F414449

General Info

Members Datasets Scaffolds Average Seq Length
340 237 329 157

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0410728|Ga0453684_0410728_181_711
Length 176
Sequence MTLQIASSLGKQSRIQLLNMDKHFIGVISDTHGLLRAEAVEALKGSNLIIHAGDVGKPEVLKALKQIAPVVAIRGNIDKGAWCQSMPLTETVEIGKIRFYVLHKLAGLDLDPAAAGFTCVIYGDSHQPSLETRNGVIFLNPGSAGPRRFKLPVSVAMIEVHGNTIKPKLIELTIES

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
3 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
4 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
5 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
6 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
7 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
8 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
9 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
10 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
11 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
75 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
76 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
77 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
109 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
110 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
159 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
234 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
235 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
236 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 4.12
Rhizoplane 13.53
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10083581 3300005288 Bacteria 2242
2 Ga0065704_10043202 3300005289 Unclassified 1198
3 Ga0065715_10004267 3300005293 Bacteria 4674
4 Ga0065707_10123090 3300005295 Bacteria 2046
5 Ga0070670_100114112 3300005331 Bacteria 2329
6 Ga0068869_100223702 3300005334 Bacteria 1493
7 Ga0068869_100480154 3300005334 Bacteria 1035
8 Ga0070680_101544925 3300005336 Bacteria 575
9 Ga0070668_100918761 3300005347 Bacteria 783
10 Ga0070669_100416768 3300005353 Unclassified 1101
11 Ga0070675_100066145 3300005354 Bacteria 2989
12 Ga0070675_100942033 3300005354 Bacteria 792
13 Ga0070671_100087138 3300005355 Bacteria 2613
14 Ga0070674_100047933 3300005356 Bacteria 2930
15 Ga0070673_100425946 3300005364 Unclassified 1190
16 Ga0070667_101425538 3300005367 Bacteria 650
17 Ga0070703_10008485 3300005406 Unclassified 2890
18 Ga0070709_10047723 3300005434 Bacteria 2669
19 Ga0070714_100029184 3300005435 Bacteria 4584
20 Ga0070713_100078762 3300005436 Bacteria 2806
21 Ga0070713_101892538 3300005436 Bacteria 579
22 Ga0070710_10186939 3300005437 Bacteria 1300
23 Ga0070700_100263682 3300005441 Unclassified 1242
24 Ga0070694_100835994 3300005444 Unclassified 757
25 Ga0070708_100050380 3300005445 Bacteria 3687
26 Ga0070708_100380381 3300005445 Bacteria 1331
27 Ga0070708_100655379 3300005445 Unclassified 989
28 Ga0070681_10482439 3300005458 Bacteria 1152
29 Ga0070681_10497003 3300005458 Bacteria 1133
30 Ga0070706_100013561 3300005467 Bacteria 7535
31 Ga0070706_100170421 3300005467 Bacteria 2032
32 Ga0070707_100480822 3300005468 Bacteria 1203
33 Ga0070698_101299535 3300005471 Bacteria 677
34 Ga0070699_100133593 3300005518 Bacteria 2188
35 Ga0070699_100768786 3300005518 Bacteria 881
36 Ga0070699_101194341 3300005518 Bacteria 698
37 Ga0070679_100543895 3300005530 Unclassified 1105
38 Ga0070697_100020738 3300005536 Bacteria 5203
39 Ga0070695_100091235 3300005545 Unclassified 2034
40 Ga0070695_100422288 3300005545 Bacteria 1015
41 Ga0070695_100619725 3300005545 Bacteria 851
42 Ga0070696_100411094 3300005546 Bacteria 1060
43 Ga0070665_101029901 3300005548 Unclassified 835
44 Ga0070704_100002695 3300005549 Bacteria 10040
45 Ga0070704_100939849 3300005549 Bacteria 779
46 Ga0070664_100161936 3300005564 Bacteria 1980
47 Ga0068859_100280150 3300005617 Bacteria 1760
48 Ga0068864_100324492 3300005618 Unclassified 1447
49 Ga0068870_10106842 3300005840 Bacteria 1591
50 Ga0068860_100587890 3300005843 Bacteria 1118
51 Ga0068862_100219014 3300005844 Bacteria 1722
52 Ga0081455_10366804 3300005937 Bacteria 1011
53 Ga0081539_10075959 3300005985 Bacteria 1782
54 Ga0070717_10032628 3300006028 Bacteria 4198
55 Ga0070717_10961196 3300006028 Unclassified 778
56 Ga0075365_10048152 3300006038 Bacteria 2805
57 Ga0075365_10175501 3300006038 Bacteria 1497
58 Ga0070715_10029142 3300006163 Bacteria 2221
59 Ga0075431_100033085 3300006847 Bacteria 5328
60 Ga0075434_100005665 3300006871 Bacteria 11396
61 Ga0097620_100280152 3300006931 Bacteria 1760
62 Ga0097620_100494729 3300006931 Bacteria 1318
63 Ga0099824_1020287 3300006942 Bacteria 4938
64 Ga0075435_100101266 3300007076 Bacteria 2387
65 Ga0075435_100674385 3300007076 Bacteria 898
66 Ga0075435_101880917 3300007076 Bacteria 525
67 Ga0099794_10012609 3300007265 Bacteria 3653
68 Ga0105240_10002656 3300009093 Bacteria 28449
69 Ga0111539_10100652 3300009094 Unclassified 3393
70 Ga0111539_10178139 3300009094 Bacteria 2483
71 Ga0111539_10300985 3300009094 Bacteria 1866
72 Ga0105245_10852052 3300009098 Bacteria 951
73 Ga0105247_10033892 3300009101 Bacteria 3108
74 Ga0114129_10006769 3300009147 Bacteria 16269
75 Ga0114129_12410476 3300009147 Bacteria 630
76 Ga0105248_10666569 3300009177 Bacteria 1174
77 Ga0105237_10001323 3300009545 Bacteria 32852
78 Ga0157374_10694814 3300013296 Bacteria 1030
79 Ga0163162_10401917 3300013306 Bacteria 1502
80 Ga0157375_10031179 3300013308 Bacteria 5035
81 Ga0157375_11924354 3300013308 Bacteria 702
82 Ga0163163_10059897 3300014325 Bacteria 3768
83 Ga0163163_10061947 3300014325 Bacteria 3707
84 Ga0157380_10064766 3300014326 Bacteria 2935
85 Ga0157380_10320866 3300014326 Unclassified 1436
86 Ga0214544_1000004 3300021320 Bacteria 455869
87 Ga0214542_1000001 3300021321 Bacteria 1018696
88 Ga0214542_1047691 3300021321 Bacteria 886
89 Ga0214545_1000001 3300021324 Bacteria 1092817
90 Ga0214545_1048704 3300021324 Bacteria 886
91 Ga0214543_1000006 3300021327 Bacteria 443395
92 Ga0214543_1048555 3300021327 Bacteria 886
93 Ga0213874_10020931 3300021377 Bacteria 1798
94 Ga0213874_10234561 3300021377 Bacteria 671
95 Ga0207697_10091196 3300025315 Unclassified 1291
96 Ga0207653_10014959 3300025885 Unclassified 2435
97 Ga0207682_10026454 3300025893 Unclassified 2307
98 Ga0207692_10622498 3300025898 Bacteria 695
99 Ga0207688_10019569 3300025901 Bacteria 3690
100 Ga0207699_10056822 3300025906 Bacteria 2334
101 Ga0207643_10014573 3300025908 Bacteria 4273
102 Ga0207684_10023749 3300025910 Bacteria 5233
103 Ga0207684_10074011 3300025910 Bacteria 2893
104 Ga0207707_10158040 3300025912 Bacteria 1982
105 Ga0207707_10419201 3300025912 Bacteria 1148
106 Ga0207707_10480333 3300025912 Unclassified 1061
107 Ga0207695_10005488 3300025913 Bacteria 16786
108 Ga0207671_10026733 3300025914 Bacteria 4320
109 Ga0207652_10980638 3300025921 Unclassified 743
110 Ga0207646_10443730 3300025922 Bacteria 1171
111 Ga0207681_10908122 3300025923 Unclassified 738
112 Ga0207650_10007215 3300025925 Bacteria 7575
113 Ga0207659_10967021 3300025926 Bacteria 732
114 Ga0207700_11532916 3300025928 Bacteria 591
115 Ga0207664_10096537 3300025929 Bacteria 2433
116 Ga0207644_10432066 3300025931 Bacteria 1080
117 Ga0207690_10619173 3300025932 Bacteria 885
118 Ga0207670_10078485 3300025936 Bacteria 2303
119 Ga0207691_10011990 3300025940 Bacteria 8315
120 Ga0207679_10533881 3300025945 Bacteria 1051
121 Ga0207651_10036083 3300025960 Bacteria 3223
122 Ga0207651_11157300 3300025960 Bacteria 694
123 Ga0207668_11408787 3300025972 Bacteria 628
124 Ga0207703_11053132 3300026035 Bacteria 781
125 Ga0207708_10067947 3300026075 Unclassified 2727
126 Ga0207702_10388491 3300026078 Bacteria 1343
127 Ga0207676_10720066 3300026095 Unclassified 968
128 Ga0209389_1000010 3300027296 Bacteria 223892
129 Ga0209589_1000016 3300027357 Bacteria 223788
130 Ga0209489_100016 3300027361 Bacteria 223873
131 Ga0209588_1094950 3300027671 Unclassified 960
132 Ga0268266_10314545 3300028379 Bacteria 1464
133 Ga0268265_10356000 3300028380 Unclassified 1338
134 Ga0268265_10813433 3300028380 Bacteria 912
135 Ga0265325_10213156 3300031241 Bacteria 886
136 Ga0265329_10015354 3300031242 Bacteria 2676
137 Ga0265340_10002096 3300031247 Bacteria 11429
138 Ga0265339_10001221 3300031249 Bacteria 19322
139 Ga0265331_10039798 3300031250 Bacteria 2290
140 Ga0307408_100039522 3300031548 Bacteria 3336
141 Ga0316579_10220108 3300031691 Bacteria 918
142 Ga0265314_10057626 3300031711 Bacteria 2666
143 Ga0265342_10000035 3300031712 Bacteria 142886
144 Ga0307405_10626784 3300031731 Unclassified 881
145 Ga0307405_11034123 3300031731 Bacteria 703
146 Ga0307410_10083541 3300031852 Bacteria 2249
147 Ga0307412_10096377 3300031911 Bacteria 2082
148 Ga0307412_10564787 3300031911 Bacteria 958
149 Ga0307416_100343709 3300032002 Bacteria 1506
150 Ga0316580_10116899 3300032139 Unclassified 816
151 Ga0373944_0235206 3300035089 Bacteria 672
152 Ga0373923_0019568 3300035111 Bacteria 2622
153 Ga0373936_0002195 3300035113 Bacteria 7281
154 Ga0373953_0020857 3300035117 Bacteria 2452
155 Ga0373953_0056169 3300035117 Bacteria 1600
156 Ga0373954_0001214 3300035118 Bacteria 10354
157 Ga0373954_0100520 3300035118 Bacteria 1395
158 Ga0373956_0070970 3300035119 Bacteria 1589
159 Ga0373957_0079887 3300035120 Bacteria 1290
160 Ga0373943_0014210 3300035170 Bacteria 3601
161 Ga0373943_0437976 3300035170 Bacteria 758
162 Ga0373946_0009915 3300035171 Bacteria 3521
163 Ga0373955_0004180 3300035172 Bacteria 6371
164 Ga0373955_0272991 3300035172 Bacteria 1016
165 Ga0373924_0006406 3300035410 Bacteria 4216
166 Ga0373924_0040718 3300035410 Bacteria 1903
167 Ga0373931_0119596 3300035691 Bacteria 1504
168 Ga0373935_0000980 3300035692 Bacteria 15499
169 Ga0373927_0008272 3300035695 Bacteria 7004
170 Ga0373933_0004767 3300035724 Bacteria 7411
171 Ga0373933_0245441 3300035724 Bacteria 1152
172 Ga0373947_0000492 3300035725 Bacteria 22784
173 Ga0373947_0116856 3300035725 Bacteria 1692
174 Ga0373947_0182582 3300035725 Bacteria 1366
175 Ga0373937_0003427 3300036401 Bacteria 13305
176 Ga0373937_0015179 3300036401 Bacteria 6806
177 Ga0373937_0657215 3300036401 Bacteria 994
178 Ga0316582_0132123 3300036647 Unclassified 1678
179 Ga0316584_0049591 3300036712 Bacteria 3138
180 Ga0316584_0103041 3300036712 Bacteria 2137
181 Ga0373925_0000018 3300037068 Bacteria 174213
182 Ga0395900_0001701 3300037418 Bacteria 25525
183 Ga0395900_0040641 3300037418 Bacteria 4793
184 Ga0395898_0007735 3300037466 Bacteria 11412
185 Ga0395898_0794349 3300037466 Bacteria 887
186 Ga0436364_0305538 3300037853 Bacteria 1785
187 Ga0395901_0014195 3300038443 Bacteria 8109
188 Ga0395901_0075186 3300038443 Bacteria 3524
189 Ga0436365_0693216 3300039437 Bacteria 924
190 Ga0436360_0669886 3300039438 Bacteria 23196
191 Ga0436361_0616781 3300039447 Bacteria 3394
192 Ga0436361_0827636 3300039447 Bacteria 6635
193 Ga0436363_0302347 3300039450 Bacteria 3373
194 Ga0436363_1185356 3300039450 Bacteria 2017
195 Ga0439431_0240712 3300041997 Unclassified 535
196 Ga0439449_0000980 3300042007 Bacteria 11230
197 Ga0439452_080847 3300042010 Bacteria 708
198 Ga0439457_016014 3300042014 Bacteria 1674
199 Ga0439462_0009597 3300042015 Bacteria 2447
200 Ga0466972_0013926 3300044658 Bacteria 4034
201 Ga0453684_0410728 3300044712 Bacteria 1514
202 Ga0466967_0535320 3300045976 Bacteria 1152
203 Ga0466967_0839715 3300045976 Bacteria 913
204 Ga0495592_0000001 3300046454 Bacteria 305819
205 Ga0495603_0224786 3300046455 Bacteria 1083
206 Ga0495629_0017298 3300046459 Bacteria 5170
207 Ga0495629_0058402 3300046459 Bacteria 2697
208 Ga0495651_0003294 3300046462 Bacteria 12396
209 Ga0495653_0000092 3300046463 Bacteria 74868
210 Ga0495582_0019402 3300046473 Bacteria 3717
211 Ga0495582_0571941 3300046473 Bacteria 654
212 Ga0495662_0087733 3300046476 Bacteria 1515
213 Ga0495662_0101030 3300046476 Bacteria 1411
214 Ga0495664_0000001 3300046477 Bacteria 757730
215 Ga0495594_0167248 3300046499 Bacteria 1251
216 Ga0495606_0038206 3300046507 Bacteria 3250
217 Ga0495608_0000050 3300046511 Bacteria 96603
218 Ga0495618_0000064 3300046514 Bacteria 77194
219 Ga0495618_0063985 3300046514 Bacteria 2337
220 Ga0495628_0000003 3300046516 Bacteria 470339
221 Ga0495630_0010199 3300046517 Bacteria 6776
222 Ga0495630_0338431 3300046517 Bacteria 1151
223 Ga0495652_0000001 3300046529 Bacteria 1045081
224 Ga0495640_0000006 3300046533 Bacteria 285419
225 Ga0495640_0220587 3300046533 Bacteria 1196
226 Ga0495640_0763327 3300046533 Bacteria 578
227 Ga0495587_0000028 3300046536 Bacteria 138663
228 Ga0495645_0000004 3300046543 Bacteria 532661
229 Ga0495667_0000001 3300046559 Bacteria 834831
230 Ga0495634_0002741 3300046642 Bacteria 14488
231 Ga0495635_0000015 3300046663 Bacteria 215468
232 Ga0495635_0351711 3300046663 Bacteria 983
233 Ga0495657_0000155 3300046675 Bacteria 62116
234 Ga0495599_0000029 3300046678 Bacteria 113803
235 Ga0495623_0002458 3300046679 Bacteria 12295
236 Ga0495646_0000006 3300046680 Bacteria 258496
237 Ga0495658_0071959 3300046683 Bacteria 2010
238 Ga0495658_0432780 3300046683 Bacteria 840
239 Ga0495613_0079093 3300046689 Bacteria 2391
240 Ga0495613_0929796 3300046689 Bacteria 561
241 Ga0495624_0120326 3300046690 Bacteria 1612
242 Ga0495624_0311550 3300046690 Bacteria 948
243 Ga0495600_0000286 3300046809 Bacteria 27213
244 Ga0495581_0063516 3300047315 Bacteria 2134
245 Ga0495581_0763769 3300047315 Bacteria 556
246 Ga0495604_0000091 3300047317 Bacteria 77216
247 Ga0495674_0000001 3300047319 Bacteria 778665
248 Ga0495676_0656813 3300047321 Bacteria 680
249 Ga0495680_0021652 3300047322 Bacteria 5377
250 Ga0495680_0369237 3300047322 Bacteria 996
251 Ga0495683_0164951 3300047323 Bacteria 1022
252 Ga0495675_0000839 3300047444 Bacteria 18796
253 Ga0495684_0000055 3300047471 Bacteria 79796
254 Ga0495684_0065427 3300047471 Bacteria 2764
255 Ga0495593_0004124 3300047673 Bacteria 8643
256 Ga0495593_0056083 3300047673 Bacteria 2072
257 Ga0495602_0000002 3300048088 Bacteria 422216
258 Ga0495614_0057462 3300048089 Bacteria 1671
259 Ga0496100_0421571 3300048903 Bacteria 1019
260 Ga0496101_0045847 3300048904 Bacteria 3133
261 Ga0496101_0287762 3300048904 Bacteria 1285
262 Ga0496102_0171619 3300048905 Bacteria 2041
263 Ga0496102_0221457 3300048905 Bacteria 1784
264 Ga0496102_0763511 3300048905 Bacteria 890
265 Ga0496103_0079194 3300048906 Bacteria 2064
266 Ga0496104_0000383 3300048907 Bacteria 38697
267 Ga0496104_0012302 3300048907 Bacteria 7693
268 Ga0496104_0012711 3300048907 Bacteria 7582
269 Ga0496104_0033664 3300048907 Bacteria 4776
270 Ga0496104_0260229 3300048907 Bacteria 1648
271 Ga0496104_1090362 3300048907 Bacteria 702
272 Ga0496105_0019451 3300048908 Bacteria 5477
273 Ga0496105_0046211 3300048908 Bacteria 3594
274 Ga0496105_0050612 3300048908 Bacteria 3432
275 Ga0496105_0054161 3300048908 Bacteria 3313
276 Ga0496106_0044785 3300048909 Bacteria 3322
277 Ga0496106_0217139 3300048909 Bacteria 1524
278 Ga0496106_0309982 3300048909 Bacteria 1266
279 Ga0496107_0015334 3300048910 Bacteria 5370
280 Ga0496108_0015685 3300048911 Bacteria 6180
281 Ga0496108_0085371 3300048911 Bacteria 2679
282 Ga0496108_0664816 3300048911 Bacteria 905
283 Ga0496109_0018139 3300048912 Bacteria 6180
284 Ga0496109_0218896 3300048912 Bacteria 1791
285 Ga0496109_1326501 3300048912 Bacteria 655
286 Ga0496110_0024669 3300048913 Bacteria 5128
287 Ga0496110_0086116 3300048913 Bacteria 2805
288 Ga0496110_0133743 3300048913 Bacteria 2240
289 Ga0496110_0637504 3300048913 Bacteria 965
290 Ga0496110_0882669 3300048913 Bacteria 800
291 Ga0496111_0015683 3300048914 Bacteria 5208
292 Ga0496111_0113511 3300048914 Bacteria 1996
293 Ga0496112_0002917 3300048915 Bacteria 13926
294 Ga0496113_0016349 3300048916 Bacteria 5123
295 Ga0496113_0149330 3300048916 Bacteria 1843
296 Ga0496113_0329777 3300048916 Bacteria 1224
297 Ga0496113_0507498 3300048916 Bacteria 968
298 Ga0496114_0234444 3300048917 Bacteria 1613
299 Ga0496114_1200272 3300048917 Bacteria 645
300 Ga0496115_0003259 3300048918 Bacteria 11644
301 Ga0496115_0047011 3300048918 Bacteria 3450
302 Ga0496115_0068028 3300048918 Bacteria 2883
303 Ga0496115_0355575 3300048918 Bacteria 1194
304 Ga0496115_0548493 3300048918 Unclassified 924
305 Ga0501033_0615607 3300049570 Bacteria 744
306 Ga0501209_077048 3300049656 Unclassified 957
307 Ga0501080_0864778 3300049742 Bacteria 790
308 nmdc:mga0yw44_239377_c1 3300050492 Bacteria 1206
309 nmdc:mga0yw44_282814_c1 3300050492 Bacteria 1109
310 nmdc:mga05p37_16172_c1 3300050507 Bacteria 8983
311 nmdc:mga09592_1841_c1 3300050508 Bacteria 17052
312 nmdc:mga06r32_11791_c1 3300050510 Bacteria 7873
313 nmdc:mga06r32_163084_c1 3300050510 Bacteria 2211
314 nmdc:mga08y16_530345_c1 3300050511 Bacteria 1193
315 nmdc:mga0n895_8568_c1 3300050512 Bacteria 8865
316 nmdc:mga0rr50_1306865_c1 3300050513 Bacteria 615
317 nmdc:mga0rr50_1849882_c1 3300050513 Bacteria 508
318 nmdc:mga0a205_486749_c1 3300050515 Bacteria 1091
319 Ga0495601_0000006 3300053077 Bacteria 373770
320 Ga0495601_0301288 3300053077 Bacteria 1044
321 Ga0495612_0000004 3300053078 Bacteria 286946
322 Ga0495595_0004715 3300053084 Bacteria 5485
323 Ga0495595_0332620 3300053084 Bacteria 766
324 Ga0495619_0000027 3300053085 Bacteria 165001
325 Ga0495619_0062725 3300053085 Bacteria 2474
326 Ga0495619_0616797 3300053085 Bacteria 741
327 Ga0500555_102961 3300053103 Bacteria 723
328 Ga0500556_0001942 3300053104 Bacteria 7313
329 Ga0501082_0000434 3300060353 Bacteria 37104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10012609 Ga0099794_100126095 141
2 3300027671 Ga0209588_1094950 Ga0209588_10949502 141
3 iso_pu_bacteria 2513237092 2513622666 144
4 3300005985 Ga0081539_10075959 Ga0081539_100759592 147
5 3300006942 Ga0099824_1020287 Ga0099824_10202878 148
6 3300014326 Ga0157380_10320866 Ga0157380_103208661 148
7 3300027296 Ga0209389_1000010 Ga0209389_100001023 148
8 3300027357 Ga0209589_1000016 Ga0209589_1000016191 148
9 3300027361 Ga0209489_100016 Ga0209489_10001623 148
10 3300025912 Ga0207707_10480333 Ga0207707_104803332 150
11 iso_pu_bacteria 2617270741 2617378486 150
12 iso_pu_bacteria 2824679649 2824680378 150
13 iso_pu_bacteria 2824732956 2824740708 150
14 iso_pu_bacteria 2824746037 2824748440 150
15 iso_pu_bacteria 2881364244 2881368219 150
16 iso_pu_bacteria 2881665667 2881667709 150
17 iso_pu_bacteria 2908775508 2908780729 150
18 iso_pu_bacteria 2922393267 2922397506 150
19 iso_pu_bacteria 3005483717 3005485138 150
20 iso_pu_bacteria 3005587118 3005587464 150
21 3300013296 Ga0157374_10694814 Ga0157374_106948141 151
22 3300026078 Ga0207702_10388491 Ga0207702_103884912 151
23 3300037418 Ga0395900_0001701 Ga0395900_0001701_20170_20625 151
24 3300037466 Ga0395898_0007735 Ga0395898_0007735_3115_3570 151
25 3300038443 Ga0395901_0075186 Ga0395901_0075186_3028_3483 151
26 3300053103 Ga0500555_102961 Ga0500555_102961_86_541 151
27 3300060353 Ga0501082_0000434 Ga0501082_0000434_28428_28898 151
28 3300005334 Ga0068869_100480154 Ga0068869_1004801542 152
29 3300005436 Ga0070713_101892538 Ga0070713_1018925381 152
30 3300005545 Ga0070695_100422288 Ga0070695_1004222881 152
31 3300005843 Ga0068860_100587890 Ga0068860_1005878902 152
32 3300006163 Ga0070715_10029142 Ga0070715_100291423 152
33 3300014326 Ga0157380_10064766 Ga0157380_100647664 152
34 3300025923 Ga0207681_10908122 Ga0207681_109081222 152
35 3300025928 Ga0207700_11532916 Ga0207700_115329161 152
36 3300025932 Ga0207690_10619173 Ga0207690_106191731 152
37 3300037418 Ga0395900_0040641 Ga0395900_0040641_2252_2764 152
38 3300037466 Ga0395898_0794349 Ga0395898_0794349_108_620 152
39 3300038443 Ga0395901_0014195 Ga0395901_0014195_1690_2202 152
40 3300039438 Ga0436360_0669886 Ga0436360_0669886_57_533 152
41 3300039447 Ga0436361_0827636 Ga0436361_0827636_184_660 152
42 3300048907 Ga0496104_0260229 Ga0496104_0260229_1149_1607 152
43 3300048913 Ga0496110_0086116 Ga0496110_0086116_409_867 152
44 3300048916 Ga0496113_0329777 Ga0496113_0329777_589_1047 152
45 3300048918 Ga0496115_0548493 Ga0496115_0548493_366_830 152
46 3300053104 Ga0500556_0001942 Ga0500556_0001942_1004_1462 152
47 3300005434 Ga0070709_10047723 Ga0070709_100477234 153
48 3300005435 Ga0070714_100029184 Ga0070714_1000291845 153
49 3300005437 Ga0070710_10186939 Ga0070710_101869392 153
50 3300005458 Ga0070681_10497003 Ga0070681_104970032 153
51 3300005530 Ga0070679_100543895 Ga0070679_1005438952 153
52 3300005536 Ga0070697_100020738 Ga0070697_1000207385 153
53 3300005546 Ga0070696_100411094 Ga0070696_1004110942 153
54 3300007076 Ga0075435_101880917 Ga0075435_1018809171 153
55 3300009093 Ga0105240_10002656 Ga0105240_1000265631 153
56 3300009147 Ga0114129_10006769 Ga0114129_100067693 153
57 3300009545 Ga0105237_10001323 Ga0105237_1000132339 153
58 3300025898 Ga0207692_10622498 Ga0207692_106224981 153
59 3300025906 Ga0207699_10056822 Ga0207699_100568222 153
60 3300025912 Ga0207707_10419201 Ga0207707_104192012 153
61 3300025913 Ga0207695_10005488 Ga0207695_100054883 153
62 3300025914 Ga0207671_10026733 Ga0207671_100267335 153
63 3300025921 Ga0207652_10980638 Ga0207652_109806382 153
64 3300025929 Ga0207664_10096537 Ga0207664_100965372 153
65 3300031241 Ga0265325_10213156 Ga0265325_102131561 153
66 3300031242 Ga0265329_10015354 Ga0265329_100153542 153
67 3300031247 Ga0265340_10002096 Ga0265340_100020962 153
68 3300031249 Ga0265339_10001221 Ga0265339_1000122111 153
69 3300031250 Ga0265331_10039798 Ga0265331_100397982 153
70 3300031691 Ga0316579_10220108 Ga0316579_102201081 153
71 3300031711 Ga0265314_10057626 Ga0265314_100576262 153
72 3300031712 Ga0265342_10000035 Ga0265342_1000003537 153
73 3300031731 Ga0307405_11034123 Ga0307405_110341232 153
74 3300032139 Ga0316580_10116899 Ga0316580_101168992 153
75 3300036401 Ga0373937_0657215 Ga0373937_0657215_515_976 153
76 3300036647 Ga0316582_0132123 Ga0316582_0132123_141_602 153
77 3300036712 Ga0316584_0049591 Ga0316584_0049591_131_592 153
78 3300036712 Ga0316584_0103041 Ga0316584_0103041_677_1138 153
79 3300039437 Ga0436365_0693216 Ga0436365_0693216_164_625 153
80 3300041997 Ga0439431_0240712 Ga0439431_0240712_49_513 153
81 3300042007 Ga0439449_0000980 Ga0439449_0000980_622_1086 153
82 3300042010 Ga0439452_080847 Ga0439452_080847_67_531 153
83 3300042014 Ga0439457_016014 Ga0439457_016014_1056_1520 153
84 3300042015 Ga0439462_0009597 Ga0439462_0009597_1779_2243 153
85 3300045976 Ga0466967_0839715 Ga0466967_0839715_99_572 153
86 3300048912 Ga0496109_0218896 Ga0496109_0218896_1168_1629 153
87 3300048913 Ga0496110_0637504 Ga0496110_0637504_237_698 153
88 3300048917 Ga0496114_1200272 Ga0496114_1200272_52_513 153
89 3300049570 Ga0501033_0615607 Ga0501033_0615607_263_727 153
90 3300050507 nmdc:mga05p37_16172_c1 nmdc:mga05p37_16172_c1_7751_8212 153
91 3300050508 nmdc:mga09592_1841_c1 nmdc:mga09592_1841_c1_537_998 153
92 3300050510 nmdc:mga06r32_11791_c1 nmdc:mga06r32_11791_c1_2400_2861 153
93 3300050513 nmdc:mga0rr50_1306865_c1 nmdc:mga0rr50_1306865_c1_143_604 153
94 3300050513 nmdc:mga0rr50_1849882_c1 nmdc:mga0rr50_1849882_c1_29_493 153
95 3300006028 Ga0070717_10961196 Ga0070717_109611962 154
96 3300021320 Ga0214544_1000004 Ga0214544_1000004113 154
97 3300021321 Ga0214542_1000001 Ga0214542_1000001240 154
98 3300021321 Ga0214542_1047691 Ga0214542_10476912 154
99 3300021324 Ga0214545_1000001 Ga0214545_1000001307 154
100 3300021324 Ga0214545_1048704 Ga0214545_10487042 154
101 3300021327 Ga0214543_1000006 Ga0214543_1000006304 154
102 3300021327 Ga0214543_1048555 Ga0214543_10485552 154
103 3300025960 Ga0207651_11157300 Ga0207651_111573001 154
104 3300044658 Ga0466972_0013926 Ga0466972_0013926_3343_3813 154
105 3300046507 Ga0495606_0038206 Ga0495606_0038206_790_1395 154
106 3300005406 Ga0070703_10008485 Ga0070703_100084852 155
107 3300005445 Ga0070708_100655379 Ga0070708_1006553792 155
108 3300005467 Ga0070706_100013561 Ga0070706_1000135617 155
109 3300005471 Ga0070698_101299535 Ga0070698_1012995352 155
110 3300005518 Ga0070699_100768786 Ga0070699_1007687861 155
111 3300005545 Ga0070695_100091235 Ga0070695_1000912352 155
112 3300005549 Ga0070704_100002695 Ga0070704_1000026959 155
113 3300025885 Ga0207653_10014959 Ga0207653_100149593 155
114 3300025910 Ga0207684_10023749 Ga0207684_100237494 155
115 3300035089 Ga0373944_0235206 Ga0373944_0235206_15_491 155
116 3300035111 Ga0373923_0019568 Ga0373923_0019568_1766_2242 155
117 3300035113 Ga0373936_0002195 Ga0373936_0002195_1356_1832 155
118 3300035117 Ga0373953_0020857 Ga0373953_0020857_1188_1664 155
119 3300035118 Ga0373954_0001214 Ga0373954_0001214_5371_5847 155
120 3300035170 Ga0373943_0014210 Ga0373943_0014210_1885_2361 155
121 3300035171 Ga0373946_0009915 Ga0373946_0009915_2724_3200 155
122 3300035172 Ga0373955_0004180 Ga0373955_0004180_2410_2886 155
123 3300035410 Ga0373924_0006406 Ga0373924_0006406_1760_2236 155
124 3300035692 Ga0373935_0000980 Ga0373935_0000980_2984_3460 155
125 3300035695 Ga0373927_0008272 Ga0373927_0008272_2441_2917 155
126 3300035724 Ga0373933_0004767 Ga0373933_0004767_926_1402 155
127 3300035725 Ga0373947_0000492 Ga0373947_0000492_95_571 155
128 3300036401 Ga0373937_0003427 Ga0373937_0003427_2675_3151 155
129 3300037068 Ga0373925_0000018 Ga0373925_0000018_151562_152038 155
130 3300045976 Ga0466967_0535320 Ga0466967_0535320_487_954 155
131 3300046454 Ga0495592_0000001 Ga0495592_0000001_56360_56836 155
132 3300046459 Ga0495629_0058402 Ga0495629_0058402_208_684 155
133 3300046462 Ga0495651_0003294 Ga0495651_0003294_8921_9397 155
134 3300046463 Ga0495653_0000092 Ga0495653_0000092_71359_71835 155
135 3300046473 Ga0495582_0019402 Ga0495582_0019402_1374_1850 155
136 3300046476 Ga0495662_0087733 Ga0495662_0087733_778_1254 155
137 3300046477 Ga0495664_0000001 Ga0495664_0000001_259525_260001 155
138 3300046511 Ga0495608_0000050 Ga0495608_0000050_14665_15141 155
139 3300046514 Ga0495618_0000064 Ga0495618_0000064_2947_3423 155
140 3300046516 Ga0495628_0000003 Ga0495628_0000003_90582_91058 155
141 3300046517 Ga0495630_0010199 Ga0495630_0010199_3454_3930 155
142 3300046529 Ga0495652_0000001 Ga0495652_0000001_567164_567640 155
143 3300046533 Ga0495640_0000006 Ga0495640_0000006_14800_15276 155
144 3300046536 Ga0495587_0000028 Ga0495587_0000028_73777_74253 155
145 3300046543 Ga0495645_0000004 Ga0495645_0000004_153031_153507 155
146 3300046559 Ga0495667_0000001 Ga0495667_0000001_407132_407608 155
147 3300046642 Ga0495634_0002741 Ga0495634_0002741_8698_9174 155
148 3300046663 Ga0495635_0000015 Ga0495635_0000015_209648_210124 155
149 3300046675 Ga0495657_0000155 Ga0495657_0000155_58644_59120 155
150 3300046678 Ga0495599_0000029 Ga0495599_0000029_2976_3452 155
151 3300046679 Ga0495623_0002458 Ga0495623_0002458_2966_3442 155
152 3300046680 Ga0495646_0000006 Ga0495646_0000006_255050_255526 155
153 3300046683 Ga0495658_0071959 Ga0495658_0071959_103_579 155
154 3300046689 Ga0495613_0079093 Ga0495613_0079093_1801_2277 155
155 3300046690 Ga0495624_0120326 Ga0495624_0120326_233_709 155
156 3300046809 Ga0495600_0000286 Ga0495600_0000286_21235_21711 155
157 3300047315 Ga0495581_0063516 Ga0495581_0063516_1293_1769 155
158 3300047317 Ga0495604_0000091 Ga0495604_0000091_3043_3519 155
159 3300047319 Ga0495674_0000001 Ga0495674_0000001_459462_459938 155
160 3300047322 Ga0495680_0021652 Ga0495680_0021652_1937_2413 155
161 3300047444 Ga0495675_0000839 Ga0495675_0000839_3008_3484 155
162 3300047471 Ga0495684_0000055 Ga0495684_0000055_73842_74318 155
163 3300047673 Ga0495593_0004124 Ga0495593_0004124_7703_8179 155
164 3300048088 Ga0495602_0000002 Ga0495602_0000002_3005_3481 155
165 3300053077 Ga0495601_0000006 Ga0495601_0000006_299512_299988 155
166 3300053078 Ga0495612_0000004 Ga0495612_0000004_14672_15148 155
167 3300053084 Ga0495595_0004715 Ga0495595_0004715_1964_2440 155
168 3300053085 Ga0495619_0000027 Ga0495619_0000027_90770_91246 155
169 3300021377 Ga0213874_10020931 Ga0213874_100209312 156
170 3300037853 Ga0436364_0305538 Ga0436364_0305538_451_921 156
171 3300039447 Ga0436361_0616781 Ga0436361_0616781_752_1222 156
172 3300039450 Ga0436363_0302347 Ga0436363_0302347_1536_2006 156
173 3300048907 Ga0496104_0012302 Ga0496104_0012302_6555_7025 156
174 3300048908 Ga0496105_0019451 Ga0496105_0019451_515_985 156
175 3300048909 Ga0496106_0309982 Ga0496106_0309982_524_994 156
176 3300048913 Ga0496110_0882669 Ga0496110_0882669_79_549 156
177 3300048918 Ga0496115_0355575 Ga0496115_0355575_330_800 156
178 3300005288 Ga0065714_10083581 Ga0065714_100835812 157
179 3300005289 Ga0065704_10043202 Ga0065704_100432023 157
180 3300005293 Ga0065715_10004267 Ga0065715_100042674 157
181 3300005295 Ga0065707_10123090 Ga0065707_101230901 157
182 3300005331 Ga0070670_100114112 Ga0070670_1001141123 157
183 3300005334 Ga0068869_100223702 Ga0068869_1002237022 157
184 3300005336 Ga0070680_101544925 Ga0070680_1015449251 157
185 3300005347 Ga0070668_100918761 Ga0070668_1009187611 157
186 3300005353 Ga0070669_100416768 Ga0070669_1004167682 157
187 3300005354 Ga0070675_100066145 Ga0070675_1000661454 157
188 3300005354 Ga0070675_100942033 Ga0070675_1009420332 157
189 3300005355 Ga0070671_100087138 Ga0070671_1000871381 157
190 3300005356 Ga0070674_100047933 Ga0070674_1000479332 157
191 3300005364 Ga0070673_100425946 Ga0070673_1004259461 157
192 3300005367 Ga0070667_101425538 Ga0070667_1014255381 157
193 3300005436 Ga0070713_100078762 Ga0070713_1000787622 157
194 3300005441 Ga0070700_100263682 Ga0070700_1002636822 157
195 3300005444 Ga0070694_100835994 Ga0070694_1008359941 157
196 3300005445 Ga0070708_100050380 Ga0070708_1000503803 157
197 3300005445 Ga0070708_100380381 Ga0070708_1003803812 157
198 3300005458 Ga0070681_10482439 Ga0070681_104824391 157
199 3300005467 Ga0070706_100170421 Ga0070706_1001704213 157
200 3300005468 Ga0070707_100480822 Ga0070707_1004808222 157
201 3300005518 Ga0070699_100133593 Ga0070699_1001335933 157
202 3300005518 Ga0070699_101194341 Ga0070699_1011943411 157
203 3300005545 Ga0070695_100619725 Ga0070695_1006197252 157
204 3300005548 Ga0070665_101029901 Ga0070665_1010299011 157
205 3300005549 Ga0070704_100939849 Ga0070704_1009398491 157
206 3300005564 Ga0070664_100161936 Ga0070664_1001619362 157
207 3300005617 Ga0068859_100280150 Ga0068859_1002801502 157
208 3300005618 Ga0068864_100324492 Ga0068864_1003244922 157
209 3300005840 Ga0068870_10106842 Ga0068870_101068422 157
210 3300005844 Ga0068862_100219014 Ga0068862_1002190143 157
211 3300005937 Ga0081455_10366804 Ga0081455_103668042 157
212 3300006028 Ga0070717_10032628 Ga0070717_100326282 157
213 3300006038 Ga0075365_10048152 Ga0075365_100481522 157
214 3300006038 Ga0075365_10175501 Ga0075365_101755012 157
215 3300006847 Ga0075431_100033085 Ga0075431_1000330852 157
216 3300006871 Ga0075434_100005665 Ga0075434_1000056656 157
217 3300006931 Ga0097620_100280152 Ga0097620_1002801523 157
218 3300006931 Ga0097620_100494729 Ga0097620_1004947292 157
219 3300007076 Ga0075435_100101266 Ga0075435_1001012661 157
220 3300007076 Ga0075435_100674385 Ga0075435_1006743852 157
221 3300009094 Ga0111539_10100652 Ga0111539_101006524 157
222 3300009094 Ga0111539_10178139 Ga0111539_101781394 157
223 3300009094 Ga0111539_10300985 Ga0111539_103009853 157
224 3300009098 Ga0105245_10852052 Ga0105245_108520521 157
225 3300009101 Ga0105247_10033892 Ga0105247_100338922 157
226 3300009147 Ga0114129_12410476 Ga0114129_124104761 157
227 3300009177 Ga0105248_10666569 Ga0105248_106665692 157
228 3300013306 Ga0163162_10401917 Ga0163162_104019172 157
229 3300013308 Ga0157375_10031179 Ga0157375_100311796 157
230 3300013308 Ga0157375_11924354 Ga0157375_119243542 157
231 3300014325 Ga0163163_10059897 Ga0163163_100598974 157
232 3300014325 Ga0163163_10061947 Ga0163163_100619472 157
233 3300021377 Ga0213874_10234561 Ga0213874_102345611 157
234 3300025315 Ga0207697_10091196 Ga0207697_100911962 157
235 3300025893 Ga0207682_10026454 Ga0207682_100264542 157
236 3300025901 Ga0207688_10019569 Ga0207688_100195694 157
237 3300025908 Ga0207643_10014573 Ga0207643_100145734 157
238 3300025910 Ga0207684_10074011 Ga0207684_100740113 157
239 3300025912 Ga0207707_10158040 Ga0207707_101580402 157
240 3300025922 Ga0207646_10443730 Ga0207646_104437302 157
241 3300025925 Ga0207650_10007215 Ga0207650_100072156 157
242 3300025926 Ga0207659_10967021 Ga0207659_109670211 157
243 3300025931 Ga0207644_10432066 Ga0207644_104320661 157
244 3300025936 Ga0207670_10078485 Ga0207670_100784853 157
245 3300025940 Ga0207691_10011990 Ga0207691_100119906 157
246 3300025945 Ga0207679_10533881 Ga0207679_105338811 157
247 3300025960 Ga0207651_10036083 Ga0207651_100360834 157
248 3300025972 Ga0207668_11408787 Ga0207668_114087871 157
249 3300026035 Ga0207703_11053132 Ga0207703_110531322 157
250 3300026075 Ga0207708_10067947 Ga0207708_100679474 157
251 3300026095 Ga0207676_10720066 Ga0207676_107200662 157
252 3300028379 Ga0268266_10314545 Ga0268266_103145452 157
253 3300028380 Ga0268265_10356000 Ga0268265_103560001 157
254 3300028380 Ga0268265_10813433 Ga0268265_108134332 157
255 3300031548 Ga0307408_100039522 Ga0307408_1000395223 157
256 3300031731 Ga0307405_10626784 Ga0307405_106267842 157
257 3300031852 Ga0307410_10083541 Ga0307410_100835412 157
258 3300031911 Ga0307412_10096377 Ga0307412_100963772 157
259 3300031911 Ga0307412_10564787 Ga0307412_105647872 157
260 3300032002 Ga0307416_100343709 Ga0307416_1003437093 157
261 3300035117 Ga0373953_0056169 Ga0373953_0056169_386_859 157
262 3300035118 Ga0373954_0100520 Ga0373954_0100520_237_710 157
263 3300035119 Ga0373956_0070970 Ga0373956_0070970_855_1328 157
264 3300035120 Ga0373957_0079887 Ga0373957_0079887_621_1094 157
265 3300035170 Ga0373943_0437976 Ga0373943_0437976_38_511 157
266 3300035172 Ga0373955_0272991 Ga0373955_0272991_213_686 157
267 3300035410 Ga0373924_0040718 Ga0373924_0040718_1333_1806 157
268 3300035691 Ga0373931_0119596 Ga0373931_0119596_499_972 157
269 3300035724 Ga0373933_0245441 Ga0373933_0245441_42_515 157
270 3300035725 Ga0373947_0116856 Ga0373947_0116856_1114_1590 157
271 3300035725 Ga0373947_0182582 Ga0373947_0182582_443_916 157
272 3300036401 Ga0373937_0015179 Ga0373937_0015179_3840_4313 157
273 3300039450 Ga0436363_1185356 Ga0436363_1185356_297_770 157
274 3300044712 Ga0453684_0410728 Ga0453684_0410728_181_711 157
275 3300046455 Ga0495603_0224786 Ga0495603_0224786_264_737 157
276 3300046459 Ga0495629_0017298 Ga0495629_0017298_2597_3070 157
277 3300046473 Ga0495582_0571941 Ga0495582_0571941_99_572 157
278 3300046476 Ga0495662_0101030 Ga0495662_0101030_182_655 157
279 3300046499 Ga0495594_0167248 Ga0495594_0167248_271_744 157
280 3300046514 Ga0495618_0063985 Ga0495618_0063985_1777_2250 157
281 3300046517 Ga0495630_0338431 Ga0495630_0338431_75_548 157
282 3300046533 Ga0495640_0220587 Ga0495640_0220587_333_806 157
283 3300046533 Ga0495640_0763327 Ga0495640_0763327_45_518 157
284 3300046663 Ga0495635_0351711 Ga0495635_0351711_171_644 157
285 3300046683 Ga0495658_0432780 Ga0495658_0432780_286_759 157
286 3300046689 Ga0495613_0929796 Ga0495613_0929796_10_483 157
287 3300046690 Ga0495624_0311550 Ga0495624_0311550_59_532 157
288 3300047315 Ga0495581_0763769 Ga0495581_0763769_23_496 157
289 3300047321 Ga0495676_0656813 Ga0495676_0656813_99_572 157
290 3300047322 Ga0495680_0369237 Ga0495680_0369237_377_850 157
291 3300047323 Ga0495683_0164951 Ga0495683_0164951_143_616 157
292 3300047471 Ga0495684_0065427 Ga0495684_0065427_1633_2106 157
293 3300047673 Ga0495593_0056083 Ga0495593_0056083_1252_1725 157
294 3300048089 Ga0495614_0057462 Ga0495614_0057462_889_1362 157
295 3300048903 Ga0496100_0421571 Ga0496100_0421571_127_600 157
296 3300048904 Ga0496101_0045847 Ga0496101_0045847_1881_2354 157
297 3300048904 Ga0496101_0287762 Ga0496101_0287762_365_838 157
298 3300048905 Ga0496102_0171619 Ga0496102_0171619_855_1328 157
299 3300048905 Ga0496102_0221457 Ga0496102_0221457_816_1289 157
300 3300048905 Ga0496102_0763511 Ga0496102_0763511_355_828 157
301 3300048906 Ga0496103_0079194 Ga0496103_0079194_926_1399 157
302 3300048907 Ga0496104_0000383 Ga0496104_0000383_6544_7017 157
303 3300048907 Ga0496104_0012711 Ga0496104_0012711_2808_3281 157
304 3300048907 Ga0496104_0033664 Ga0496104_0033664_2348_2821 157
305 3300048907 Ga0496104_1090362 Ga0496104_1090362_173_646 157
306 3300048908 Ga0496105_0046211 Ga0496105_0046211_1878_2351 157
307 3300048908 Ga0496105_0050612 Ga0496105_0050612_825_1298 157
308 3300048908 Ga0496105_0054161 Ga0496105_0054161_2548_3021 157
309 3300048909 Ga0496106_0044785 Ga0496106_0044785_368_841 157
310 3300048909 Ga0496106_0217139 Ga0496106_0217139_1030_1503 157
311 3300048910 Ga0496107_0015334 Ga0496107_0015334_4683_5156 157
312 3300048911 Ga0496108_0015685 Ga0496108_0015685_1406_1879 157
313 3300048911 Ga0496108_0085371 Ga0496108_0085371_229_702 157
314 3300048911 Ga0496108_0664816 Ga0496108_0664816_90_563 157
315 3300048912 Ga0496109_0018139 Ga0496109_0018139_1406_1879 157
316 3300048912 Ga0496109_1326501 Ga0496109_1326501_20_493 157
317 3300048913 Ga0496110_0024669 Ga0496110_0024669_656_1129 157
318 3300048913 Ga0496110_0133743 Ga0496110_0133743_1203_1676 157
319 3300048914 Ga0496111_0015683 Ga0496111_0015683_2899_3372 157
320 3300048914 Ga0496111_0113511 Ga0496111_0113511_291_764 157
321 3300048915 Ga0496112_0002917 Ga0496112_0002917_9181_9654 157
322 3300048916 Ga0496113_0016349 Ga0496113_0016349_4300_4773 157
323 3300048916 Ga0496113_0149330 Ga0496113_0149330_303_776 157
324 3300048916 Ga0496113_0507498 Ga0496113_0507498_32_505 157
325 3300048917 Ga0496114_0234444 Ga0496114_0234444_771_1244 157
326 3300048918 Ga0496115_0003259 Ga0496115_0003259_9257_9730 157
327 3300048918 Ga0496115_0047011 Ga0496115_0047011_548_1021 157
328 3300048918 Ga0496115_0068028 Ga0496115_0068028_2091_2564 157
329 3300049656 Ga0501209_077048 Ga0501209_077048_126_653 157
330 3300049742 Ga0501080_0864778 Ga0501080_0864778_234_725 157
331 3300050492 nmdc:mga0yw44_239377_c1 nmdc:mga0yw44_239377_c1_588_1061 157
332 3300050492 nmdc:mga0yw44_282814_c1 nmdc:mga0yw44_282814_c1_555_1028 157
333 3300050510 nmdc:mga06r32_163084_c1 nmdc:mga06r32_163084_c1_317_790 157
334 3300050511 nmdc:mga08y16_530345_c1 nmdc:mga08y16_530345_c1_699_1172 157
335 3300050512 nmdc:mga0n895_8568_c1 nmdc:mga0n895_8568_c1_5903_6394 157
336 3300050515 nmdc:mga0a205_486749_c1 nmdc:mga0a205_486749_c1_284_760 157
337 3300053077 Ga0495601_0301288 Ga0495601_0301288_258_731 157
338 3300053084 Ga0495595_0332620 Ga0495595_0332620_44_517 157
339 3300053085 Ga0495619_0062725 Ga0495619_0062725_313_786 157
340 3300053085 Ga0495619_0616797 Ga0495619_0616797_109_582 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

24

163

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8m-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8267 6 156
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8122 6 155
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.7987 1 154
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7986 6 157
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.7962 6 156
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8519 6 153 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.838 6 157 3.60.21.10
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8122 6 155 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8085 6 157 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8055 6 153 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7V8NNJ3-F1-model_v4 Metallophosphoesterase family protein 1.003 8 70
AF-A0A2V9ZU70-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9978 6 115 GO:0016787
GO:0046872
AF-W4L4G6-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9978 6 70
AF-A0A2V7E4R1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9977 4 155 GO:0016787
GO:0046872
AF-A0A530HE49-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9977 6 123 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
95.98 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map