F414731

General Info

Members Datasets Scaffolds Average Seq Length
341 222 340 82

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_12181877|Ga0105241_121818771
Length 95
Sequence MRFLGGNGMSNFVETWKGIATALGRSERWCRYMARRAGDPLPVFKVGGIVRLNTNDLEDWLSRQRDRSMRVAIPAVVQAIPAAAASDDVGLRLIA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
150 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
151 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
152 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
170 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
171 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
172 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
173 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
174 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
177 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
178 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
179 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
180 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
202 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
203 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
204 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
208 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
209 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
212 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
213 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
214 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
215 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
221 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 1.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 0
Rhizoplane 1.17
Rhizosphere 82.11
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10168042 3300003323 Bacteria 1888
2 Ga0058861_11980788 3300004800 Unclassified 637
3 Ga0058860_10039270 3300004801 Bacteria 577
4 Ga0058860_10107444 3300004801 Unclassified 589
5 Ga0058862_12716050 3300004803 Bacteria 1123
6 Ga0070658_10118113 3300005327 Unclassified 2202
7 Ga0070658_10399652 3300005327 Bacteria 1180
8 Ga0070658_10775842 3300005327 Bacteria 833
9 Ga0070683_101760382 3300005329 Unclassified 596
10 Ga0070690_100003058 3300005330 Bacteria 9089
11 Ga0070690_100923810 3300005330 Unclassified 684
12 Ga0070690_101248683 3300005330 Bacteria 594
13 Ga0068869_100027306 3300005334 Bacteria 3979
14 Ga0068869_100076333 3300005334 Bacteria 2491
15 Ga0068869_100210606 3300005334 Bacteria 1536
16 Ga0070680_100345252 3300005336 Bacteria 1265
17 Ga0070680_100831510 3300005336 Bacteria 796
18 Ga0070680_101662161 3300005336 Unclassified 553
19 Ga0070682_101323106 3300005337 Unclassified 613
20 Ga0070689_100050359 3300005340 Bacteria 3218
21 Ga0070689_100117948 3300005340 Unclassified 2117
22 Ga0070689_100506327 3300005340 Bacteria 1035
23 Ga0070674_100075469 3300005356 Bacteria 2395
24 Ga0070673_100235672 3300005364 Bacteria 1589
25 Ga0070688_100059301 3300005365 Unclassified 2413
26 Ga0070688_100257044 3300005365 Unclassified 1246
27 Ga0070688_100378461 3300005365 Unclassified 1043
28 Ga0070667_100437221 3300005367 Bacteria 1194
29 Ga0070709_10093347 3300005434 Viruses 1989
30 Ga0070709_10568627 3300005434 Bacteria 869
31 Ga0070709_11661616 3300005434 Unclassified 521
32 Ga0070705_100039360 3300005440 Bacteria 2682
33 Ga0070678_100017834 3300005456 Bacteria 4582
34 Ga0070678_100659398 3300005456 Unclassified 939
35 Ga0070681_10279834 3300005458 Bacteria 1579
36 Ga0070681_10599627 3300005458 Unclassified 1016
37 Ga0070681_10662726 3300005458 Unclassified 959
38 Ga0068867_102058500 3300005459 Unclassified 540
39 Ga0070685_11070210 3300005466 Unclassified 608
40 Ga0070707_100620237 3300005468 Bacteria 1044
41 Ga0070699_100317742 3300005518 Bacteria 1399
42 Ga0070679_100036923 3300005530 Bacteria 4850
43 Ga0070679_100552834 3300005530 Unclassified 1095
44 Ga0070684_100257084 3300005535 Unclassified 1597
45 Ga0070697_100869003 3300005536 Bacteria 799
46 Ga0070665_100035471 3300005548 Bacteria 5015
47 Ga0070665_100525455 3300005548 Unclassified 1195
48 Ga0068855_100628773 3300005563 Bacteria 1155
49 Ga0068857_100475181 3300005577 Bacteria 1171
50 Ga0068857_102139255 3300005577 Unclassified 549
51 Ga0068856_100052209 3300005614 Bacteria 4031
52 Ga0070702_100303562 3300005615 Unclassified 1105
53 Ga0068852_100110107 3300005616 Unclassified 2502
54 Ga0068859_100084894 3300005617 Bacteria 3211
55 Ga0068859_100735493 3300005617 Unclassified 1076
56 Ga0068859_101855139 3300005617 Unclassified 666
57 Ga0068864_100103987 3300005618 Bacteria 2522
58 Ga0068864_101020581 3300005618 Unclassified 821
59 Ga0068861_100021887 3300005719 Bacteria 4598
60 Ga0068861_100436531 3300005719 Bacteria 1170
61 Ga0068851_10089106 3300005834 Unclassified 1622
62 Ga0068863_100050082 3300005841 Bacteria 3961
63 Ga0068858_100360785 3300005842 Unclassified 1393
64 Ga0068860_100264934 3300005843 Unclassified 1676
65 Ga0068860_100613297 3300005843 Bacteria 1094
66 Ga0068862_100353614 3300005844 Unclassified 1364
67 Ga0081455_10152005 3300005937 Unclassified 1784
68 Ga0070717_10014533 3300006028 Bacteria 6058
69 Ga0070712_101499124 3300006175 Unclassified 589
70 Ga0097621_100289878 3300006237 Unclassified 1443
71 Ga0097621_100327519 3300006237 Bacteria 1358
72 Ga0097621_102118917 3300006237 Bacteria 538
73 Ga0068871_100210383 3300006358 Bacteria 1682
74 Ga0068871_100462451 3300006358 Bacteria 1139
75 Ga0075428_100643379 3300006844 Unclassified 1131
76 Ga0075430_100411375 3300006846 Unclassified 1116
77 Ga0075430_101599145 3300006846 Bacteria 535
78 Ga0075430_101781481 3300006846 Bacteria 505
79 Ga0075431_100154439 3300006847 Bacteria 2362
80 Ga0075431_100745455 3300006847 Unclassified 955
81 Ga0075431_101135410 3300006847 Bacteria 745
82 Ga0075431_101332167 3300006847 Unclassified 678
83 Ga0075434_100897605 3300006871 Bacteria 901
84 Ga0075429_100036758 3300006880 Bacteria 4261
85 Ga0075429_100053528 3300006880 Bacteria 3512
86 Ga0075429_100374056 3300006880 Bacteria 1247
87 Ga0075429_101289298 3300006880 Bacteria 637
88 Ga0075429_101563379 3300006880 Bacteria 573
89 Ga0068865_100031674 3300006881 Bacteria 3527
90 Ga0068865_101020977 3300006881 Unclassified 725
91 Ga0097620_100084895 3300006931 Bacteria 3211
92 Ga0097620_100735502 3300006931 Unclassified 1076
93 Ga0097620_101855099 3300006931 Unclassified 666
94 Ga0075435_100156529 3300007076 Bacteria 1917
95 Ga0075435_101973643 3300007076 Unclassified 512
96 Ga0105240_10655138 3300009093 Unclassified 1150
97 Ga0111539_11626246 3300009094 Unclassified 749
98 Ga0105245_10000015 3300009098 Bacteria 224549
99 Ga0114129_10700190 3300009147 Bacteria 1302
100 Ga0114129_10780384 3300009147 Unclassified 1221
101 Ga0114129_10811060 3300009147 Bacteria 1193
102 Ga0114129_10931441 3300009147 Unclassified 1099
103 Ga0114129_12599968 3300009147 Unclassified 604
104 Ga0114129_13453886 3300009147 Unclassified 506
105 Ga0105243_10198181 3300009148 Bacteria 1759
106 Ga0105241_10560916 3300009174 Unclassified 1027
107 Ga0105241_12181877 3300009174 Unclassified 549
108 Ga0105242_10276014 3300009176 Unclassified 1525
109 Ga0105248_10618952 3300009177 Bacteria 1221
110 Ga0105238_10248325 3300009551 Unclassified 1757
111 Ga0105238_11645093 3300009551 Unclassified 672
112 Ga0105249_10391740 3300009553 Bacteria 1417
113 Ga0105249_11827795 3300009553 Bacteria 680
114 Ga0105249_12832826 3300009553 Unclassified 556
115 Ga0105239_10417520 3300010375 Unclassified 1520
116 Ga0105246_10192663 3300011119 Bacteria 1579
117 Ga0157374_10027307 3300013296 Bacteria 5146
118 Ga0157374_10271564 3300013296 Bacteria 1672
119 Ga0157378_10024023 3300013297 Bacteria 5362
120 Ga0157378_12426855 3300013297 Unclassified 576
121 Ga0157380_11810529 3300014326 Unclassified 670
122 Ga0157377_11168164 3300014745 Unclassified 594
123 Ga0157376_10168187 3300014969 Unclassified 1994
124 Ga0157376_10377288 3300014969 Unclassified 1365
125 Ga0157376_10864153 3300014969 Bacteria 921
126 Ga0157376_13010890 3300014969 Unclassified 510
127 Ga0213876_10012931 3300021384 Bacteria 4438
128 Ga0207692_10320883 3300025898 Bacteria 948
129 Ga0207642_10788954 3300025899 Unclassified 603
130 Ga0207699_10227580 3300025906 Bacteria 1276
131 Ga0207699_10789651 3300025906 Unclassified 698
132 Ga0207705_10725554 3300025909 Bacteria 772
133 Ga0207707_10143806 3300025912 Unclassified 2085
134 Ga0207707_10397904 3300025912 Bacteria 1183
135 Ga0207695_11280785 3300025913 Unclassified 613
136 Ga0207660_10184099 3300025917 Bacteria 1624
137 Ga0207660_10208192 3300025917 Bacteria 1530
138 Ga0207660_11526542 3300025917 Unclassified 539
139 Ga0207662_10055050 3300025918 Unclassified 2373
140 Ga0207662_10116022 3300025918 Bacteria 1674
141 Ga0207662_10764331 3300025918 Unclassified 680
142 Ga0207652_10023287 3300025921 Bacteria 5130
143 Ga0207646_10638908 3300025922 Bacteria 954
144 Ga0207646_10894569 3300025922 Unclassified 788
145 Ga0207694_11096224 3300025924 Unclassified 674
146 Ga0207659_10094461 3300025926 Bacteria 2241
147 Ga0207687_10002702 3300025927 Bacteria 11998
148 Ga0207686_10150271 3300025934 Unclassified 1621
149 Ga0207709_10445222 3300025935 Bacteria 1000
150 Ga0207709_10510509 3300025935 Bacteria 939
151 Ga0207670_10087519 3300025936 Bacteria 2195
152 Ga0207670_10328540 3300025936 Bacteria 1205
153 Ga0207670_11498284 3300025936 Unclassified 573
154 Ga0207704_10035616 3300025938 Bacteria 2854
155 Ga0207711_10552378 3300025941 Bacteria 1074
156 Ga0207689_10053573 3300025942 Bacteria 3324
157 Ga0207689_10058451 3300025942 Bacteria 3172
158 Ga0207689_10152855 3300025942 Bacteria 1902
159 Ga0207661_10108076 3300025944 Bacteria 2348
160 Ga0207667_10554876 3300025949 Bacteria 1162
161 Ga0207712_10450071 3300025961 Bacteria 1092
162 Ga0207677_11870453 3300026023 Unclassified 557
163 Ga0207703_11670417 3300026035 Unclassified 613
164 Ga0207708_10207325 3300026075 Bacteria 1566
165 Ga0207702_10077391 3300026078 Unclassified 2877
166 Ga0207641_10034957 3300026088 Bacteria 4183
167 Ga0207641_10348123 3300026088 Bacteria 1412
168 Ga0207648_10869329 3300026089 Unclassified 841
169 Ga0207648_11013959 3300026089 Unclassified 778
170 Ga0207676_10415656 3300026095 Bacteria 1260
171 Ga0207676_11051718 3300026095 Bacteria 803
172 Ga0207675_100093659 3300026118 Bacteria 2826
173 Ga0207675_100436867 3300026118 Bacteria 1295
174 Ga0207675_102238513 3300026118 Unclassified 561
175 Ga0207683_10022721 3300026121 Bacteria 5387
176 Ga0207698_10766218 3300026142 Unclassified 965
177 Ga0268266_10004793 3300028379 Bacteria 12849
178 Ga0268266_10620884 3300028379 Bacteria 1039
179 Ga0268265_10717399 3300028380 Bacteria 968
180 Ga0268264_10962856 3300028381 Bacteria 859
181 Ga0268264_10969769 3300028381 Bacteria 856
182 Ga0307517_10031396 3300028786 Bacteria 6184
183 Ga0307515_10052134 3300028794 Bacteria 6077
184 Ga0307515_10391303 3300028794 Bacteria 1019
185 Ga0307511_10124602 3300030521 Bacteria 1578
186 Ga0265332_10007011 3300031238 Bacteria 5103
187 Ga0265316_10643603 3300031344 Unclassified 750
188 Ga0307513_10011182 3300031456 Bacteria 11173
189 Ga0307513_10135498 3300031456 Bacteria 2399
190 Ga0307509_10000143 3300031507 Bacteria 107879
191 Ga0307509_10015692 3300031507 Bacteria 8821
192 Ga0307509_10535207 3300031507 Unclassified 851
193 Ga0307509_10547152 3300031507 Unclassified 836
194 Ga0307509_10624277 3300031507 Unclassified 748
195 Ga0307508_10076715 3300031616 Bacteria 2920
196 Ga0307508_10303295 3300031616 Unclassified 1190
197 Ga0265314_10488071 3300031711 Unclassified 650
198 Ga0265314_10604185 3300031711 Unclassified 565
199 Ga0307516_10165800 3300031730 Bacteria 1954
200 Ga0307406_10039597 3300031901 Unclassified 2925
201 Ga0307415_100008031 3300032126 Bacteria 5823
202 Ga0307415_100376318 3300032126 Bacteria 1204
203 Ga0307507_10031913 3300033179 Bacteria 5515
204 Ga0307507_10400224 3300033179 Bacteria 781
205 Ga0373936_0000002 3300035113 Bacteria 452874
206 Ga0373956_0361512 3300035119 Unclassified 692
207 Ga0373957_0415766 3300035120 Bacteria 580
208 Ga0373955_0855693 3300035172 Bacteria 559
209 Ga0373961_0000101 3300035241 Bacteria 46278
210 Ga0316574_0366567 3300035398 Bacteria 910
211 Ga0373933_0690850 3300035724 Bacteria 671
212 Ga0373937_0652800 3300036401 Bacteria 998
213 Ga0395899_0610996 3300037312 Unclassified 693
214 Ga0395900_0087229 3300037418 Bacteria 3207
215 Ga0395900_0803944 3300037418 Unclassified 868
216 Ga0395900_0989753 3300037418 Unclassified 761
217 Ga0395898_0256656 3300037466 Bacteria 1667
218 Ga0395905_0333515 3300037471 Unclassified 1407
219 Ga0395905_0462314 3300037471 Unclassified 1167
220 Ga0395901_0338920 3300038443 Bacteria 1553
221 Ga0436365_0165817 3300039437 Unclassified 1586
222 Ga0436365_1105624 3300039437 Bacteria 3309
223 Ga0436363_0373271 3300039450 Unclassified 566
224 Ga0436363_0657787 3300039450 Bacteria 577
225 Ga0451797_0944188 3300041453 Unclassified 601
226 Ga0451800_1378480 3300041459 Unclassified 561
227 Ga0451807_0645985 3300041486 Unclassified 635
228 Ga0451851_0414308 3300041507 Bacteria 523
229 Ga0451853_0965615 3300041512 Unclassified 662
230 Ga0451853_1349847 3300041512 Bacteria 1719
231 Ga0451853_2804491 3300041512 Unclassified 752
232 Ga0466964_0485856 3300044706 Unclassified 661
233 Ga0466957_1388577 3300044842 Bacteria 511
234 Ga0451576_0465974 3300045051 Bacteria 1327
235 Ga0466967_0165702 3300045976 Bacteria 2077
236 Ga0495650_0086654 3300046471 Bacteria 1198
237 Ga0495686_0016372 3300047472 Bacteria 5028
238 Ga0496115_0172021 3300048918 Unclassified 1791
239 Ga0501309_030216 3300049129 Bacteria 797
240 Ga0501310_051343 3300049130 Bacteria 597
241 Ga0501293_002848 3300049516 Bacteria 1322
242 Ga0501296_022771 3300049519 Unclassified 809
243 Ga0501296_028447 3300049519 Bacteria 743
244 Ga0501298_034317 3300049521 Bacteria 1008
245 Ga0501299_033081 3300049522 Bacteria 1006
246 Ga0501033_0217226 3300049570 Unclassified 1362
247 Ga0501034_0142573 3300049571 Bacteria 2375
248 Ga0501034_0280677 3300049571 Bacteria 1605
249 Ga0501037_0703748 3300049573 Bacteria 672
250 Ga0501042_0844144 3300049578 Bacteria 667
251 Ga0501043_0334284 3300049579 Unclassified 1153
252 Ga0501046_0161519 3300049580 Bacteria 1685
253 Ga0501047_0011569 3300049581 Bacteria 8350
254 Ga0501047_0092577 3300049581 Unclassified 2901
255 Ga0501048_0452558 3300049582 Bacteria 919
256 Ga0501067_0044053 3300049583 Unclassified 2480
257 Ga0501068_0045228 3300049584 Unclassified 2652
258 Ga0501069_0018839 3300049585 Bacteria 3726
259 Ga0501070_0015727 3300049586 Bacteria 6363
260 Ga0501070_0033386 3300049586 Bacteria 4307
261 Ga0501070_0535518 3300049586 Bacteria 938
262 Ga0501070_0818524 3300049586 Unclassified 730
263 Ga0501071_0166302 3300049587 Unclassified 1650
264 Ga0501072_0069780 3300049588 Bacteria 2775
265 Ga0501073_0249907 3300049589 Bacteria 1224
266 Ga0501074_0096649 3300049590 Bacteria 2115
267 Ga0501074_0253396 3300049590 Bacteria 1252
268 Ga0501202_037187 3300049652 Bacteria 1039
269 Ga0501207_016882 3300049654 Bacteria 1135
270 Ga0501210_024966 3300049657 Unclassified 589
271 Ga0501214_054220 3300049659 Unclassified 617
272 Ga0501216_001132 3300049660 Bacteria 3504
273 Ga0501217_057708 3300049661 Bacteria 1029
274 Ga0501217_134312 3300049661 Bacteria 728
275 Ga0501223_048358 3300049663 Bacteria 825
276 Ga0501227_000057 3300049665 Bacteria 17108
277 Ga0501227_010219 3300049665 Unclassified 2032
278 Ga0501230_006176 3300049667 Bacteria 1727
279 Ga0501233_003463 3300049668 Bacteria 2837
280 Ga0501236_014062 3300049670 Bacteria 1103
281 Ga0501239_034933 3300049672 Bacteria 674
282 Ga0501249_108496 3300049679 Unclassified 669
283 Ga0501221_005116 3300049704 Bacteria 2187
284 Ga0501225_0025662 3300049705 Bacteria 1621
285 Ga0501234_029951 3300049707 Bacteria 878
286 Ga0501080_0153123 3300049742 Bacteria 2130
287 Ga0501080_0438952 3300049742 Bacteria 1171
288 Ga0501035_1044589 3300049822 Bacteria 640
289 Ga0501044_0012559 3300049823 Bacteria 9173
290 Ga0501044_0097229 3300049823 Unclassified 2966
291 Ga0501220_03822 3300049852 Bacteria 674
292 nmdc:mga05p37_2023871_c1 3300050507 Unclassified 544
293 nmdc:mga05p37_602523_c1 3300050507 Bacteria 1240
294 nmdc:mga09592_1029948_c1 3300050508 Bacteria 687
295 nmdc:mga09592_1056049_c1 3300050508 Bacteria 677
296 nmdc:mga09592_1094091_c1 3300050508 Unclassified 663
297 nmdc:mga09592_1173702_c1 3300050508 Bacteria 636
298 nmdc:mga09592_149351_c1 3300050508 Unclassified 2016
299 nmdc:mga09592_44635_c1 3300050508 Bacteria 3732
300 nmdc:mga0qj67_1528147_c1 3300050509 Bacteria 513
301 nmdc:mga0qj67_701910_c1 3300050509 Unclassified 805
302 nmdc:mga06r32_1043197_c1 3300050510 Bacteria 769
303 nmdc:mga06r32_1259099_c1 3300050510 Unclassified 685
304 nmdc:mga06r32_140686_c1 3300050510 Bacteria 2389
305 nmdc:mga06r32_1509768_c1 3300050510 Bacteria 612
306 nmdc:mga06r32_1747431_c1 3300050510 Unclassified 558
307 nmdc:mga06r32_306485_c1 3300050510 Bacteria 1573
308 nmdc:mga06r32_502807_c1 3300050510 Archaea 1189
309 nmdc:mga0rr50_87975_c1 3300050513 Bacteria 2412
310 nmdc:mga08x19_395132_c1 3300050514 Bacteria 969
311 Ga0500635_0100766 3300053080 Unclassified 1062
312 Ga0495595_0411221 3300053084 Bacteria 686
313 Ga0500578_0042576 3300053086 Unclassified 2916
314 Ga0500578_0339916 3300053086 Unclassified 880
315 Ga0500644_0316567 3300053088 Unclassified 670
316 Ga0500646_0046535 3300053090 Bacteria 1238
317 Ga0500566_0030924 3300053094 Bacteria 3121
318 Ga0500640_002596 3300053095 Bacteria 6033
319 Ga0500554_000707 3300053102 Bacteria 6758
320 Ga0500562_078021 3300053108 Unclassified 895
321 Ga0500572_002772 3300053111 Bacteria 4135
322 Ga0500595_000397 3300053119 Bacteria 27943
323 Ga0500614_000348 3300053123 Bacteria 12062
324 Ga0500621_125508 3300053126 Unclassified 989
325 Ga0500623_250641 3300053127 Unclassified 592
326 Ga0500642_0064335 3300053130 Bacteria 1655
327 Ga0500559_0009503 3300053136 Bacteria 4204
328 Ga0500564_040876 3300053138 Bacteria 2134
329 Ga0500568_0024318 3300053139 Bacteria 2566
330 Ga0500579_189016 3300053143 Unclassified 790
331 Ga0500585_045104 3300053144 Unclassified 1565
332 Ga0500603_002866 3300053150 Unclassified 3739
333 Ga0500603_009226 3300053150 Bacteria 2203
334 Ga0500622_0025283 3300053156 Bacteria 3138
335 Ga0500630_051518 3300053159 Bacteria 1988
336 Ga0500638_074959 3300053162 Bacteria 1613
337 Ga0500636_0055747 3300053177 Unclassified 2316
338 Ga0500637_0182590 3300053178 Bacteria 1202
339 Ga0500601_004992 3300053737 Unclassified 1450
340 Ga0501082_0065139 3300060353 Bacteria 3138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005364 Ga0070673_100235672 Ga0070673_1002356722 72
2 3300025926 Ga0207659_10094461 Ga0207659_100944613 72
3 3300026118 Ga0207675_102238513 Ga0207675_1022385131 72
4 3300026095 Ga0207676_10415656 Ga0207676_104156562 74
5 3300005330 Ga0070690_101248683 Ga0070690_1012486832 75
6 3300005434 Ga0070709_11661616 Ga0070709_116616161 75
7 3300005618 Ga0068864_100103987 Ga0068864_1001039873 75
8 3300006237 Ga0097621_100289878 Ga0097621_1002898782 75
9 3300006358 Ga0068871_100462451 Ga0068871_1004624512 75
10 3300026095 Ga0207676_11051718 Ga0207676_110517182 75
11 3300035398 Ga0316574_0366567 Ga0316574_0366567_147_386 75
12 3300041453 Ga0451797_0944188 Ga0451797_0944188_227_466 75
13 3300005327 Ga0070658_10118113 Ga0070658_101181132 76
14 3300005518 Ga0070699_100317742 Ga0070699_1003177422 76
15 3300005719 Ga0068861_100021887 Ga0068861_1000218873 76
16 3300005843 Ga0068860_100613297 Ga0068860_1006132972 76
17 3300006175 Ga0070712_101499124 Ga0070712_1014991242 76
18 3300006844 Ga0075428_100643379 Ga0075428_1006433791 76
19 3300006846 Ga0075430_101781481 Ga0075430_1017814812 76
20 3300006880 Ga0075429_100374056 Ga0075429_1003740562 76
21 3300006880 Ga0075429_101289298 Ga0075429_1012892982 76
22 3300007076 Ga0075435_101973643 Ga0075435_1019736432 76
23 3300009147 Ga0114129_10700190 Ga0114129_107001902 76
24 3300009148 Ga0105243_10198181 Ga0105243_101981812 76
25 3300009174 Ga0105241_10560916 Ga0105241_105609162 76
26 3300009176 Ga0105242_10276014 Ga0105242_102760142 76
27 3300025922 Ga0207646_10894569 Ga0207646_108945692 76
28 3300025934 Ga0207686_10150271 Ga0207686_101502713 76
29 3300025935 Ga0207709_10510509 Ga0207709_105105092 76
30 3300026118 Ga0207675_100093659 Ga0207675_1000936592 76
31 3300028381 Ga0268264_10969769 Ga0268264_109697692 76
32 3300031456 Ga0307513_10135498 Ga0307513_101354982 76
33 3300031711 Ga0265314_10604185 Ga0265314_106041852 76
34 3300032126 Ga0307415_100376318 Ga0307415_1003763181 76
35 3300037312 Ga0395899_0610996 Ga0395899_0610996_281_517 76
36 3300037418 Ga0395900_0087229 Ga0395900_0087229_1314_1550 76
37 3300037418 Ga0395900_0803944 Ga0395900_0803944_247_483 76
38 3300037466 Ga0395898_0256656 Ga0395898_0256656_318_554 76
39 3300038443 Ga0395901_0338920 Ga0395901_0338920_68_304 76
40 3300050507 nmdc:mga05p37_602523_c1 nmdc:mga05p37_602523_c1_324_560 76
41 3300050508 nmdc:mga09592_1029948_c1 nmdc:mga09592_1029948_c1_277_510 76
42 3300050508 nmdc:mga09592_1056049_c1 nmdc:mga09592_1056049_c1_213_449 76
43 3300050509 nmdc:mga0qj67_1528147_c1 nmdc:mga0qj67_1528147_c1_62_298 76
44 3300050510 nmdc:mga06r32_1509768_c1 nmdc:mga06r32_1509768_c1_296_532 76
45 3300005458 Ga0070681_10662726 Ga0070681_106627261 77
46 3300014745 Ga0157377_11168164 Ga0157377_111681641 77
47 3300005530 Ga0070679_100552834 Ga0070679_1005528342 78
48 3300005577 Ga0068857_102139255 Ga0068857_1021392551 78
49 3300006237 Ga0097621_100327519 Ga0097621_1003275192 78
50 3300006358 Ga0068871_100210383 Ga0068871_1002103832 78
51 3300006846 Ga0075430_101599145 Ga0075430_1015991451 78
52 3300006880 Ga0075429_101563379 Ga0075429_1015633791 78
53 3300009177 Ga0105248_10618952 Ga0105248_106189522 78
54 3300014326 Ga0157380_11810529 Ga0157380_118105291 78
55 3300014969 Ga0157376_10864153 Ga0157376_108641531 78
56 3300025906 Ga0207699_10789651 Ga0207699_107896512 78
57 3300025936 Ga0207670_11498284 Ga0207670_114982841 78
58 3300025941 Ga0207711_10552378 Ga0207711_105523782 78
59 3300031901 Ga0307406_10039597 Ga0307406_100395972 78
60 3300032126 Ga0307415_100008031 Ga0307415_1000080313 78
61 3300035120 Ga0373957_0415766 Ga0373957_0415766_67_303 78
62 3300035172 Ga0373955_0855693 Ga0373955_0855693_157_393 78
63 3300035724 Ga0373933_0690850 Ga0373933_0690850_318_554 78
64 3300036401 Ga0373937_0652800 Ga0373937_0652800_487_723 78
65 3300037418 Ga0395900_0989753 Ga0395900_0989753_168_416 78
66 3300037471 Ga0395905_0333515 Ga0395905_0333515_88_336 78
67 3300037471 Ga0395905_0462314 Ga0395905_0462314_639_887 78
68 3300039437 Ga0436365_0165817 Ga0436365_0165817_879_1115 78
69 3300041459 Ga0451800_1378480 Ga0451800_1378480_256_492 78
70 3300041486 Ga0451807_0645985 Ga0451807_0645985_214_450 78
71 3300041512 Ga0451853_0965615 Ga0451853_0965615_356_598 78
72 3300047472 Ga0495686_0016372 Ga0495686_0016372_3381_3626 78
73 3300049129 Ga0501309_030216 Ga0501309_030216_540_776 78
74 3300049519 Ga0501296_028447 Ga0501296_028447_190_426 78
75 3300049570 Ga0501033_0217226 Ga0501033_0217226_370_612 78
76 3300049571 Ga0501034_0280677 Ga0501034_0280677_554_790 78
77 3300049578 Ga0501042_0844144 Ga0501042_0844144_329_580 78
78 3300049579 Ga0501043_0334284 Ga0501043_0334284_466_711 78
79 3300049580 Ga0501046_0161519 Ga0501046_0161519_1201_1449 78
80 3300049581 Ga0501047_0011569 Ga0501047_0011569_5067_5315 78
81 3300049581 Ga0501047_0092577 Ga0501047_0092577_2138_2383 78
82 3300049583 Ga0501067_0044053 Ga0501067_0044053_760_996 78
83 3300049584 Ga0501068_0045228 Ga0501068_0045228_437_673 78
84 3300049585 Ga0501069_0018839 Ga0501069_0018839_1535_1771 78
85 3300049586 Ga0501070_0015727 Ga0501070_0015727_2208_2450 78
86 3300049586 Ga0501070_0535518 Ga0501070_0535518_464_700 78
87 3300049586 Ga0501070_0818524 Ga0501070_0818524_439_687 78
88 3300049587 Ga0501071_0166302 Ga0501071_0166302_62_298 78
89 3300049588 Ga0501072_0069780 Ga0501072_0069780_2434_2670 78
90 3300049589 Ga0501073_0249907 Ga0501073_0249907_366_602 78
91 3300049590 Ga0501074_0096649 Ga0501074_0096649_1075_1311 78
92 3300049590 Ga0501074_0253396 Ga0501074_0253396_303_548 78
93 3300049661 Ga0501217_134312 Ga0501217_134312_252_488 78
94 3300049665 Ga0501227_010219 Ga0501227_010219_1116_1352 78
95 3300049742 Ga0501080_0153123 Ga0501080_0153123_1523_1759 78
96 3300049742 Ga0501080_0438952 Ga0501080_0438952_917_1159 78
97 3300049822 Ga0501035_1044589 Ga0501035_1044589_318_569 78
98 3300049823 Ga0501044_0012559 Ga0501044_0012559_3623_3871 78
99 3300053084 Ga0495595_0411221 Ga0495595_0411221_343_579 78
100 3300053139 Ga0500568_0024318 Ga0500568_0024318_769_1008 78
101 3300060353 Ga0501082_0065139 Ga0501082_0065139_971_1207 78
102 3300005334 Ga0068869_100210606 Ga0068869_1002106063 79
103 3300005336 Ga0070680_100831510 Ga0070680_1008315101 79
104 3300005340 Ga0070689_100506327 Ga0070689_1005063272 79
105 3300005468 Ga0070707_100620237 Ga0070707_1006202372 79
106 3300005548 Ga0070665_100525455 Ga0070665_1005254552 79
107 3300006028 Ga0070717_10014533 Ga0070717_100145333 79
108 3300006871 Ga0075434_100897605 Ga0075434_1008976052 79
109 3300007076 Ga0075435_100156529 Ga0075435_1001565292 79
110 3300021384 Ga0213876_10012931 Ga0213876_100129313 79
111 3300025917 Ga0207660_10184099 Ga0207660_101840992 79
112 3300025918 Ga0207662_10116022 Ga0207662_101160222 79
113 3300025922 Ga0207646_10638908 Ga0207646_106389081 79
114 3300025936 Ga0207670_10328540 Ga0207670_103285402 79
115 3300025942 Ga0207689_10152855 Ga0207689_101528553 79
116 3300026023 Ga0207677_11870453 Ga0207677_118704531 79
117 3300031344 Ga0265316_10643603 Ga0265316_106436032 79
118 3300039437 Ga0436365_1105624 Ga0436365_1105624_1807_2055 79
119 3300039450 Ga0436363_0373271 Ga0436363_0373271_275_523 79
120 3300041512 Ga0451853_1349847 Ga0451853_1349847_365_607 79
121 3300041512 Ga0451853_1349847 Ga0451853_1349847_689_931 79
122 3300044706 Ga0466964_0485856 Ga0466964_0485856_358_603 79
123 3300044842 Ga0466957_1388577 Ga0466957_1388577_82_327 79
124 3300045051 Ga0451576_0465974 Ga0451576_0465974_360_638 79
125 3300045976 Ga0466967_0165702 Ga0466967_0165702_1720_1965 79
126 3300050510 nmdc:mga06r32_306485_c1 nmdc:mga06r32_306485_c1_433_675 79
127 3300050513 nmdc:mga0rr50_87975_c1 nmdc:mga0rr50_87975_c1_1805_2050 79
128 3300050514 nmdc:mga08x19_395132_c1 nmdc:mga08x19_395132_c1_699_944 79
129 3300005327 Ga0070658_10775842 Ga0070658_107758421 80
130 3300005356 Ga0070674_100075469 Ga0070674_1000754692 80
131 3300005456 Ga0070678_100017834 Ga0070678_1000178343 80
132 3300005459 Ga0068867_102058500 Ga0068867_1020585001 80
133 3300006847 Ga0075431_100154439 Ga0075431_1001544392 80
134 3300006847 Ga0075431_101135410 Ga0075431_1011354101 80
135 3300006880 Ga0075429_100036758 Ga0075429_1000367582 80
136 3300013296 Ga0157374_10027307 Ga0157374_100273073 80
137 3300013297 Ga0157378_12426855 Ga0157378_124268551 80
138 3300014969 Ga0157376_13010890 Ga0157376_130108901 80
139 3300025898 Ga0207692_10320883 Ga0207692_103208831 80
140 3300025909 Ga0207705_10725554 Ga0207705_107255542 80
141 3300026121 Ga0207683_10022721 Ga0207683_100227215 80
142 3300031711 Ga0265314_10488071 Ga0265314_104880711 80
143 3300049130 Ga0501310_051343 Ga0501310_051343_64_312 80
144 3300049571 Ga0501034_0142573 Ga0501034_0142573_534_776 80
145 3300049573 Ga0501037_0703748 Ga0501037_0703748_164_406 80
146 3300049582 Ga0501048_0452558 Ga0501048_0452558_29_271 80
147 3300049586 Ga0501070_0033386 Ga0501070_0033386_458_700 80
148 3300049679 Ga0501249_108496 Ga0501249_108496_132_374 80
149 3300049823 Ga0501044_0097229 Ga0501044_0097229_151_393 80
150 3300050508 nmdc:mga09592_1094091_c1 nmdc:mga09592_1094091_c1_43_288 80
151 3300050508 nmdc:mga09592_44635_c1 nmdc:mga09592_44635_c1_2505_2756 80
152 3300050509 nmdc:mga0qj67_701910_c1 nmdc:mga0qj67_701910_c1_255_500 80
153 3300050510 nmdc:mga06r32_1043197_c1 nmdc:mga06r32_1043197_c1_300_545 80
154 3300050510 nmdc:mga06r32_140686_c1 nmdc:mga06r32_140686_c1_1143_1394 80
155 3300006237 Ga0097621_102118917 Ga0097621_1021189171 81
156 3300006846 Ga0075430_100411375 Ga0075430_1004113752 81
157 3300006847 Ga0075431_100745455 Ga0075431_1007454552 81
158 3300006847 Ga0075431_101332167 Ga0075431_1013321671 81
159 3300006880 Ga0075429_100053528 Ga0075429_1000535283 81
160 3300009094 Ga0111539_11626246 Ga0111539_116262462 81
161 3300009147 Ga0114129_10780384 Ga0114129_107803842 81
162 3300009147 Ga0114129_10811060 Ga0114129_108110602 81
163 3300009147 Ga0114129_10931441 Ga0114129_109314411 81
164 3300009147 Ga0114129_12599968 Ga0114129_125999681 81
165 3300009147 Ga0114129_13453886 Ga0114129_134538861 81
166 3300031507 Ga0307509_10015692 Ga0307509_1001569211 81
167 3300033179 Ga0307507_10400224 Ga0307507_104002242 81
168 3300046471 Ga0495650_0086654 Ga0495650_0086654_238_492 81
169 3300049516 Ga0501293_002848 Ga0501293_002848_555_800 81
170 3300049519 Ga0501296_022771 Ga0501296_022771_125_370 81
171 3300049521 Ga0501298_034317 Ga0501298_034317_556_801 81
172 3300049522 Ga0501299_033081 Ga0501299_033081_554_799 81
173 3300049652 Ga0501202_037187 Ga0501202_037187_203_448 81
174 3300049654 Ga0501207_016882 Ga0501207_016882_197_442 81
175 3300049657 Ga0501210_024966 Ga0501210_024966_147_392 81
176 3300049659 Ga0501214_054220 Ga0501214_054220_127_372 81
177 3300049660 Ga0501216_001132 Ga0501216_001132_243_488 81
178 3300049661 Ga0501217_057708 Ga0501217_057708_353_598 81
179 3300049663 Ga0501223_048358 Ga0501223_048358_385_630 81
180 3300049665 Ga0501227_000057 Ga0501227_000057_10712_10957 81
181 3300049667 Ga0501230_006176 Ga0501230_006176_1067_1312 81
182 3300049668 Ga0501233_003463 Ga0501233_003463_2296_2541 81
183 3300049670 Ga0501236_014062 Ga0501236_014062_134_379 81
184 3300049672 Ga0501239_034933 Ga0501239_034933_303_548 81
185 3300049704 Ga0501221_005116 Ga0501221_005116_1292_1537 81
186 3300049705 Ga0501225_0025662 Ga0501225_0025662_1081_1326 81
187 3300049707 Ga0501234_029951 Ga0501234_029951_163_408 81
188 3300049852 Ga0501220_03822 Ga0501220_03822_192_437 81
189 3300050507 nmdc:mga05p37_2023871_c1 nmdc:mga05p37_2023871_c1_57_311 81
190 3300050508 nmdc:mga09592_1173702_c1 nmdc:mga09592_1173702_c1_245_499 81
191 3300050508 nmdc:mga09592_149351_c1 nmdc:mga09592_149351_c1_537_794 81
192 3300050510 nmdc:mga06r32_1259099_c1 nmdc:mga06r32_1259099_c1_220_474 81
193 3300050510 nmdc:mga06r32_1747431_c1 nmdc:mga06r32_1747431_c1_15_269 81
194 3300050510 nmdc:mga06r32_502807_c1 nmdc:mga06r32_502807_c1_514_771 81
195 3300004803 Ga0058862_12716050 Ga0058862_127160501 82
196 3300005327 Ga0070658_10399652 Ga0070658_103996522 82
197 3300005329 Ga0070683_101760382 Ga0070683_1017603821 82
198 3300005334 Ga0068869_100027306 Ga0068869_1000273062 82
199 3300005336 Ga0070680_100345252 Ga0070680_1003452522 82
200 3300005336 Ga0070680_101662161 Ga0070680_1016621612 82
201 3300005337 Ga0070682_101323106 Ga0070682_1013231062 82
202 3300005340 Ga0070689_100050359 Ga0070689_1000503593 82
203 3300005434 Ga0070709_10568627 Ga0070709_105686272 82
204 3300005440 Ga0070705_100039360 Ga0070705_1000393602 82
205 3300005456 Ga0070678_100659398 Ga0070678_1006593981 82
206 3300005458 Ga0070681_10279834 Ga0070681_102798342 82
207 3300005530 Ga0070679_100036923 Ga0070679_1000369232 82
208 3300005535 Ga0070684_100257084 Ga0070684_1002570842 82
209 3300005536 Ga0070697_100869003 Ga0070697_1008690031 82
210 3300005548 Ga0070665_100035471 Ga0070665_1000354714 82
211 3300005563 Ga0068855_100628773 Ga0068855_1006287732 82
212 3300005577 Ga0068857_100475181 Ga0068857_1004751811 82
213 3300005614 Ga0068856_100052209 Ga0068856_1000522092 82
214 3300005616 Ga0068852_100110107 Ga0068852_1001101074 82
215 3300005617 Ga0068859_101855139 Ga0068859_1018551392 82
216 3300005834 Ga0068851_10089106 Ga0068851_100891062 82
217 3300005842 Ga0068858_100360785 Ga0068858_1003607852 82
218 3300005937 Ga0081455_10152005 Ga0081455_101520052 82
219 3300006931 Ga0097620_101855099 Ga0097620_1018550991 82
220 3300009093 Ga0105240_10655138 Ga0105240_106551382 82
221 3300009098 Ga0105245_10000015 Ga0105245_1000001586 82
222 3300009174 Ga0105241_12181877 Ga0105241_121818771 82
223 3300009551 Ga0105238_10248325 Ga0105238_102483252 82
224 3300009553 Ga0105249_12832826 Ga0105249_128328261 82
225 3300010375 Ga0105239_10417520 Ga0105239_104175201 82
226 3300011119 Ga0105246_10192663 Ga0105246_101926632 82
227 3300013296 Ga0157374_10271564 Ga0157374_102715642 82
228 3300014969 Ga0157376_10168187 Ga0157376_101681872 82
229 3300014969 Ga0157376_10377288 Ga0157376_103772882 82
230 3300025906 Ga0207699_10227580 Ga0207699_102275802 82
231 3300025912 Ga0207707_10143806 Ga0207707_101438062 82
232 3300025913 Ga0207695_11280785 Ga0207695_112807851 82
233 3300025917 Ga0207660_10208192 Ga0207660_102081922 82
234 3300025917 Ga0207660_11526542 Ga0207660_115265422 82
235 3300025918 Ga0207662_10055050 Ga0207662_100550502 82
236 3300025921 Ga0207652_10023287 Ga0207652_100232872 82
237 3300025927 Ga0207687_10002702 Ga0207687_100027028 82
238 3300025936 Ga0207670_10087519 Ga0207670_100875192 82
239 3300025942 Ga0207689_10053573 Ga0207689_100535732 82
240 3300025949 Ga0207667_10554876 Ga0207667_105548762 82
241 3300026075 Ga0207708_10207325 Ga0207708_102073253 82
242 3300026078 Ga0207702_10077391 Ga0207702_100773913 82
243 3300026089 Ga0207648_11013959 Ga0207648_110139591 82
244 3300026142 Ga0207698_10766218 Ga0207698_107662181 82
245 3300028379 Ga0268266_10004793 Ga0268266_100047934 82
246 3300028379 Ga0268266_10620884 Ga0268266_106208842 82
247 3300028380 Ga0268265_10717399 Ga0268265_107173991 82
248 3300028794 Ga0307515_10391303 Ga0307515_103913032 82
249 3300030521 Ga0307511_10124602 Ga0307511_101246022 82
250 3300031507 Ga0307509_10535207 Ga0307509_105352072 82
251 3300031616 Ga0307508_10076715 Ga0307508_100767152 82
252 3300033179 Ga0307507_10031913 Ga0307507_100319133 82
253 3300039450 Ga0436363_0657787 Ga0436363_0657787_17_274 82
254 3300041507 Ga0451851_0414308 Ga0451851_0414308_189_440 82
255 3300041512 Ga0451853_2804491 Ga0451853_2804491_300_557 82
256 3300048918 Ga0496115_0172021 Ga0496115_0172021_795_1046 82
257 3300053150 Ga0500603_009226 Ga0500603_009226_826_1077 82
258 3300053162 Ga0500638_074959 Ga0500638_074959_56_304 82
259 3300053177 Ga0500636_0055747 Ga0500636_0055747_100_351 82
260 3300005367 Ga0070667_100437221 Ga0070667_1004372211 83
261 3300005617 Ga0068859_100084894 Ga0068859_1000848945 83
262 3300006881 Ga0068865_100031674 Ga0068865_1000316742 83
263 3300006931 Ga0097620_100084895 Ga0097620_1000848955 83
264 3300009551 Ga0105238_11645093 Ga0105238_116450931 83
265 3300025899 Ga0207642_10788954 Ga0207642_107889541 83
266 3300025924 Ga0207694_11096224 Ga0207694_110962241 83
267 3300025938 Ga0207704_10035616 Ga0207704_100356162 83
268 3300028794 Ga0307515_10052134 Ga0307515_100521345 83
269 3300031456 Ga0307513_10011182 Ga0307513_100111824 83
270 3300031507 Ga0307509_10547152 Ga0307509_105471521 83
271 3300035113 Ga0373936_0000002 Ga0373936_0000002_40713_40970 83
272 3300053130 Ga0500642_0064335 Ga0500642_0064335_972_1223 83
273 3300053159 Ga0500630_051518 Ga0500630_051518_1277_1528 83
274 3300003323 rootH1_10168042 rootH1_101680423 84
275 3300004800 Ga0058861_11980788 Ga0058861_119807881 84
276 3300004801 Ga0058860_10039270 Ga0058860_100392702 84
277 3300004801 Ga0058860_10107444 Ga0058860_101074441 84
278 3300005330 Ga0070690_100003058 Ga0070690_10000305810 84
279 3300005330 Ga0070690_100923810 Ga0070690_1009238101 84
280 3300005334 Ga0068869_100076333 Ga0068869_1000763331 84
281 3300005340 Ga0070689_100117948 Ga0070689_1001179483 84
282 3300005365 Ga0070688_100059301 Ga0070688_1000593012 84
283 3300005365 Ga0070688_100257044 Ga0070688_1002570441 84
284 3300005365 Ga0070688_100378461 Ga0070688_1003784612 84
285 3300005434 Ga0070709_10093347 Ga0070709_100933473 84
286 3300005458 Ga0070681_10599627 Ga0070681_105996272 84
287 3300005466 Ga0070685_11070210 Ga0070685_110702101 84
288 3300005615 Ga0070702_100303562 Ga0070702_1003035621 84
289 3300005617 Ga0068859_100735493 Ga0068859_1007354932 84
290 3300005618 Ga0068864_101020581 Ga0068864_1010205811 84
291 3300005719 Ga0068861_100436531 Ga0068861_1004365312 84
292 3300005841 Ga0068863_100050082 Ga0068863_1000500822 84
293 3300005843 Ga0068860_100264934 Ga0068860_1002649342 84
294 3300005844 Ga0068862_100353614 Ga0068862_1003536141 84
295 3300006881 Ga0068865_101020977 Ga0068865_1010209772 84
296 3300006931 Ga0097620_100735502 Ga0097620_1007355022 84
297 3300009553 Ga0105249_10391740 Ga0105249_103917402 84
298 3300009553 Ga0105249_11827795 Ga0105249_118277952 84
299 3300013297 Ga0157378_10024023 Ga0157378_100240236 84
300 3300025912 Ga0207707_10397904 Ga0207707_103979042 84
301 3300025918 Ga0207662_10764331 Ga0207662_107643311 84
302 3300025935 Ga0207709_10445222 Ga0207709_104452221 84
303 3300025942 Ga0207689_10058451 Ga0207689_100584512 84
304 3300025944 Ga0207661_10108076 Ga0207661_101080762 84
305 3300025961 Ga0207712_10450071 Ga0207712_104500712 84
306 3300026035 Ga0207703_11670417 Ga0207703_116704171 84
307 3300026088 Ga0207641_10034957 Ga0207641_100349575 84
308 3300026088 Ga0207641_10348123 Ga0207641_103481232 84
309 3300026089 Ga0207648_10869329 Ga0207648_108693292 84
310 3300026118 Ga0207675_100436867 Ga0207675_1004368672 84
311 3300028381 Ga0268264_10962856 Ga0268264_109628562 84
312 3300028786 Ga0307517_10031396 Ga0307517_100313961 84
313 3300031238 Ga0265332_10007011 Ga0265332_100070112 84
314 3300031507 Ga0307509_10000143 Ga0307509_1000014322 84
315 3300031507 Ga0307509_10624277 Ga0307509_106242772 84
316 3300031616 Ga0307508_10303295 Ga0307508_103032952 84
317 3300031730 Ga0307516_10165800 Ga0307516_101658002 84
318 3300035119 Ga0373956_0361512 Ga0373956_0361512_380_640 84
319 3300035241 Ga0373961_0000101 Ga0373961_0000101_15511_15771 84
320 3300053080 Ga0500635_0100766 Ga0500635_0100766_140_406 84
321 3300053086 Ga0500578_0042576 Ga0500578_0042576_767_1033 84
322 3300053086 Ga0500578_0339916 Ga0500578_0339916_141_404 84
323 3300053088 Ga0500644_0316567 Ga0500644_0316567_268_531 84
324 3300053090 Ga0500646_0046535 Ga0500646_0046535_554_817 84
325 3300053094 Ga0500566_0030924 Ga0500566_0030924_437_703 84
326 3300053095 Ga0500640_002596 Ga0500640_002596_3827_4108 84
327 3300053102 Ga0500554_000707 Ga0500554_000707_2899_3180 84
328 3300053108 Ga0500562_078021 Ga0500562_078021_384_647 84
329 3300053111 Ga0500572_002772 Ga0500572_002772_171_452 84
330 3300053119 Ga0500595_000397 Ga0500595_000397_16145_16426 84
331 3300053123 Ga0500614_000348 Ga0500614_000348_11606_11887 84
332 3300053126 Ga0500621_125508 Ga0500621_125508_20_283 84
333 3300053127 Ga0500623_250641 Ga0500623_250641_202_468 84
334 3300053136 Ga0500559_0009503 Ga0500559_0009503_2769_3050 84
335 3300053138 Ga0500564_040876 Ga0500564_040876_1823_2089 84
336 3300053143 Ga0500579_189016 Ga0500579_189016_502_765 84
337 3300053144 Ga0500585_045104 Ga0500585_045104_245_511 84
338 3300053150 Ga0500603_002866 Ga0500603_002866_3335_3601 84
339 3300053156 Ga0500622_0025283 Ga0500622_0025283_1749_2012 84
340 3300053178 Ga0500637_0182590 Ga0500637_0182590_680_961 84
341 3300053737 Ga0500601_004992 Ga0500601_004992_1005_1286 84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dgl-assembly1.cif.gz_C crystal structure of the rdfs excisionase 0.8516 1 55
8dgl-assembly1.cif.gz_B crystal structure of the rdfs excisionase 0.8402 1 56
8g4u-assembly2.cif.gz_C final ketosynthase+acyltransferase of the erythromycin modular polyketide synthase 0.8297 41 60
7lw0-assembly1.cif.gz_A structural and biochemical insight into assembly of molecular motors involved in viral dna packaging 0.7746 4 56
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.7547 1 52
ID Description Score Start End Superfamily
af_O53399_195_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7918 5 56 1.10.10.10
af_O53399_195_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7665 5 56 1.10.10.10
5d8cA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.7135 6 65 1.10.1660.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.7126 4 62 1.10.1660.10
af_Q569B5_1_167_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.7077 45 70 1.25.40.20
ID Description Score Start End GO Terms
AF-A0A7V9TXY8-F1-model_v4 Helix-turn-helix domain-containing protein 0.9621 3 62
AF-A0A517YPS1-F1-model_v4 Helix-turn-helix domain protein 0.9395 2 62
AF-A0A3A4ZIN2-F1-model_v4 DNA-binding protein 0.934 4 57 GO:0003677
AF-A0A0M2ASP5-F1-model_v4 deleted 0.9309 7 55
AF-A0A1L7CXG2-F1-model_v4 Helix-turn-helix domain-containing protein 0.9307 1 56 GO:0003677

Feature Viewer

pLDDT pTM Quality
77.06 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map