNVFVGDMSLVGPRPLLVEYLPLYTPEQARRHEVRPGITGWAQVNGRNAVSWEDRFKMDVWYVDNRSFVLDIKILWMTILSVMRREGISQKGHATMPKFRGGVEDKS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
6 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
7 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221583 Caulobacter sp. Root655 Isolate Unclassified
10 2643221584 Caulobacter sp. Root656 Isolate Unclassified
11 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
12 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
13 2818991435 Caulobacter henricii 536 Isolate Unclassified
14 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
15 2818991459 Paenibacillus sp. 597 Isolate Unclassified
16 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
17 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
18 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
19 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
20 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
21 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
22 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
27 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
28 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
40 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
165 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
237 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
240 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 0
Isolates 6.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.65
Nodule 0
Rhizoplane 2.05
Rhizosphere 70.09
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 JGI24739J22299_10017820 3300001989 Bacteria 2558
3 JGI25162J39368_1000204 3300002737 Bacteria 62620
4 JGI25164J39214_1000944 3300002772 Bacteria 9402
5 JGI25150J39212_1000227 3300002774 Bacteria 30769
6 JGI25159J45721_1009324 3300002987 Bacteria 2598
7 JGI25151J46595_10000841 3300003187 Bacteria 24478
8 JGI25165J46597_1000753 3300003214 Bacteria 24891
9 JGI25153J46596_10000594 3300003215 Bacteria 22122
10 JGI25153J46596_10020355 3300003215 Bacteria 2511
11 JGI25153J46596_10038639 3300003215 Bacteria 1501
12 rootH2_10029156 3300003320 Bacteria 5157
13 rootL2_10212091 3300003322 Bacteria 3852
14 rootH1_10213629 3300003323 Bacteria 5548
15 rootH1_10280008 3300003323 Bacteria 1818
16 JGI25160J50197_1015235 3300003354 Bacteria 2532
17 Ga0055526_1017842 3300003771 Bacteria 2685
18 Ga0055537_1002827 3300003773 Bacteria 5571
19 Ga0055536_1000022 3300003781 Bacteria 198244
20 Ga0055528_1010501 3300003790 Bacteria 3758
21 Ga0055531_10002153 3300003794 Bacteria 13458
22 Ga0065165_1001826 3300005262 Bacteria 20836
23 Ga0065165_1032293 3300005262 Bacteria 1643
24 Ga0065704_10070140 3300005289 Bacteria 482257
25 Ga0065715_10006394 3300005293 Unclassified 4572
26 Ga0070658_10035058 3300005327 Bacteria 4040
27 Ga0070676_10659761 3300005328 Bacteria 760
28 Ga0070683_100005059 3300005329 Bacteria 10948
29 Ga0070670_100028018 3300005331 Bacteria 4848
30 Ga0070666_10316832 3300005335 Bacteria 1112
31 Ga0070680_100061380 3300005336 Bacteria 3077
32 Ga0070680_100320630 3300005336 Bacteria 1315
33 Ga0070668_100002052 3300005347 Bacteria 14736
34 Ga0070668_100002234 3300005347 Bacteria 14237
35 Ga0070668_100013263 3300005347 Bacteria 6149
36 Ga0070669_100047907 3300005353 Bacteria 3119
37 Ga0070674_100598041 3300005356 Bacteria 932
38 Ga0070667_100004855 3300005367 Bacteria 11262
39 Ga0070708_100053451 3300005445 Bacteria 3583
40 Ga0070708_100106311 3300005445 Bacteria 2576
41 Ga0070663_100263360 3300005455 Bacteria 1368
42 Ga0070681_10111408 3300005458 Bacteria 2676
43 Ga0070681_10122825 3300005458 Bacteria 2529
44 Ga0070707_100042065 3300005468 Bacteria 4374
45 Ga0070707_100196984 3300005468 Bacteria 1964
46 Ga0070698_100132461 3300005471 Unclassified 2448
47 Ga0070699_101248762 3300005518 Bacteria 681
48 Ga0070679_100029621 3300005530 Bacteria 5400
49 Ga0070679_100107434 3300005530 Bacteria 2776
50 Ga0070679_100201244 3300005530 Bacteria 1958
51 Ga0070684_100007337 3300005535 Bacteria 8571
52 Ga0070697_100148653 3300005536 Bacteria 1974
53 Ga0070665_100000329 3300005548 Bacteria 73128
54 Ga0070665_100051213 3300005548 Bacteria 4141
55 Ga0068859_100006984 3300005617 Bacteria 11464
56 Ga0068859_100104662 3300005617 Bacteria 2889
57 Ga0068863_100056943 3300005841 Bacteria 3700
58 Ga0068860_100003039 3300005843 Bacteria 17319
59 Ga0068860_100003109 3300005843 Bacteria 17159
60 Ga0068860_100170798 3300005843 Bacteria 2100
61 Ga0068860_100542775 3300005843 Bacteria 1164
62 Ga0068862_100006717 3300005844 Bacteria 9543
63 Ga0068862_100022986 3300005844 Bacteria 5221
64 Ga0068862_100026527 3300005844 Bacteria 4870
65 Ga0075366_10242009 3300006195 Bacteria 1100
66 Ga0075370_10073720 3300006353 Bacteria 1955
67 Ga0075370_10678763 3300006353 Bacteria 626
68 Ga0068871_100146116 3300006358 Bacteria 2013
69 Ga0075428_100004130 3300006844 Bacteria 15986
70 Ga0075430_100084314 3300006846 Bacteria 2661
71 Ga0075431_100004231 3300006847 Bacteria 14063
72 Ga0075429_100072324 3300006880 Bacteria 3003
73 Ga0068865_100046065 3300006881 Bacteria 2991
74 Ga0068865_100161780 3300006881 Bacteria 1708
75 Ga0075436_100257178 3300006914 Bacteria 1245
76 Ga0097620_100006984 3300006931 Bacteria 11464
77 Ga0097620_100104664 3300006931 Bacteria 2889
78 Ga0105250_10001805 3300009092 Bacteria 11211
79 Ga0105240_10000047 3300009093 Bacteria 239067
80 Ga0105240_10047943 3300009093 Bacteria 5403
81 Ga0105245_10061796 3300009098 Bacteria 3378
82 Ga0114129_10027319 3300009147 Bacteria 8081
83 Ga0105243_10022017 3300009148 Bacteria 4841
84 Ga0105242_10153381 3300009176 Bacteria 2010
85 Ga0105248_10013708 3300009177 Bacteria 8924
86 Ga0105248_10050732 3300009177 Bacteria 4654
87 Ga0105248_10082011 3300009177 Bacteria 3626
88 Ga0105248_10139698 3300009177 Bacteria 2733
89 Ga0105248_10254030 3300009177 Bacteria 1978
90 Ga0105249_10158002 3300009553 Bacteria 2188
91 Ga0105249_11001840 3300009553 Bacteria 904
92 Ga0105239_10001231 3300010375 Bacteria 34884
93 Ga0105246_10363990 3300011119 Bacteria 1189
94 Ga0157370_10000468 3300013104 Bacteria 50304
95 Ga0157370_10776684 3300013104 Unclassified 872
96 Ga0157374_10158348 3300013296 Bacteria 2205
97 Ga0163162_10031232 3300013306 Bacteria 5283
98 Ga0163162_11523152 3300013306 Bacteria 762
99 Ga0157372_10014290 3300013307 Bacteria 8488
100 Ga0157375_10748960 3300013308 Bacteria 1128
101 Ga0157376_10213140 3300014969 Bacteria 1784
102 Ga0163161_11029661 3300017792 Bacteria 704
103 Ga0213876_10052676 3300021384 Bacteria 2151
104 Ga0228598_1015070 3300024227 Bacteria 1527
105 Ga0207427_100223 3300025231 Bacteria 48426
106 Ga0209437_100164 3300025233 Bacteria 145317
107 Ga0209258_100228 3300025242 Bacteria 105712
108 Ga0207425_1000001 3300025245 Bacteria 2525432
109 Ga0209148_1000204 3300025254 Bacteria 105778
110 Ga0209129_1000001 3300025258 Bacteria 1452436
111 Ga0209233_1000242 3300025261 Bacteria 90301
112 Ga0209565_1002418 3300025263 Bacteria 6758
113 Ga0209673_1006699 3300025273 Bacteria 5497
114 Ga0209673_1095366 3300025273 Bacteria 650
115 Ga0209130_1003717 3300025284 Bacteria 6259
116 Ga0209130_1007043 3300025284 Bacteria 3537
117 Ga0209675_1013842 3300025291 Bacteria 2493
118 Ga0209676_1000012 3300025292 Bacteria 841431
119 Ga0209025_1000124 3300025294 Bacteria 201973
120 Ga0209025_1006901 3300025294 Bacteria 8654
121 Ga0209564_1002918 3300025295 Bacteria 12435
122 Ga0209564_1005360 3300025295 Bacteria 7355
123 Ga0209564_1029716 3300025295 Bacteria 1712
124 Ga0209758_1000055 3300025297 Bacteria 336183
125 Ga0209758_1004891 3300025297 Bacteria 10775
126 Ga0209758_1006097 3300025297 Bacteria 8853
127 Ga0209758_1006294 3300025297 Bacteria 8622
128 Ga0209050_1022021 3300025298 Bacteria 2299
129 Ga0209256_1003271 3300025299 Bacteria 11599
130 Ga0209256_1007124 3300025299 Bacteria 5636
131 Ga0207426_1000193 3300025302 Bacteria 151669
132 Ga0207426_1043635 3300025302 Bacteria 1376
133 Ga0207426_1045557 3300025302 Bacteria 1333
134 Ga0209257_1002549 3300025304 Bacteria 17822
135 Ga0207645_10117988 3300025907 Bacteria 1721
136 Ga0207705_10002665 3300025909 Bacteria 13678
137 Ga0207705_10027110 3300025909 Bacteria 4084
138 Ga0207707_10077016 3300025912 Bacteria 2911
139 Ga0207695_10000010 3300025913 Bacteria 981919
140 Ga0207652_10021966 3300025921 Bacteria 5272
141 Ga0207646_10091811 3300025922 Bacteria 2717
142 Ga0207650_10088868 3300025925 Bacteria 2357
143 Ga0207687_10152296 3300025927 Bacteria 1766
144 Ga0207700_10003145 3300025928 Bacteria 9525
145 Ga0207690_10026466 3300025932 Bacteria 3652
146 Ga0207686_10003807 3300025934 Bacteria 8092
147 Ga0207709_10052451 3300025935 Bacteria 2505
148 Ga0207711_10034005 3300025941 Bacteria 4316
149 Ga0207711_10127877 3300025941 Bacteria 2275
150 Ga0207711_10508309 3300025941 Bacteria 1123
151 Ga0207711_10550778 3300025941 Bacteria 1076
152 Ga0207661_10014648 3300025944 Bacteria 5751
153 Ga0207667_10021224 3300025949 Bacteria 7199
154 Ga0207668_10000053 3300025972 Bacteria 97131
155 Ga0207668_10001269 3300025972 Bacteria 15059
156 Ga0207668_10055091 3300025972 Bacteria 2762
157 Ga0207658_10131316 3300025986 Bacteria 2012
158 Ga0207658_10714568 3300025986 Bacteria 906
159 Ga0207641_10032804 3300026088 Bacteria 4313
160 Ga0207648_10019886 3300026089 Bacteria 6060
161 Ga0207676_10176904 3300026095 Bacteria 1865
162 Ga0207674_10460790 3300026116 Bacteria 1229
163 Ga0207683_10119310 3300026121 Bacteria 2367
164 Ga0209974_10010570 3300027876 Bacteria 3114
165 Ga0268266_10000306 3300028379 Bacteria 77988
166 Ga0268266_10094849 3300028379 Bacteria 2620
167 Ga0268265_10054163 3300028380 Bacteria 3042
168 Ga0268265_10187925 3300028380 Bacteria 1781
169 Ga0268264_10000021 3300028381 Bacteria 481580
170 Ga0268264_10067731 3300028381 Bacteria 3014
171 Ga0268264_10196354 3300028381 Bacteria 1843
172 Ga0268264_10200123 3300028381 Bacteria 1827
173 Ga0265323_10028166 3300028653 Bacteria 2108
174 Ga0307515_10182391 3300028794 Bacteria 2043
175 Ga0265338_10754282 3300028800 Bacteria 669
176 Ga0265324_10040094 3300029957 Bacteria 1623
177 Ga0265340_10198664 3300031247 Bacteria 902
178 Ga0265339_10166445 3300031249 Bacteria 1106
179 Ga0265327_10000006 3300031251 Bacteria 693716
180 Ga0265316_10000157 3300031344 Bacteria 75589
181 Ga0265316_10015251 3300031344 Bacteria 6727
182 Ga0307513_10374229 3300031456 Bacteria 1166
183 Ga0307508_10287355 3300031616 Bacteria 1238
184 Ga0265314_10005804 3300031711 Bacteria 11062
185 Ga0316576_10091668 3300031727 Bacteria 2265
186 Ga0307413_10160327 3300031824 Bacteria 1579
187 Ga0307410_10016052 3300031852 Bacteria 4455
188 Ga0307414_10010769 3300032004 Bacteria 5330
189 Ga0307414_10021306 3300032004 Bacteria 4063
190 Ga0307414_10102314 3300032004 Bacteria 2159
191 Ga0307414_10640650 3300032004 Bacteria 957
192 Ga0307510_10003275 3300033180 Bacteria 18847
193 Ga0373943_0464496 3300035170 Bacteria 737
194 Ga0316582_0152675 3300036647 Bacteria 1562
195 Ga0316584_0325442 3300036712 Bacteria 1108
196 Ga0395900_0003049 3300037418 Bacteria 18243
197 Ga0395900_0010294 3300037418 Bacteria 9568
198 Ga0395900_0125175 3300037418 Bacteria 2636
199 Ga0395898_0004370 3300037466 Bacteria 15465
200 Ga0395898_0072031 3300037466 Bacteria 3339
201 Ga0395898_0452067 3300037466 Bacteria 1223
202 Ga0395905_0000209 3300037471 Bacteria 90777
203 Ga0395905_0739977 3300037471 Bacteria 886
204 Ga0395901_0151589 3300038443 Bacteria 2436
205 Ga0395901_1034311 3300038443 Bacteria 795
206 Ga0400490_41598 3300038726 Bacteria 49031
207 Ga0400483_020331 3300039062 Bacteria 1298
208 Ga0400483_186460 3300039062 Unclassified 2381
209 Ga0400483_189449 3300039062 Bacteria 1162
210 Ga0436365_1697098 3300039437 Bacteria 2628
211 Ga0436362_1256968 3300039453 Bacteria 5931
212 Ga0451791_1482317 3300041451 Bacteria 757
213 Ga0439445_0019971 3300042004 Bacteria 1674
214 Ga0439446_0027383 3300042156 Bacteria 1636
215 Ga0439435_0049472 3300042436 Bacteria 1199
216 Ga0453684_0266761 3300044712 Bacteria 1959
217 Ga0453684_1452549 3300044712 Unclassified 709
218 Ga0466967_0261172 3300045976 Bacteria 1657
219 Ga0495627_000185 3300046453 Bacteria 69533
220 Ga0495638_0005199 3300046460 Bacteria 9728
221 Ga0495638_0006989 3300046460 Bacteria 8148
222 Ga0495638_0009139 3300046460 Bacteria 6972
223 Ga0495638_0035489 3300046460 Bacteria 3178
224 Ga0495638_0258200 3300046460 Bacteria 957
225 Ga0495650_0000269 3300046471 Bacteria 99675
226 Ga0495650_0101024 3300046471 Bacteria 1083
227 Ga0495584_0005663 3300046491 Bacteria 6604
228 Ga0495585_0248743 3300046492 Bacteria 888
229 Ga0495596_0005723 3300046500 Bacteria 5834
230 Ga0495607_0055159 3300046501 Bacteria 2287
231 Ga0495583_0000029 3300046506 Bacteria 255536
232 Ga0495583_0024256 3300046506 Bacteria 3051
233 Ga0495606_0001706 3300046507 Bacteria 28356
234 Ga0495610_0001701 3300046512 Bacteria 19307
235 Ga0495610_0006512 3300046512 Bacteria 8011
236 Ga0495616_0001503 3300046513 Bacteria 16105
237 Ga0495616_0015077 3300046513 Bacteria 4302
238 Ga0495616_0062463 3300046513 Bacteria 1824
239 Ga0495618_0386500 3300046514 Bacteria 858
240 Ga0495620_0038995 3300046515 Bacteria 2104
241 Ga0495631_0004736 3300046518 Bacteria 7189
242 Ga0495631_0233342 3300046518 Bacteria 785
243 Ga0495632_0073552 3300046519 Bacteria 1638
244 Ga0495632_0199931 3300046519 Bacteria 910
245 Ga0495637_0004369 3300046520 Bacteria 7338
246 Ga0495637_0028740 3300046520 Bacteria 2480
247 Ga0495637_0045799 3300046520 Bacteria 1853
248 Ga0495637_0190127 3300046520 Bacteria 758
249 Ga0495643_0049488 3300046522 Bacteria 2267
250 Ga0495648_0124377 3300046524 Bacteria 1380
251 Ga0495642_0045444 3300046528 Bacteria 1795
252 Ga0495654_0000153 3300046530 Bacteria 70297
253 Ga0495654_0007015 3300046530 Bacteria 6343
254 Ga0495609_0167107 3300046538 Bacteria 930
255 Ga0495597_0000878 3300046542 Bacteria 23387
256 Ga0495668_0001655 3300046616 Bacteria 20778
257 Ga0495668_0002273 3300046616 Bacteria 16147
258 Ga0495625_0001311 3300046660 Bacteria 31043
259 Ga0495625_0006609 3300046660 Bacteria 10293
260 Ga0495625_0009188 3300046660 Bacteria 8302
261 Ga0495625_0024051 3300046660 Bacteria 4643
262 Ga0495625_0045368 3300046660 Bacteria 3177
263 Ga0495625_0162291 3300046660 Bacteria 1496
264 Ga0495661_0004239 3300046665 Bacteria 10422
265 Ga0495661_0009239 3300046665 Bacteria 6775
266 Ga0495661_0162411 3300046665 Bacteria 1198
267 Ga0495623_0164112 3300046679 Unclassified 1303
268 Ga0495671_0028645 3300046692 Bacteria 2866
269 Ga0495660_0002391 3300046810 Bacteria 11979
270 Ga0495660_0052389 3300046810 Bacteria 2217
271 Ga0495672_0009976 3300047320 Bacteria 6813
272 Ga0495679_005078 3300047446 Bacteria 5909
273 Ga0495673_0000056 3300047469 Bacteria 245918
274 Ga0495673_0004042 3300047469 Bacteria 9348
275 Ga0495681_0013972 3300047470 Bacteria 4630
276 Ga0495681_0019645 3300047470 Bacteria 3683
277 Ga0495684_0728036 3300047471 Bacteria 655
278 Ga0495686_0001702 3300047472 Bacteria 22722
279 Ga0495686_0015793 3300047472 Bacteria 5139
280 Ga0495686_0025987 3300047472 Bacteria 3833
281 Ga0495686_0102182 3300047472 Bacteria 1727
282 Ga0496104_0181181 3300048907 Bacteria 2017
283 Ga0496107_0000095 3300048910 Bacteria 42594
284 Ga0496108_0519399 3300048911 Bacteria 1040
285 Ga0496110_0000262 3300048913 Bacteria 34117
286 Ga0496115_0001653 3300048918 Bacteria 16036
287 Ga0496117_0047437 3300048920 Bacteria 3080
288 Ga0496120_0282224 3300048923 Bacteria 767
289 Ga0496121_0001883 3300048924 Bacteria 33669
290 Ga0496126_0165589 3300048929 Bacteria 1887
291 Ga0496126_0576152 3300048929 Bacteria 890
292 Ga0501031_0216158 3300049568 Bacteria 1249
293 Ga0501039_0078223 3300049575 Bacteria 2573
294 Ga0501075_0026223 3300049591 Bacteria 4288
295 Ga0501257_054872 3300049686 Bacteria 999
296 Ga0501080_1374339 3300049742 Bacteria 603
297 Ga0501045_0585935 3300049824 Bacteria 826
298 nmdc:mga07m45_283411_c1 3300050496 Bacteria 964
299 nmdc:mga0qj67_21411_c1 3300050509 Bacteria 4960
300 nmdc:mga06r32_54414_c1 3300050510 Bacteria 3838
301 Ga0495595_0100267 3300053084 Bacteria 1397
302 Ga0500578_0000554 3300053086 Bacteria 45443
303 Ga0500578_0206578 3300053086 Bacteria 1200
304 Ga0500583_0004349 3300053092 Bacteria 4605
305 Ga0500556_0001848 3300053104 Bacteria 7656
306 Ga0500595_000823 3300053119 Bacteria 17861
307 Ga0500618_001099 3300053125 Bacteria 13291
308 Ga0500658_0003339 3300053134 Bacteria 6082
309 Ga0500559_0000145 3300053136 Bacteria 55410
310 Ga0500559_0005027 3300053136 Bacteria 6138
311 Ga0500577_0056472 3300053142 Bacteria 1494
312 Ga0500616_0042791 3300053153 Bacteria 2424
313 Ga0500627_0072539 3300053158 Bacteria 1526
314 Ga0500611_029013 3300053727 Bacteria 1128
315 Ga0500645_003370 3300053730 Bacteria 6536
316 Ga0500645_093729 3300053730 Bacteria 850
317 Ga0500609_000802 3300053731 Bacteria 4721
318 Ga0590075_006226 3300059424 Bacteria 2830
319 Ga0590077_088713 3300059426 Bacteria 716

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003215 JGI25153J46596_10038639 JGI25153J46596_100386392 162
2 3300003771 Ga0055526_1017842 Ga0055526_10178422 162
3 3300003773 Ga0055537_1002827 Ga0055537_10028273 162
4 3300003790 Ga0055528_1010501 Ga0055528_10105013 162
5 3300005262 Ga0065165_1001826 Ga0065165_10018267 162
6 3300006353 Ga0075370_10678763 Ga0075370_106787631 162
7 3300025263 Ga0209565_1002418 Ga0209565_10024185 162
8 3300025273 Ga0209673_1006699 Ga0209673_10066992 162
9 3300025273 Ga0209673_1095366 Ga0209673_10953661 162
10 3300025291 Ga0209675_1013842 Ga0209675_10138422 162
11 3300025295 Ga0209564_1005360 Ga0209564_10053605 162
12 3300025295 Ga0209564_1029716 Ga0209564_10297162 162
13 3300025297 Ga0209758_1004891 Ga0209758_10048914 162
14 3300025297 Ga0209758_1006097 Ga0209758_10060975 162
15 3300025299 Ga0209256_1007124 Ga0209256_10071242 162
16 3300042436 Ga0439435_0049472 Ga0439435_0049472_111_671 162
17 3300046460 Ga0495638_0005199 Ga0495638_0005199_5095_5655 162
18 3300046460 Ga0495638_0006989 Ga0495638_0006989_1311_1871 162
19 3300046471 Ga0495650_0000269 Ga0495650_0000269_94588_95148 162
20 3300046471 Ga0495650_0101024 Ga0495650_0101024_22_582 162
21 3300046492 Ga0495585_0248743 Ga0495585_0248743_167_727 162
22 3300046507 Ga0495606_0001706 Ga0495606_0001706_2911_3471 162
23 3300046512 Ga0495610_0001701 Ga0495610_0001701_5008_5568 162
24 3300046513 Ga0495616_0001503 Ga0495616_0001503_4809_5369 162
25 3300046513 Ga0495616_0062463 Ga0495616_0062463_708_1268 162
26 3300046518 Ga0495631_0233342 Ga0495631_0233342_15_575 162
27 3300046519 Ga0495632_0073552 Ga0495632_0073552_589_1149 162
28 3300046519 Ga0495632_0199931 Ga0495632_0199931_322_882 162
29 3300046520 Ga0495637_0190127 Ga0495637_0190127_74_634 162
30 3300046522 Ga0495643_0049488 Ga0495643_0049488_558_1118 162
31 3300046530 Ga0495654_0000153 Ga0495654_0000153_64984_65544 162
32 3300046660 Ga0495625_0009188 Ga0495625_0009188_6366_6926 162
33 3300046660 Ga0495625_0024051 Ga0495625_0024051_1451_2011 162
34 3300046660 Ga0495625_0045368 Ga0495625_0045368_1510_2070 162
35 3300047320 Ga0495672_0009976 Ga0495672_0009976_6198_6758 162
36 3300047472 Ga0495686_0015793 Ga0495686_0015793_2950_3510 162
37 3300048929 Ga0496126_0576152 Ga0496126_0576152_145_705 162
38 3300053086 Ga0500578_0206578 Ga0500578_0206578_229_789 162
39 3300053104 Ga0500556_0001848 Ga0500556_0001848_5571_6131 162
40 3300053134 Ga0500658_0003339 Ga0500658_0003339_597_1157 162
41 3300053153 Ga0500616_0042791 Ga0500616_0042791_482_1042 162
42 3300053158 Ga0500627_0072539 Ga0500627_0072539_596_1156 162
43 3300053730 Ga0500645_003370 Ga0500645_003370_1460_2020 162
44 3300053730 Ga0500645_093729 Ga0500645_093729_136_696 162
45 3300046660 Ga0495625_0006609 Ga0495625_0006609_4333_4893 163
46 3300048918 Ga0496115_0001653 Ga0496115_0001653_8661_9221 163
47 3300048923 Ga0496120_0282224 Ga0496120_0282224_54_554 163
48 3300041451 Ga0451791_1482317 Ga0451791_1482317_84_644 164
49 3300046460 Ga0495638_0009139 Ga0495638_0009139_5922_6482 164
50 3300025299 Ga0209256_1003271 Ga0209256_10032714 165
51 3300046810 Ga0495660_0002391 Ga0495660_0002391_4141_4701 167
52 3300031456 Ga0307513_10374229 Ga0307513_103742292 169
53 3300046520 Ga0495637_0045799 Ga0495637_0045799_882_1442 170
54 3300047472 Ga0495686_0025987 Ga0495686_0025987_243_803 170
55 3300042004 Ga0439445_0019971 Ga0439445_0019971_149_709 172
56 3300042156 Ga0439446_0027383 Ga0439446_0027383_341_901 172
57 3300044712 Ga0453684_0266761 Ga0453684_0266761_369_953 172
58 3300053092 Ga0500583_0004349 Ga0500583_0004349_3400_4026 172
59 3300005331 Ga0070670_100028018 Ga0070670_1000280182 173
60 3300005347 Ga0070668_100002052 Ga0070668_1000020522 173
61 3300005353 Ga0070669_100047907 Ga0070669_1000479072 173
62 3300005367 Ga0070667_100004855 Ga0070667_1000048555 173
63 3300005617 Ga0068859_100006984 Ga0068859_1000069846 173
64 3300005841 Ga0068863_100056943 Ga0068863_1000569432 173
65 3300005843 Ga0068860_100003039 Ga0068860_10000303914 173
66 3300005844 Ga0068862_100006717 Ga0068862_1000067172 173
67 3300006931 Ga0097620_100006984 Ga0097620_1000069846 173
68 3300009553 Ga0105249_10158002 Ga0105249_101580022 173
69 3300025925 Ga0207650_10088868 Ga0207650_100888682 173
70 3300025972 Ga0207668_10055091 Ga0207668_100550912 173
71 3300025986 Ga0207658_10131316 Ga0207658_101313162 173
72 3300026088 Ga0207641_10032804 Ga0207641_100328044 173
73 3300026095 Ga0207676_10176904 Ga0207676_101769042 173
74 3300028380 Ga0268265_10187925 Ga0268265_101879252 173
75 3300028381 Ga0268264_10067731 Ga0268264_100677312 173
76 3300035170 Ga0373943_0464496 Ga0373943_0464496_141_677 175
77 3300046460 Ga0495638_0258200 Ga0495638_0258200_291_899 177
78 3300046520 Ga0495637_0028740 Ga0495637_0028740_584_1222 177
79 3300046524 Ga0495648_0124377 Ga0495648_0124377_182_820 177
80 3300046530 Ga0495654_0007015 Ga0495654_0007015_5635_6273 177
81 3300046810 Ga0495660_0052389 Ga0495660_0052389_1515_2153 177
82 3300031344 Ga0265316_10000157 Ga0265316_1000015714 178
83 3300046491 Ga0495584_0005663 Ga0495584_0005663_4472_5080 178
84 3300046500 Ga0495596_0005723 Ga0495596_0005723_41_649 178
85 3300046501 Ga0495607_0055159 Ga0495607_0055159_291_899 178
86 3300046506 Ga0495583_0024256 Ga0495583_0024256_1826_2434 178
87 3300046518 Ga0495631_0004736 Ga0495631_0004736_150_758 178
88 3300046528 Ga0495642_0045444 Ga0495642_0045444_137_745 178
89 3300046538 Ga0495609_0167107 Ga0495609_0167107_276_884 178
90 3300046542 Ga0495597_0000878 Ga0495597_0000878_5661_6269 178
91 3300046616 Ga0495668_0001655 Ga0495668_0001655_504_1112 178
92 3300046665 Ga0495661_0009239 Ga0495661_0009239_4149_4757 178
93 3300047470 Ga0495681_0019645 Ga0495681_0019645_380_988 178
94 3300049742 Ga0501080_1374339 Ga0501080_1374339_25_567 178
95 3300005471 Ga0070698_100132461 Ga0070698_1001324612 179
96 3300005536 Ga0070697_100148653 Ga0070697_1001486532 179
97 3300024227 Ga0228598_1015070 Ga0228598_10150701 179
98 3300025922 Ga0207646_10091811 Ga0207646_100918113 179
99 3300045976 Ga0466967_0261172 Ga0466967_0261172_88_636 179
100 iso_pu_bacteria 2510917020 2511125539 179
101 iso_pu_bacteria 2582581280 2585155702 179
102 iso_pu_bacteria 2582581293 2585199495 179
103 iso_pu_bacteria 2643221545 2643747891 179
104 iso_pu_bacteria 2643221552 2643780141 179
105 iso_pu_bacteria 2643221583 2643926131 179
106 iso_pu_bacteria 2643221584 2643928659 179
107 iso_pu_bacteria 2643221691 2644511401 179
108 iso_pu_bacteria 2818991435 2819536761 179
109 iso_pu_bacteria 2818991454 2819645922 179
110 3300013306 Ga0163162_11523152 Ga0163162_115231521 180
111 3300013308 Ga0157375_10748960 Ga0157375_107489602 180
112 3300027876 Ga0209974_10010570 Ga0209974_100105703 182
113 3300032004 Ga0307414_10021306 Ga0307414_100213064 182
114 3300003794 Ga0055531_10002153 Ga0055531_100021539 183
115 3300005336 Ga0070680_100320630 Ga0070680_1003206302 183
116 3300005347 Ga0070668_100002234 Ga0070668_1000022345 183
117 3300005347 Ga0070668_100013263 Ga0070668_1000132632 183
118 3300005458 Ga0070681_10111408 Ga0070681_101114082 183
119 3300005458 Ga0070681_10122825 Ga0070681_101228252 183
120 3300005518 Ga0070699_101248762 Ga0070699_1012487621 183
121 3300005530 Ga0070679_100029621 Ga0070679_1000296214 183
122 3300005530 Ga0070679_100201244 Ga0070679_1002012442 183
123 3300005548 Ga0070665_100000329 Ga0070665_10000032920 183
124 3300005617 Ga0068859_100104662 Ga0068859_1001046622 183
125 3300005843 Ga0068860_100003109 Ga0068860_1000031099 183
126 3300005843 Ga0068860_100170798 Ga0068860_1001707982 183
127 3300005844 Ga0068862_100022986 Ga0068862_1000229862 183
128 3300005844 Ga0068862_100026527 Ga0068862_1000265272 183
129 3300006195 Ga0075366_10242009 Ga0075366_102420091 183
130 3300006353 Ga0075370_10073720 Ga0075370_100737202 183
131 3300006931 Ga0097620_100104664 Ga0097620_1001046642 183
132 3300009177 Ga0105248_10082011 Ga0105248_100820112 183
133 3300017792 Ga0163161_11029661 Ga0163161_110296612 183
134 3300021384 Ga0213876_10052676 Ga0213876_100526762 183
135 3300025298 Ga0209050_1022021 Ga0209050_10220212 183
136 3300025304 Ga0209257_1002549 Ga0209257_100254911 183
137 3300025909 Ga0207705_10002665 Ga0207705_1000266512 183
138 3300025912 Ga0207707_10077016 Ga0207707_100770163 183
139 3300025921 Ga0207652_10021966 Ga0207652_100219663 183
140 3300025932 Ga0207690_10026466 Ga0207690_100264662 183
141 3300025941 Ga0207711_10550778 Ga0207711_105507782 183
142 3300025949 Ga0207667_10021224 Ga0207667_100212245 183
143 3300025972 Ga0207668_10000053 Ga0207668_1000005373 183
144 3300025972 Ga0207668_10001269 Ga0207668_100012695 183
145 3300025986 Ga0207658_10714568 Ga0207658_107145681 183
146 3300026116 Ga0207674_10460790 Ga0207674_104607901 183
147 3300028379 Ga0268266_10000306 Ga0268266_1000030655 183
148 3300028380 Ga0268265_10054163 Ga0268265_100541632 183
149 3300028381 Ga0268264_10000021 Ga0268264_10000021442 183
150 3300028381 Ga0268264_10196354 Ga0268264_101963542 183
151 3300033180 Ga0307510_10003275 Ga0307510_1000327513 183
152 3300038443 Ga0395901_1034311 Ga0395901_1034311_89_655 183
153 3300039437 Ga0436365_1697098 Ga0436365_1697098_1080_1640 183
154 3300044712 Ga0453684_1452549 Ga0453684_1452549_21_581 183
155 3300046453 Ga0495627_000185 Ga0495627_000185_6219_6779 183
156 3300046460 Ga0495638_0035489 Ga0495638_0035489_152_712 183
157 3300046506 Ga0495583_0000029 Ga0495583_0000029_57830_58405 183
158 3300046512 Ga0495610_0006512 Ga0495610_0006512_3410_3970 183
159 3300046515 Ga0495620_0038995 Ga0495620_0038995_1389_1949 183
160 3300046520 Ga0495637_0004369 Ga0495637_0004369_26_619 183
161 3300046660 Ga0495625_0001311 Ga0495625_0001311_21080_21640 183
162 3300046660 Ga0495625_0162291 Ga0495625_0162291_765_1325 183
163 3300046665 Ga0495661_0004239 Ga0495661_0004239_7894_8487 183
164 3300047446 Ga0495679_005078 Ga0495679_005078_5275_5835 183
165 3300047469 Ga0495673_0000056 Ga0495673_0000056_235740_236300 183
166 3300047470 Ga0495681_0013972 Ga0495681_0013972_1952_2512 183
167 3300047472 Ga0495686_0102182 Ga0495686_0102182_149_709 183
168 3300048910 Ga0496107_0000095 Ga0496107_0000095_9727_10287 183
169 3300048924 Ga0496121_0001883 Ga0496121_0001883_28623_29183 183
170 3300048929 Ga0496126_0165589 Ga0496126_0165589_562_1122 183
171 3300050496 nmdc:mga07m45_283411_c1 nmdc:mga07m45_283411_c1_325_885 183
172 3300053125 Ga0500618_001099 Ga0500618_001099_6580_7140 183
173 3300053136 Ga0500559_0000145 Ga0500559_0000145_50218_50778 183
174 3300053136 Ga0500559_0005027 Ga0500559_0005027_1584_2144 183
175 3300053142 Ga0500577_0056472 Ga0500577_0056472_368_928 183
176 3300053727 Ga0500611_029013 Ga0500611_029013_476_1036 183
177 3300053731 Ga0500609_000802 Ga0500609_000802_3559_4119 183
178 3300009093 Ga0105240_10047943 Ga0105240_100479434 184
179 3300025242 Ga0209258_100228 Ga0209258_10022860 184
180 3300025254 Ga0209148_1000204 Ga0209148_100020432 184
181 3300025302 Ga0207426_1043635 Ga0207426_10436351 184
182 3300028653 Ga0265323_10028166 Ga0265323_100281662 184
183 3300013104 Ga0157370_10776684 Ga0157370_107766842 185
184 3300046514 Ga0495618_0386500 Ga0495618_0386500_197_805 185
185 3300047469 Ga0495673_0004042 Ga0495673_0004042_4286_4873 185
186 3300028800 Ga0265338_10754282 Ga0265338_107542821 186
187 3300046665 Ga0495661_0162411 Ga0495661_0162411_472_1164 186
188 3300005455 Ga0070663_100263360 Ga0070663_1002633602 187
189 3300046679 Ga0495623_0164112 Ga0495623_0164112_167_745 187
190 3300003187 JGI25151J46595_10000841 JGI25151J46595_1000084116 188
191 3300003215 JGI25153J46596_10020355 JGI25153J46596_100203552 188
192 3300003354 JGI25160J50197_1015235 JGI25160J50197_10152353 188
193 3300003781 Ga0055536_1000022 Ga0055536_100002260 188
194 3300005262 Ga0065165_1032293 Ga0065165_10322932 188
195 3300025284 Ga0209130_1007043 Ga0209130_10070432 188
196 3300025292 Ga0209676_1000012 Ga0209676_1000012615 188
197 3300025294 Ga0209025_1000124 Ga0209025_100012497 188
198 3300025302 Ga0207426_1000193 Ga0207426_100019394 188
199 3300003323 rootH1_10213629 rootH1_102136295 189
200 3300048913 Ga0496110_0000262 Ga0496110_0000262_18645_19259 189
201 3300006844 Ga0075428_100004130 Ga0075428_1000041306 190
202 3300006846 Ga0075430_100084314 Ga0075430_1000843142 190
203 3300006847 Ga0075431_100004231 Ga0075431_1000042319 190
204 3300006880 Ga0075429_100072324 Ga0075429_1000723241 190
205 3300009147 Ga0114129_10027319 Ga0114129_100273195 190
206 3300050509 nmdc:mga0qj67_21411_c1 nmdc:mga0qj67_21411_c1_3203_3793 190
207 3300050510 nmdc:mga06r32_54414_c1 nmdc:mga06r32_54414_c1_659_1249 190
208 3300053119 Ga0500595_000823 Ga0500595_000823_10083_10688 190
209 3300005445 Ga0070708_100053451 Ga0070708_1000534511 191
210 3300005445 Ga0070708_100106311 Ga0070708_1001063112 191
211 3300005468 Ga0070707_100042065 Ga0070707_1000420652 191
212 3300005468 Ga0070707_100196984 Ga0070707_1001969842 191
213 3300025928 Ga0207700_10003145 Ga0207700_100031458 191
214 3300031247 Ga0265340_10198664 Ga0265340_101986642 191
215 3300031249 Ga0265339_10166445 Ga0265339_101664452 191
216 3300031344 Ga0265316_10015251 Ga0265316_100152512 191
217 3300031711 Ga0265314_10005804 Ga0265314_100058043 191
218 3300038726 Ga0400490_41598 Ga0400490_41598_18393_19004 191
219 3300046513 Ga0495616_0015077 Ga0495616_0015077_3482_4138 191
220 3300039453 Ga0436362_1256968 Ga0436362_1256968_4877_5476 192
221 3300046616 Ga0495668_0002273 Ga0495668_0002273_7358_7969 192
222 iso_pu_bacteria 2599185311 2599995610 192
223 3300009553 Ga0105249_11001840 Ga0105249_110018402 193
224 3300013104 Ga0157370_10000468 Ga0157370_1000046834 193
225 3300046692 Ga0495671_0028645 Ga0495671_0028645_1417_1998 193
226 iso_pu_bacteria 2818991459 2819671207 194
227 iso_pu_bacteria 2857609550 2857610218 194
228 iso_pu_bacteria 2919425241 2919425626 194
229 iso_pu_bacteria 3006984091 3006986632 194
230 3300059424 Ga0590075_006226 Ga0590075_006226_1634_2221 195
231 3300059426 Ga0590077_088713 Ga0590077_088713_118_705 195
232 3300001989 JGI24739J22299_10017820 JGI24739J22299_100178202 196
233 3300005293 Ga0065715_10006394 Ga0065715_100063944 196
234 3300005327 Ga0070658_10035058 Ga0070658_100350584 196
235 3300013307 Ga0157372_10014290 Ga0157372_100142904 196
236 3300025295 Ga0209564_1002918 Ga0209564_10029189 196
237 3300025297 Ga0209758_1006294 Ga0209758_10062944 196
238 3300025302 Ga0207426_1045557 Ga0207426_10455572 196
239 3300025909 Ga0207705_10027110 Ga0207705_100271102 196
240 3300029957 Ga0265324_10040094 Ga0265324_100400942 196
241 3300032004 Ga0307414_10102314 Ga0307414_101023143 196
242 iso_pu_bacteria 2887375801 2887378128 196
243 iso_pu_bacteria 2890737413 2890740976 196
244 3300009148 Ga0105243_10022017 Ga0105243_100220173 197
245 3300011119 Ga0105246_10363990 Ga0105246_103639901 197
246 3300025935 Ga0207709_10052451 Ga0207709_100524512 197
247 3300028794 Ga0307515_10182391 Ga0307515_101823911 197
248 3300031824 Ga0307413_10160327 Ga0307413_101603273 197
249 3300031852 Ga0307410_10016052 Ga0307410_100160524 197
250 3300037471 Ga0395905_0000209 Ga0395905_0000209_76618_77235 197
251 3300039062 Ga0400483_186460 Ga0400483_186460_1279_1878 197
252 3300039062 Ga0400483_189449 Ga0400483_189449_262_858 197
253 3300047471 Ga0495684_0728036 Ga0495684_0728036_18_611 197
254 3300048920 Ga0496117_0047437 Ga0496117_0047437_1916_2521 197
255 3300049568 Ga0501031_0216158 Ga0501031_0216158_182_775 197
256 3300049575 Ga0501039_0078223 Ga0501039_0078223_154_747 197
257 3300049591 Ga0501075_0026223 Ga0501075_0026223_19_612 197
258 3300049824 Ga0501045_0585935 Ga0501045_0585935_163_756 197
259 3300053084 Ga0495595_0100267 Ga0495595_0100267_541_1134 197
260 iso_pu_bacteria 2585428095 2587867520 197
261 iso_pu_bacteria 2643221716 2644643879 197
262 iso_pu_bacteria 2965320100 2965321991 197
263 3300002774 JGI25150J39212_1000227 JGI25150J39212_10002276 198
264 3300003215 JGI25153J46596_10000594 JGI25153J46596_100005948 198
265 3300005328 Ga0070676_10659761 Ga0070676_106597611 198
266 3300005335 Ga0070666_10316832 Ga0070666_103168322 198
267 3300005356 Ga0070674_100598041 Ga0070674_1005980411 198
268 3300005548 Ga0070665_100051213 Ga0070665_1000512133 198
269 3300005843 Ga0068860_100542775 Ga0068860_1005427752 198
270 3300006358 Ga0068871_100146116 Ga0068871_1001461163 198
271 3300006881 Ga0068865_100046065 Ga0068865_1000460653 198
272 3300006881 Ga0068865_100161780 Ga0068865_1001617802 198
273 3300009098 Ga0105245_10061796 Ga0105245_100617963 198
274 3300009176 Ga0105242_10153381 Ga0105242_101533812 198
275 3300009177 Ga0105248_10013708 Ga0105248_100137083 198
276 3300009177 Ga0105248_10050732 Ga0105248_100507323 198
277 3300009177 Ga0105248_10139698 Ga0105248_101396982 198
278 3300013296 Ga0157374_10158348 Ga0157374_101583482 198
279 3300013306 Ga0163162_10031232 Ga0163162_100312325 198
280 3300014969 Ga0157376_10213140 Ga0157376_102131402 198
281 3300025245 Ga0207425_1000001 Ga0207425_10000012068 198
282 3300025258 Ga0209129_1000001 Ga0209129_10000011245 198
283 3300025294 Ga0209025_1006901 Ga0209025_10069016 198
284 3300025297 Ga0209758_1000055 Ga0209758_1000055284 198
285 3300025907 Ga0207645_10117988 Ga0207645_101179883 198
286 3300025927 Ga0207687_10152296 Ga0207687_101522962 198
287 3300025934 Ga0207686_10003807 Ga0207686_100038076 198
288 3300025941 Ga0207711_10034005 Ga0207711_100340052 198
289 3300025941 Ga0207711_10127877 Ga0207711_101278773 198
290 3300025941 Ga0207711_10508309 Ga0207711_105083092 198
291 3300026089 Ga0207648_10019886 Ga0207648_100198863 198
292 3300026121 Ga0207683_10119310 Ga0207683_101193102 198
293 3300028379 Ga0268266_10094849 Ga0268266_100948493 198
294 3300028381 Ga0268264_10200123 Ga0268264_102001232 198
295 3300048907 Ga0496104_0181181 Ga0496104_0181181_909_1505 198
296 iso_pu_bacteria 8036736890 8036737862 198
297 3300006914 Ga0075436_100257178 Ga0075436_1002571782 199
298 iso_pu_bacteria 2910245624 2910246427 199
299 3300037418 Ga0395900_0010294 Ga0395900_0010294_2076_2678 200
300 3300037466 Ga0395898_0004370 Ga0395898_0004370_2197_2799 200
301 3300037471 Ga0395905_0739977 Ga0395905_0739977_70_672 200
302 3300038443 Ga0395901_0151589 Ga0395901_0151589_510_1112 200
303 3300002987 JGI25159J45721_1009324 JGI25159J45721_10093243 201
304 3300003322 rootL2_10212091 rootL2_102120916 201
305 3300009092 Ga0105250_10001805 Ga0105250_100018051 201
306 3300009177 Ga0105248_10254030 Ga0105248_102540302 201
307 3300025284 Ga0209130_1003717 Ga0209130_10037174 201
308 3300031251 Ga0265327_10000006 Ga0265327_1000000658 201
309 3300032004 Ga0307414_10640650 Ga0307414_106406502 201
310 3300047472 Ga0495686_0001702 Ga0495686_0001702_15228_15833 201
311 3300032004 Ga0307414_10010769 Ga0307414_100107693 202
312 3300036712 Ga0316584_0325442 Ga0316584_0325442_437_1051 202
313 3300049686 Ga0501257_054872 Ga0501257_054872_54_662 202
314 3300053086 Ga0500578_0000554 Ga0500578_0000554_38969_39577 202
315 3300005329 Ga0070683_100005059 Ga0070683_1000050595 203
316 3300005535 Ga0070684_100007337 Ga0070684_1000073379 203
317 3300009093 Ga0105240_10000047 Ga0105240_1000004768 203
318 3300010375 Ga0105239_10001231 Ga0105239_1000123113 203
319 3300025913 Ga0207695_10000010 Ga0207695_10000010171 203
320 3300025944 Ga0207661_10014648 Ga0207661_100146482 203
321 3300031616 Ga0307508_10287355 Ga0307508_102873551 203
322 3300002737 JGI25162J39368_1000204 JGI25162J39368_100020444 204
323 3300002772 JGI25164J39214_1000944 JGI25164J39214_10009445 204
324 3300003214 JGI25165J46597_1000753 JGI25165J46597_100075311 204
325 3300005336 Ga0070680_100061380 Ga0070680_1000613803 204
326 3300005530 Ga0070679_100107434 Ga0070679_1001074342 204
327 3300025231 Ga0207427_100223 Ga0207427_10022323 204
328 3300025233 Ga0209437_100164 Ga0209437_10016437 204
329 3300025261 Ga0209233_1000242 Ga0209233_100024243 204
330 3300037418 Ga0395900_0003049 Ga0395900_0003049_2851_3474 204
331 3300037418 Ga0395900_0125175 Ga0395900_0125175_994_1608 204
332 3300037466 Ga0395898_0072031 Ga0395898_0072031_2040_2663 204
333 3300037466 Ga0395898_0452067 Ga0395898_0452067_457_1071 204
334 3300048911 Ga0496108_0519399 Ga0496108_0519399_374_988 204
335 3300003320 rootH2_10029156 rootH2_100291563 205
336 3300003323 rootH1_10280008 rootH1_102800082 205
337 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00006590 206
338 3300005289 Ga0065704_10070140 Ga0065704_10070140280 206
339 3300031727 Ga0316576_10091668 Ga0316576_100916683 206
340 3300036647 Ga0316582_0152675 Ga0316582_0152675_479_1129 206
341 3300039062 Ga0400483_020331 Ga0400483_020331_183_845 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02397

Bac_transf

Bacterial sugar transferase

22

197

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.9276 3 185
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.9095 4 184
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.9026 4 192
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.8866 4 184
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.8803 4 192
ID Description Score Start End Superfamily
af_Q0J6W9_62_206_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.5881 43 63 2.30.110.10
1aupA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.5671 45 63 3.40.50.10860
1nqyA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.5439 41 63 3.90.79.10
af_A0A0R0FKB1_3_185_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.5212 43 71 2.30.110.10
af_Q4CWW1_321_436_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5174 43 73 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A519P1D2-F1-model_v4 deleted 0.9963 5 184
AF-A0A2N2Y6L0-F1-model_v4 Lipid carrier--UDP-N-acetylgalactosaminyltransferase 0.9951 5 180 GO:0016780
AF-A0A349P650-F1-model_v4 deleted 0.9938 4 147
AF-A0A2N4X778-F1-model_v4 Lipid carrier--UDP-N-acetylgalactosaminyltransferase 0.993 5 189 GO:0016020
GO:0016780
AF-A0A6L7E7K5-F1-model_v4 deleted 0.9915 48 187

Feature Viewer

pLDDT pTM Quality
90.8 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map