F413859

General Info

Members Datasets Scaffolds Average Seq Length
339 159 678 457

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10017042|Ga0075365_100170422
Length 506
Sequence MAGPSPKVRTFDRSIIDGPIRPAVWRLAWPTMLQNVIAGLQGMIDHAMVGHFVGYAANAAIGVSWQIIMVATVFVSSVSSGMAVLVARFAGANEPDKVNRVVYQAFLTAAGLAVVLAALGWIAAPSLLDLVHASAEVHGEALPFLRTMLVGIIGMTMFFMLGGALRAAGDPHTPLRLGAGMTVLTVVFNVLLIPVFGTVGAAYGTVASSTLVSIYGIWRLTRPESVIHFEPGKDRRPDFRIIRSLFRFGLPTGIQGIAMSGAGVLLLRFIGSLHNSAAAQAAYTIAYTQLYSLITWTSVGLMGAAATIAGQNLGARNPERAMAGVRVASHIGLGVASVVGALFLLVPRYLLAVFGMSDPHVLEIATQLLRFLSVSGLFITVALSYTGGLQGTGDTRSPLYISVISQIVIPIGICTVLQASGHLTPGGIWTAILVGQVARCTLSVTRFHQQKWRSIAVDIEPRQTRIADDELLGAQALQHAPDGDSLDAKNGKRVWAGGDAAERRRR

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
137 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
157 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 0.29
Rhizosphere 99.41
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10017042 3300006038 Bacteria 4435
2 JGI24746J21847_1003970 3300001977 Bacteria 2338
3 JGI25406J46586_10002589 3300003203 Bacteria 8536
4 Ga0065714_10015528 3300005288 Bacteria 2256
5 Ga0065714_10092241 3300005288 Bacteria 1884
6 Ga0065704_10080959 3300005289 Bacteria 3840
7 Ga0065712_10000181 3300005290 Bacteria 61982
8 Ga0065712_10008075 3300005290 Bacteria 6727
9 Ga0065715_10125219 3300005293 Bacteria 2136
10 Ga0065715_10136832 3300005293 Bacteria 1916
11 Ga0065707_10000926 3300005295 Bacteria 20311
12 Ga0065707_10103664 3300005295 Bacteria 2735
13 Ga0065707_10133384 3300005295 Bacteria 1880
14 Ga0070676_10089570 3300005328 Bacteria 1882
15 Ga0070676_10089857 3300005328 Bacteria 1879
16 Ga0070683_100005314 3300005329 Bacteria 10733
17 Ga0070690_100041016 3300005330 Bacteria 2929
18 Ga0070690_100094157 3300005330 Bacteria 1976
19 Ga0070670_100012111 3300005331 Bacteria 7376
20 Ga0070677_10002135 3300005333 Bacteria 6312
21 Ga0070677_10005606 3300005333 Bacteria 4141
22 Ga0068869_100003946 3300005334 Bacteria 9161
23 Ga0068869_100008166 3300005334 Bacteria 6734
24 Ga0070666_10004859 3300005335 Bacteria 8213
25 Ga0070666_10159765 3300005335 Bacteria 1575
26 Ga0068868_100052167 3300005338 Bacteria 3220
27 Ga0068868_100147208 3300005338 Bacteria 1937
28 Ga0070689_100113443 3300005340 Bacteria 2158
29 Ga0070691_10069217 3300005341 Bacteria 1710
30 Ga0070687_100077454 3300005343 Bacteria 1804
31 Ga0070661_100020077 3300005344 Bacteria 4763
32 Ga0070692_10000450 3300005345 Bacteria 12539
33 Ga0070668_100074174 3300005347 Bacteria 2654
34 Ga0070669_100038952 3300005353 Bacteria 3452
35 Ga0070669_100069284 3300005353 Bacteria 2605
36 Ga0070675_100006448 3300005354 Bacteria 9005
37 Ga0070675_100007847 3300005354 Bacteria 8272
38 Ga0070675_100045111 3300005354 Bacteria 3606
39 Ga0070675_100082225 3300005354 Unclassified 2687
40 Ga0070675_100102939 3300005354 Bacteria 2406
41 Ga0070671_100075899 3300005355 Bacteria 2808
42 Ga0070671_100077084 3300005355 Unclassified 2785
43 Ga0070671_100130011 3300005355 Bacteria 2121
44 Ga0070674_100000788 3300005356 Bacteria 16267
45 Ga0070674_100078453 3300005356 Bacteria 2353
46 Ga0070673_100036086 3300005364 Bacteria 3754
47 Ga0070673_100040463 3300005364 Bacteria 3576
48 Ga0070673_100072579 3300005364 Bacteria 2768
49 Ga0070688_100033611 3300005365 Bacteria 3101
50 Ga0070688_100107322 3300005365 Bacteria 1851
51 Ga0070667_100020061 3300005367 Bacteria 5549
52 Ga0070705_100008014 3300005440 Bacteria 5222
53 Ga0070694_100004741 3300005444 Bacteria 8188
54 Ga0070663_100005915 3300005455 Bacteria 7321
55 Ga0070663_100048565 3300005455 Bacteria 3010
56 Ga0070678_100103456 3300005456 Bacteria 2212
57 Ga0070678_100120208 3300005456 Bacteria 2070
58 Ga0070662_100145934 3300005457 Bacteria 1838
59 Ga0070706_100004038 3300005467 Bacteria 14254
60 Ga0070706_100012563 3300005467 Bacteria 7843
61 Ga0070706_100034728 3300005467 Bacteria 4657
62 Ga0070706_100133533 3300005467 Bacteria 2316
63 Ga0070707_100080407 3300005468 Bacteria 3145
64 Ga0070698_100010937 3300005471 Bacteria 9654
65 Ga0070698_100083424 3300005471 Bacteria 3185
66 Ga0070699_100011283 3300005518 Bacteria 7718
67 Ga0070672_100000133 3300005543 Bacteria 39180
68 Ga0070672_100033495 3300005543 Bacteria 3891
69 Ga0070672_100043006 3300005543 Bacteria 3481
70 Ga0070672_100086698 3300005543 Unclassified 2518
71 Ga0070672_100125920 3300005543 Bacteria 2101
72 Ga0070686_100023806 3300005544 Bacteria 3665
73 Ga0070696_100062857 3300005546 Unclassified 2600
74 Ga0070704_100007288 3300005549 Bacteria 6578
75 Ga0070704_100077878 3300005549 Bacteria 2430
76 Ga0070664_100049372 3300005564 Bacteria 3558
77 Ga0070664_100178154 3300005564 Bacteria 1888
78 Ga0068859_100007703 3300005617 Bacteria 10934
79 Ga0068859_100028507 3300005617 Bacteria 5598
80 Ga0068864_100003644 3300005618 Bacteria 12735
81 Ga0068864_100032441 3300005618 Bacteria 4439
82 Ga0068864_100055540 3300005618 Bacteria 3420
83 Ga0068864_100098830 3300005618 Bacteria 2585
84 Ga0068864_100217209 3300005618 Bacteria 1762
85 Ga0068861_100014991 3300005719 Bacteria 5451
86 Ga0068861_100037358 3300005719 Unclassified 3610
87 Ga0068861_100151584 3300005719 Bacteria 1903
88 Ga0068870_10002958 3300005840 Bacteria 7164
89 Ga0068870_10003214 3300005840 Bacteria 6898
90 Ga0068863_100099320 3300005841 Bacteria 2765
91 Ga0068860_100011792 3300005843 Bacteria 8613
92 Ga0068860_100032384 3300005843 Bacteria 5022
93 Ga0068862_100014140 3300005844 Bacteria 6617
94 Ga0068862_100016813 3300005844 Bacteria 6090
95 Ga0068862_100148172 3300005844 Bacteria 2087
96 Ga0081455_10094277 3300005937 Bacteria 2418
97 Ga0081538_10075280 3300005981 Bacteria 1832
98 Ga0081539_10000093 3300005985 Bacteria 207314
99 Ga0081539_10000096 3300005985 Bacteria 204059
100 Ga0081539_10034576 3300005985 Bacteria 3053
101 Ga0068871_100056228 3300006358 Bacteria 3198
102 Ga0075428_100014702 3300006844 Bacteria 8693
103 Ga0075428_100039246 3300006844 Bacteria 5211
104 Ga0075428_100069429 3300006844 Unclassified 3852
105 Ga0075428_100105748 3300006844 Bacteria 3069
106 Ga0075430_100001515 3300006846 Bacteria 18953
107 Ga0075430_100005087 3300006846 Bacteria 11074
108 Ga0075430_100121694 3300006846 Bacteria 2176
109 Ga0075430_100154354 3300006846 Unclassified 1912
110 Ga0075431_100002023 3300006847 Bacteria 19362
111 Ga0075431_100008744 3300006847 Bacteria 10144
112 Ga0075431_100050946 3300006847 Bacteria 4269
113 Ga0075431_100060891 3300006847 Bacteria 3895
114 Ga0075433_10003319 3300006852 Bacteria 12429
115 Ga0075433_10040540 3300006852 Bacteria 4031
116 Ga0075433_10049086 3300006852 Bacteria 3671
117 Ga0075433_10054003 3300006852 Bacteria 3504
118 Ga0075433_10134956 3300006852 Bacteria 2194
119 Ga0075434_100003070 3300006871 Bacteria 14866
120 Ga0075434_100010348 3300006871 Bacteria 8741
121 Ga0075434_100033083 3300006871 Bacteria 5101
122 Ga0075434_100099836 3300006871 Bacteria 2908
123 Ga0075434_100113977 3300006871 Bacteria 2716
124 Ga0075434_100165335 3300006871 Bacteria 2233
125 Ga0075429_100004482 3300006880 Bacteria 12010
126 Ga0075429_100005660 3300006880 Bacteria 10777
127 Ga0075429_100079515 3300006880 Bacteria 2858
128 Ga0097620_100007704 3300006931 Bacteria 10934
129 Ga0097620_100028507 3300006931 Bacteria 5598
130 Ga0075435_100006588 3300007076 Bacteria 8221
131 Ga0075435_100079627 3300007076 Bacteria 2689
132 Ga0111539_10000057 3300009094 Bacteria 114860
133 Ga0111539_10005130 3300009094 Bacteria 16986
134 Ga0111539_10011081 3300009094 Bacteria 11344
135 Ga0111539_10017288 3300009094 Bacteria 8926
136 Ga0111539_10018455 3300009094 Bacteria 8643
137 Ga0111539_10070537 3300009094 Unclassified 4125
138 Ga0111539_10110853 3300009094 Bacteria 3220
139 Ga0114129_10000309 3300009147 Bacteria 56974
140 Ga0114129_10002388 3300009147 Bacteria 26084
141 Ga0114129_10028388 3300009147 Bacteria 7929
142 Ga0114129_10036552 3300009147 Bacteria 6934
143 Ga0114129_10043312 3300009147 Bacteria 6333
144 Ga0114129_10059483 3300009147 Bacteria 5342
145 Ga0114129_10128423 3300009147 Bacteria 3484
146 Ga0114129_10148522 3300009147 Unclassified 3209
147 Ga0114129_10213160 3300009147 Bacteria 2610
148 Ga0114129_10264077 3300009147 Bacteria 2306
149 Ga0105248_10006525 3300009177 Bacteria 12791
150 Ga0105248_10032755 3300009177 Bacteria 5806
151 Ga0105248_10139778 3300009177 Bacteria 2732
152 Ga0105249_10132605 3300009553 Bacteria 2380
153 Ga0105249_10188825 3300009553 Bacteria 2010
154 Ga0157374_10066097 3300013296 Bacteria 3398
155 Ga0157378_10029523 3300013297 Bacteria 4842
156 Ga0163162_10351327 3300013306 Unclassified 1607
157 Ga0157375_10000002 3300013308 Bacteria 495826
158 Ga0157375_10003821 3300013308 Bacteria 13063
159 Ga0157375_10111901 3300013308 Bacteria 2830
160 Ga0163163_10017097 3300014325 Bacteria 6755
161 Ga0163163_10063762 3300014325 Bacteria 3655
162 Ga0157380_10007557 3300014326 Bacteria 7720
163 Ga0157380_10016721 3300014326 Bacteria 5417
164 Ga0157380_10019587 3300014326 Bacteria 5043
165 Ga0157380_10069789 3300014326 Bacteria 2837
166 Ga0157377_10057917 3300014745 Bacteria 2205
167 Ga0157379_10081973 3300014968 Bacteria 2890
168 Ga0157376_10033106 3300014969 Bacteria 4157
169 Ga0207682_10000853 3300025893 Bacteria 14147
170 Ga0207682_10002320 3300025893 Bacteria 8574
171 Ga0207682_10005942 3300025893 Bacteria 4937
172 Ga0207682_10007759 3300025893 Bacteria 4264
173 Ga0207688_10001797 3300025901 Bacteria 11402
174 Ga0207688_10004950 3300025901 Bacteria 7249
175 Ga0207645_10101334 3300025907 Bacteria 1858
176 Ga0207643_10001037 3300025908 Bacteria 16490
177 Ga0207643_10005250 3300025908 Bacteria 6928
178 Ga0207643_10023211 3300025908 Unclassified 3420
179 Ga0207643_10025583 3300025908 Unclassified 3263
180 Ga0207684_10037639 3300025910 Bacteria 4105
181 Ga0207684_10110574 3300025910 Bacteria 2352
182 Ga0207662_10007324 3300025918 Bacteria 6001
183 Ga0207646_10003360 3300025922 Bacteria 18130
184 Ga0207681_10012507 3300025923 Bacteria 5236
185 Ga0207650_10013664 3300025925 Bacteria 5628
186 Ga0207659_10009887 3300025926 Bacteria 5970
187 Ga0207659_10035071 3300025926 Unclassified 3465
188 Ga0207659_10135721 3300025926 Bacteria 1904
189 Ga0207644_10015837 3300025931 Bacteria 5070
190 Ga0207706_10006060 3300025933 Bacteria 11239
191 Ga0207706_10086280 3300025933 Bacteria 2759
192 Ga0207706_10187025 3300025933 Bacteria 1818
193 Ga0207686_10104313 3300025934 Unclassified 1899
194 Ga0207669_10158658 3300025937 Unclassified 1594
195 Ga0207691_10000489 3300025940 Bacteria 39336
196 Ga0207691_10005230 3300025940 Bacteria 12521
197 Ga0207691_10016844 3300025940 Bacteria 6934
198 Ga0207691_10066506 3300025940 Bacteria 3261
199 Ga0207691_10179987 3300025940 Bacteria 1848
200 Ga0207711_10049923 3300025941 Bacteria 3582
201 Ga0207711_10087607 3300025941 Bacteria 2732
202 Ga0207711_10190745 3300025941 Bacteria 1867
203 Ga0207711_10193282 3300025941 Bacteria 1855
204 Ga0207689_10014909 3300025942 Bacteria 6595
205 Ga0207689_10043948 3300025942 Bacteria 3693
206 Ga0207689_10153245 3300025942 Unclassified 1900
207 Ga0207679_10015322 3300025945 Bacteria 5062
208 Ga0207667_10085308 3300025949 Bacteria 3269
209 Ga0207651_10016482 3300025960 Bacteria 4329
210 Ga0207651_10038892 3300025960 Bacteria 3130
211 Ga0207651_10068364 3300025960 Bacteria 2504
212 Ga0207651_10131310 3300025960 Unclassified 1918
213 Ga0207712_10058568 3300025961 Bacteria 2723
214 Ga0207677_10035779 3300026023 Bacteria 3228
215 Ga0207703_10099493 3300026035 Bacteria 2461
216 Ga0207678_10009582 3300026067 Bacteria 8517
217 Ga0207678_10047697 3300026067 Bacteria 3703
218 Ga0207708_10024634 3300026075 Bacteria 4551
219 Ga0207641_10021769 3300026088 Bacteria 5270
220 Ga0207648_10005223 3300026089 Bacteria 13133
221 Ga0207676_10080681 3300026095 Bacteria 2641
222 Ga0207676_10086243 3300026095 Unclassified 2564
223 Ga0207676_10140844 3300026095 Unclassified 2064
224 Ga0207675_100003476 3300026118 Bacteria 15389
225 Ga0207675_100025763 3300026118 Bacteria 5473
226 Ga0207675_100030849 3300026118 Bacteria 4992
227 Ga0207675_100114307 3300026118 Bacteria 2549
228 Ga0207675_100153483 3300026118 Bacteria 2193
229 Ga0207683_10003196 3300026121 Bacteria 14291
230 Ga0207683_10109950 3300026121 Bacteria 2467
231 Ga0207683_10125194 3300026121 Bacteria 2309
232 Ga0209970_1001035 3300027614 Bacteria 4924
233 Ga0209983_1000787 3300027665 Bacteria 6891
234 Ga0209971_1006782 3300027682 Bacteria 2713
235 Ga0209966_1002062 3300027695 Bacteria 3355
236 Ga0207428_10000996 3300027907 Bacteria 31420
237 Ga0207428_10001963 3300027907 Bacteria 20879
238 Ga0207428_10007649 3300027907 Bacteria 9838
239 Ga0207428_10060071 3300027907 Bacteria 3012
240 Ga0268266_10007979 3300028379 Bacteria 9462
241 Ga0268265_10150215 3300028380 Unclassified 1964
242 Ga0268264_10023270 3300028381 Bacteria 5054
243 Ga0268264_10041381 3300028381 Bacteria 3812
244 Ga0307408_100029915 3300031548 Bacteria 3778
245 Ga0307408_100216744 3300031548 Bacteria 1559
246 Ga0307413_10099526 3300031824 Bacteria 1917
247 Ga0307410_10005717 3300031852 Bacteria 6624
248 Ga0307410_10017682 3300031852 Bacteria 4289
249 Ga0307410_10098785 3300031852 Bacteria 2088
250 Ga0307406_10010691 3300031901 Bacteria 5184
251 Ga0307407_10010539 3300031903 Bacteria 4366
252 Ga0307407_10026602 3300031903 Unclassified 3066
253 Ga0307409_100099389 3300031995 Bacteria 2409
254 Ga0307416_100010917 3300032002 Bacteria 6027
255 Ga0307416_100017089 3300032002 Bacteria 5063
256 Ga0307416_100023236 3300032002 Bacteria 4495
257 Ga0307416_100157829 3300032002 Bacteria 2091
258 Ga0307414_10028528 3300032004 Bacteria 3622
259 Ga0307414_10094542 3300032004 Bacteria 2231
260 Ga0307414_10158691 3300032004 Bacteria 1794
261 Ga0395905_0014646 3300037471 Bacteria 7481
262 Ga0395905_0217411 3300037471 Bacteria 1789
263 Ga0395901_0160265 3300038443 Unclassified 2363
264 Ga0451577_0005025 3300042876 Bacteria 13683
265 Ga0451577_0269252 3300042876 Bacteria 1543
266 Ga0451577_0359710 3300042876 Bacteria 1320
267 Ga0453684_0155427 3300044712 Bacteria 2713
268 Ga0451576_0095542 3300045051 Bacteria 3091
269 Ga0495580_0000002 3300046472 Bacteria 121311
270 Ga0495580_0016969 3300046472 Bacteria 5455
271 Ga0495643_0003815 3300046522 Bacteria 10872
272 Ga0495663_0051498 3300046525 Bacteria 1276
273 Ga0495659_0014051 3300046664 Bacteria 2615
274 Ga0495659_0053018 3300046664 Bacteria 1481
275 Ga0495659_0057930 3300046664 Bacteria 1424
276 Ga0495588_0004281 3300046674 Bacteria 6293
277 Ga0495599_0111229 3300046678 Bacteria 1706
278 Ga0495647_0028192 3300046681 Bacteria 2069
279 Ga0495672_0070683 3300047320 Unclassified 1977
280 Ga0495684_0014791 3300047471 Bacteria 6008
281 Ga0496113_0167672 3300048916 Bacteria 1738
282 Ga0501299_009929 3300049522 Bacteria 1580
283 Ga0501039_0123045 3300049575 Unclassified 2033
284 Ga0501041_0005036 3300049577 Bacteria 7693
285 Ga0501042_0005464 3300049578 Bacteria 8184
286 Ga0501042_0072617 3300049578 Bacteria 2462
287 Ga0501048_0093235 3300049582 Bacteria 2124
288 Ga0501074_0064084 3300049590 Bacteria 2647
289 Ga0501075_0071921 3300049591 Bacteria 2614
290 Ga0501076_0013370 3300049592 Bacteria 6155
291 Ga0501076_0060826 3300049592 Unclassified 3006
292 Ga0501079_0011671 3300049741 Bacteria 6712
293 Ga0501045_0011672 3300049824 Bacteria 6169
294 Ga0501045_0161972 3300049824 Bacteria 1665
295 nmdc:mga05p37_105319_c1 3300050507 Bacteria 3470
296 nmdc:mga05p37_126524_c1 3300050507 Unclassified 3138
297 nmdc:mga05p37_148089_c1 3300050507 Bacteria 2873
298 nmdc:mga05p37_19860_c1 3300050507 Bacteria 8129
299 nmdc:mga05p37_236558_c1 3300050507 Bacteria 2198
300 nmdc:mga05p37_279568_c1 3300050507 Unclassified 1991
301 nmdc:mga05p37_4242_c1 3300050507 Bacteria 16746
302 nmdc:mga05p37_42511_c1 3300050507 Bacteria 5584
303 nmdc:mga05p37_52748_c1 3300050507 Bacteria 5000
304 nmdc:mga05p37_7790_c1 3300050507 Bacteria 12642
305 nmdc:mga05p37_83643_c1 3300050507 Bacteria 3931
306 nmdc:mga09592_107494_c1 3300050508 Bacteria 2393
307 nmdc:mga09592_108605_c1 3300050508 Unclassified 2380
308 nmdc:mga09592_179985_c1 3300050508 Bacteria 1829
309 nmdc:mga09592_4534_c1 3300050508 Bacteria 11231
310 nmdc:mga0qj67_20133_c1 3300050509 Bacteria 5107
311 nmdc:mga0qj67_4548_c1 3300050509 Bacteria 10050
312 nmdc:mga06r32_12770_c1 3300050510 Bacteria 7593
313 nmdc:mga06r32_17107_c1 3300050510 Bacteria 6618
314 nmdc:mga06r32_39625_c1 3300050510 Bacteria 4472
315 nmdc:mga08y16_1384_c1 3300050511 Bacteria 24245
316 nmdc:mga08y16_162_c1 3300050511 Bacteria 58005
317 nmdc:mga08y16_2776_c1 3300050511 Bacteria 17949
318 nmdc:mga08y16_60428_c1 3300050511 Bacteria 3959
319 nmdc:mga0n895_1308_c1 3300050512 Bacteria 18426
320 nmdc:mga0n895_14381_c1 3300050512 Bacteria 7185
321 nmdc:mga0n895_194776_c1 3300050512 Bacteria 2058
322 nmdc:mga0n895_67151_c1 3300050512 Bacteria 3551
323 nmdc:mga0rr50_21805_c1 3300050513 Bacteria 4381
324 nmdc:mga0rr50_32180_c1 3300050513 Bacteria 3734
325 nmdc:mga0rr50_64363_c1 3300050513 Bacteria 2773
326 nmdc:mga0a205_10299_c1 3300050515 Bacteria 8592
327 nmdc:mga0a205_130918_c1 3300050515 Bacteria 2409
328 nmdc:mga0a205_1675_c1 3300050515 Bacteria 19112
329 nmdc:mga0a205_17368_c1 3300050515 Bacteria 6743
330 nmdc:mga0a205_3369_c1 3300050515 Bacteria 14235
331 nmdc:mga0a205_45244_c1 3300050515 Bacteria 3714
332 Ga0590071_000486 3300059421 Bacteria 11625
333 Ga0590071_001289 3300059421 Bacteria 6721
334 Ga0590074_000106 3300059423 Bacteria 9501
335 Ga0590075_000588 3300059424 Bacteria 9800
336 Ga0590075_000818 3300059424 Bacteria 8179
337 Ga0590077_002914 3300059426 Bacteria 3589
338 Ga0501082_0171735 3300060353 Bacteria 1885
339 Ga0501082_0190904 3300060353 Unclassified 1782
340 Ga0075365_10017042
341 JGI24746J21847_1003970
342 JGI25406J46586_10002589
343 Ga0065714_10015528
344 Ga0065714_10092241
345 Ga0065704_10080959
346 Ga0065712_10000181
347 Ga0065712_10008075
348 Ga0065715_10125219
349 Ga0065715_10136832
350 Ga0065707_10000926
351 Ga0065707_10103664
352 Ga0065707_10133384
353 Ga0070676_10089570
354 Ga0070676_10089857
355 Ga0070683_100005314
356 Ga0070690_100041016
357 Ga0070690_100094157
358 Ga0070670_100012111
359 Ga0070677_10002135
360 Ga0070677_10005606
361 Ga0068869_100003946
362 Ga0068869_100008166
363 Ga0070666_10004859
364 Ga0070666_10159765
365 Ga0068868_100052167
366 Ga0068868_100147208
367 Ga0070689_100113443
368 Ga0070691_10069217
369 Ga0070687_100077454
370 Ga0070661_100020077
371 Ga0070692_10000450
372 Ga0070668_100074174
373 Ga0070669_100038952
374 Ga0070669_100069284
375 Ga0070675_100006448
376 Ga0070675_100007847
377 Ga0070675_100045111
378 Ga0070675_100082225
379 Ga0070675_100102939
380 Ga0070671_100075899
381 Ga0070671_100077084
382 Ga0070671_100130011
383 Ga0070674_100000788
384 Ga0070674_100078453
385 Ga0070673_100036086
386 Ga0070673_100040463
387 Ga0070673_100072579
388 Ga0070688_100033611
389 Ga0070688_100107322
390 Ga0070667_100020061
391 Ga0070705_100008014
392 Ga0070694_100004741
393 Ga0070663_100005915
394 Ga0070663_100048565
395 Ga0070678_100103456
396 Ga0070678_100120208
397 Ga0070662_100145934
398 Ga0070706_100004038
399 Ga0070706_100012563
400 Ga0070706_100034728
401 Ga0070706_100133533
402 Ga0070707_100080407
403 Ga0070698_100010937
404 Ga0070698_100083424
405 Ga0070699_100011283
406 Ga0070672_100000133
407 Ga0070672_100033495
408 Ga0070672_100043006
409 Ga0070672_100086698
410 Ga0070672_100125920
411 Ga0070686_100023806
412 Ga0070696_100062857
413 Ga0070704_100007288
414 Ga0070704_100077878
415 Ga0070664_100049372
416 Ga0070664_100178154
417 Ga0068859_100007703
418 Ga0068859_100028507
419 Ga0068864_100003644
420 Ga0068864_100032441
421 Ga0068864_100055540
422 Ga0068864_100098830
423 Ga0068864_100217209
424 Ga0068861_100014991
425 Ga0068861_100037358
426 Ga0068861_100151584
427 Ga0068870_10002958
428 Ga0068870_10003214
429 Ga0068863_100099320
430 Ga0068860_100011792
431 Ga0068860_100032384
432 Ga0068862_100014140
433 Ga0068862_100016813
434 Ga0068862_100148172
435 Ga0081455_10094277
436 Ga0081538_10075280
437 Ga0081539_10000093
438 Ga0081539_10000096
439 Ga0081539_10034576
440 Ga0068871_100056228
441 Ga0075428_100014702
442 Ga0075428_100039246
443 Ga0075428_100069429
444 Ga0075428_100105748
445 Ga0075430_100001515
446 Ga0075430_100005087
447 Ga0075430_100121694
448 Ga0075430_100154354
449 Ga0075431_100002023
450 Ga0075431_100008744
451 Ga0075431_100050946
452 Ga0075431_100060891
453 Ga0075433_10003319
454 Ga0075433_10040540
455 Ga0075433_10049086
456 Ga0075433_10054003
457 Ga0075433_10134956
458 Ga0075434_100003070
459 Ga0075434_100010348
460 Ga0075434_100033083
461 Ga0075434_100099836
462 Ga0075434_100113977
463 Ga0075434_100165335
464 Ga0075429_100004482
465 Ga0075429_100005660
466 Ga0075429_100079515
467 Ga0097620_100007704
468 Ga0097620_100028507
469 Ga0075435_100006588
470 Ga0075435_100079627
471 Ga0111539_10000057
472 Ga0111539_10005130
473 Ga0111539_10011081
474 Ga0111539_10017288
475 Ga0111539_10018455
476 Ga0111539_10070537
477 Ga0111539_10110853
478 Ga0114129_10000309
479 Ga0114129_10002388
480 Ga0114129_10028388
481 Ga0114129_10036552
482 Ga0114129_10043312
483 Ga0114129_10059483
484 Ga0114129_10128423
485 Ga0114129_10148522
486 Ga0114129_10213160
487 Ga0114129_10264077
488 Ga0105248_10006525
489 Ga0105248_10032755
490 Ga0105248_10139778
491 Ga0105249_10132605
492 Ga0105249_10188825
493 Ga0157374_10066097
494 Ga0157378_10029523
495 Ga0163162_10351327
496 Ga0157375_10000002
497 Ga0157375_10003821
498 Ga0157375_10111901
499 Ga0163163_10017097
500 Ga0163163_10063762
501 Ga0157380_10007557
502 Ga0157380_10016721
503 Ga0157380_10019587
504 Ga0157380_10069789
505 Ga0157377_10057917
506 Ga0157379_10081973
507 Ga0157376_10033106
508 Ga0207682_10000853
509 Ga0207682_10002320
510 Ga0207682_10005942
511 Ga0207682_10007759
512 Ga0207688_10001797
513 Ga0207688_10004950
514 Ga0207645_10101334
515 Ga0207643_10001037
516 Ga0207643_10005250
517 Ga0207643_10023211
518 Ga0207643_10025583
519 Ga0207684_10037639
520 Ga0207684_10110574
521 Ga0207662_10007324
522 Ga0207646_10003360
523 Ga0207681_10012507
524 Ga0207650_10013664
525 Ga0207659_10009887
526 Ga0207659_10035071
527 Ga0207659_10135721
528 Ga0207644_10015837
529 Ga0207706_10006060
530 Ga0207706_10086280
531 Ga0207706_10187025
532 Ga0207686_10104313
533 Ga0207669_10158658
534 Ga0207691_10000489
535 Ga0207691_10005230
536 Ga0207691_10016844
537 Ga0207691_10066506
538 Ga0207691_10179987
539 Ga0207711_10049923
540 Ga0207711_10087607
541 Ga0207711_10190745
542 Ga0207711_10193282
543 Ga0207689_10014909
544 Ga0207689_10043948
545 Ga0207689_10153245
546 Ga0207679_10015322
547 Ga0207667_10085308
548 Ga0207651_10016482
549 Ga0207651_10038892
550 Ga0207651_10068364
551 Ga0207651_10131310
552 Ga0207712_10058568
553 Ga0207677_10035779
554 Ga0207703_10099493
555 Ga0207678_10009582
556 Ga0207678_10047697
557 Ga0207708_10024634
558 Ga0207641_10021769
559 Ga0207648_10005223
560 Ga0207676_10080681
561 Ga0207676_10086243
562 Ga0207676_10140844
563 Ga0207675_100003476
564 Ga0207675_100025763
565 Ga0207675_100030849
566 Ga0207675_100114307
567 Ga0207675_100153483
568 Ga0207683_10003196
569 Ga0207683_10109950
570 Ga0207683_10125194
571 Ga0209970_1001035
572 Ga0209983_1000787
573 Ga0209971_1006782
574 Ga0209966_1002062
575 Ga0207428_10000996
576 Ga0207428_10001963
577 Ga0207428_10007649
578 Ga0207428_10060071
579 Ga0268266_10007979
580 Ga0268265_10150215
581 Ga0268264_10023270
582 Ga0268264_10041381
583 Ga0307408_100029915
584 Ga0307408_100216744
585 Ga0307413_10099526
586 Ga0307410_10005717
587 Ga0307410_10017682
588 Ga0307410_10098785
589 Ga0307406_10010691
590 Ga0307407_10010539
591 Ga0307407_10026602
592 Ga0307409_100099389
593 Ga0307416_100010917
594 Ga0307416_100017089
595 Ga0307416_100023236
596 Ga0307416_100157829
597 Ga0307414_10028528
598 Ga0307414_10094542
599 Ga0307414_10158691
600 Ga0395905_0014646
601 Ga0395905_0217411
602 Ga0395901_0160265
603 Ga0451577_0005025
604 Ga0451577_0269252
605 Ga0451577_0359710
606 Ga0453684_0155427
607 Ga0451576_0095542
608 Ga0495580_0000002
609 Ga0495580_0016969
610 Ga0495643_0003815
611 Ga0495663_0051498
612 Ga0495659_0014051
613 Ga0495659_0053018
614 Ga0495659_0057930
615 Ga0495588_0004281
616 Ga0495599_0111229
617 Ga0495647_0028192
618 Ga0495672_0070683
619 Ga0495684_0014791
620 Ga0496113_0167672
621 Ga0501299_009929
622 Ga0501039_0123045
623 Ga0501041_0005036
624 Ga0501042_0005464
625 Ga0501042_0072617
626 Ga0501048_0093235
627 Ga0501074_0064084
628 Ga0501075_0071921
629 Ga0501076_0013370
630 Ga0501076_0060826
631 Ga0501079_0011671
632 Ga0501045_0011672
633 Ga0501045_0161972
634 nmdc:mga05p37_105319_c1
635 nmdc:mga05p37_126524_c1
636 nmdc:mga05p37_148089_c1
637 nmdc:mga05p37_19860_c1
638 nmdc:mga05p37_236558_c1
639 nmdc:mga05p37_279568_c1
640 nmdc:mga05p37_4242_c1
641 nmdc:mga05p37_42511_c1
642 nmdc:mga05p37_52748_c1
643 nmdc:mga05p37_7790_c1
644 nmdc:mga05p37_83643_c1
645 nmdc:mga09592_107494_c1
646 nmdc:mga09592_108605_c1
647 nmdc:mga09592_179985_c1
648 nmdc:mga09592_4534_c1
649 nmdc:mga0qj67_20133_c1
650 nmdc:mga0qj67_4548_c1
651 nmdc:mga06r32_12770_c1
652 nmdc:mga06r32_17107_c1
653 nmdc:mga06r32_39625_c1
654 nmdc:mga08y16_1384_c1
655 nmdc:mga08y16_162_c1
656 nmdc:mga08y16_2776_c1
657 nmdc:mga08y16_60428_c1
658 nmdc:mga0n895_1308_c1
659 nmdc:mga0n895_14381_c1
660 nmdc:mga0n895_194776_c1
661 nmdc:mga0n895_67151_c1
662 nmdc:mga0rr50_21805_c1
663 nmdc:mga0rr50_32180_c1
664 nmdc:mga0rr50_64363_c1
665 nmdc:mga0a205_10299_c1
666 nmdc:mga0a205_130918_c1
667 nmdc:mga0a205_1675_c1
668 nmdc:mga0a205_17368_c1
669 nmdc:mga0a205_3369_c1
670 nmdc:mga0a205_45244_c1
671 Ga0590071_000486
672 Ga0590071_001289
673 Ga0590074_000106
674 Ga0590075_000588
675 Ga0590075_000818
676 Ga0590077_002914
677 Ga0501082_0171735
678 Ga0501082_0190904

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

30

191

0.98

PF01554

MatE

MatE

251

416

0.93

PF03023

MurJ

Lipid II flippase MurJ

21

234

0.86

PF14667

Polysacc_synt_C

Polysaccharide biosynthesis C-terminal domain

144

295

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gwh-assembly1.cif.gz_A outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.9028 14 424
6hfb-assembly3.cif.gz_C outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.901 14 421
4mlb-assembly1.cif.gz_C reverse polarity of binding pocket suggests different function of a mop superfamily transporter from pyrococcus furiosus vc1 (dsm3638) 0.8991 14 417
3vvn-assembly1.cif.gz_A crystal structure of mate in the straight conformation 0.8893 14 417
3w4t-assembly1.cif.gz_A crystal structure of mate p26a mutant 0.8858 14 417
ID Description Score Start End Superfamily
af_Q54YM8_263_426_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9206 254 413 1.20.1250.20
af_P76352_100_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9187 34 187 1.20.1250.20
af_A0A1D6H4R6_249_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9061 255 413 1.20.1250.20
af_P76352_330_491_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.904 251 413 1.20.1250.20
af_Q5N7N1_268_425_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9038 254 411 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3D4YQB5-F1-model_v4 MATE family efflux transporter 0.9738 11 215 GO:0005886
GO:0015297
GO:0042910
AF-A0A7Y2K7A0-F1-model_v4 MATE family efflux transporter 0.9407 33 256 GO:0005886
GO:0015297
GO:0042910
AF-A0A090SEF6-F1-model_v4 deleted 0.9384 22 272
AF-A0A1V6BGF9-F1-model_v4 Multidrug export protein MepA 0.9383 21 257 GO:0005886
GO:0015297
GO:0042910
AF-A0A061ABQ5-F1-model_v4 MATE efflux family protein NorM 0.9312 8 421 GO:0005886
GO:0006811
GO:0015297
GO:0042910

Map