F413820

General Info

Members Datasets Scaffolds Average Seq Length
339 216 678 189

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100769140|Ga0070694_1007691402
Length 197
Sequence MPLPLNVPNLVTLSRIILIPLLIGLYYLPDGTLSEEGKNITATSIFILAGITDWLDGYLARRLNQMSAFGAFLDPVADKLIVVGALVVLLHLEPPRVDALVALIIIGREIAISALREWMAKVGQAKSVAVAFIGKLKTVGQMVAIPLLLFHDRLFGLDCQWLGTILINVAAVLTVISMLYYLRKALPYASVRDIERP

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
128 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
129 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
132 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
152 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
153 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
154 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
158 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100769140 3300005444 Bacteria 788
2 Ga0065707_10019929 3300005295 Bacteria 1668
3 Ga0065707_10231676 3300005295 Bacteria 1186
4 Ga0070690_100000277 3300005330 Bacteria 26309
5 Ga0070670_100396675 3300005331 Bacteria 1218
6 Ga0068869_100000362 3300005334 Bacteria 24432
7 Ga0068869_100139025 3300005334 Bacteria 1874
8 Ga0070680_100012670 3300005336 Bacteria 6554
9 Ga0070680_100032441 3300005336 Bacteria 4204
10 Ga0070682_100149590 3300005337 Bacteria 1601
11 Ga0068868_100003571 3300005338 Bacteria 10831
12 Ga0070689_100023014 3300005340 Bacteria 4659
13 Ga0070691_10000756 3300005341 Bacteria 12780
14 Ga0070692_10001209 3300005345 Bacteria 9161
15 Ga0070692_10034685 3300005345 Bacteria 2550
16 Ga0070669_100043105 3300005353 Bacteria 3285
17 Ga0070669_100324147 3300005353 Bacteria 1245
18 Ga0070675_100305875 3300005354 Bacteria 1402
19 Ga0070674_100112368 3300005356 Bacteria 2002
20 Ga0070674_100459381 3300005356 Bacteria 1053
21 Ga0070703_10019884 3300005406 Bacteria 1950
22 Ga0070710_10023530 3300005437 Bacteria 3240
23 Ga0070701_10065080 3300005438 Bacteria 1934
24 Ga0070701_10334040 3300005438 Bacteria 942
25 Ga0070701_10534324 3300005438 Bacteria 767
26 Ga0070705_100003134 3300005440 Bacteria 8131
27 Ga0070705_100020644 3300005440 Bacteria 3490
28 Ga0070700_100000605 3300005441 Bacteria 17941
29 Ga0070694_100004026 3300005444 Bacteria 8804
30 Ga0070694_100011462 3300005444 Bacteria 5491
31 Ga0070694_100040923 3300005444 Bacteria 3090
32 Ga0070694_100361337 3300005444 Bacteria 1128
33 Ga0070662_100059621 3300005457 Bacteria 2781
34 Ga0070681_10102327 3300005458 Bacteria 2810
35 Ga0068867_100000406 3300005459 Bacteria 29006
36 Ga0068867_100004615 3300005459 Bacteria 9694
37 Ga0068867_100544338 3300005459 Bacteria 1004
38 Ga0070679_100012881 3300005530 Bacteria 8005
39 Ga0070697_100081088 3300005536 Bacteria 2674
40 Ga0068853_100436095 3300005539 Bacteria 1231
41 Ga0070672_100714865 3300005543 Bacteria 878
42 Ga0070686_100004039 3300005544 Bacteria 8070
43 Ga0070695_100002250 3300005545 Bacteria 11049
44 Ga0070695_100034491 3300005545 Bacteria 3173
45 Ga0070696_100001321 3300005546 Bacteria 16168
46 Ga0070696_100056151 3300005546 Bacteria 2746
47 Ga0070696_100080864 3300005546 Bacteria 2301
48 Ga0070696_100663622 3300005546 Bacteria 847
49 Ga0070693_100000483 3300005547 Bacteria 17830
50 Ga0070704_100000068 3300005549 Bacteria 34169
51 Ga0070704_100247729 3300005549 Bacteria 1461
52 Ga0070704_100375349 3300005549 Bacteria 1207
53 Ga0068855_100002155 3300005563 Bacteria 24332
54 Ga0068856_100037369 3300005614 Bacteria 4766
55 Ga0070702_100005707 3300005615 Bacteria 5825
56 Ga0068859_100000543 3300005617 Bacteria 37386
57 Ga0068866_10000166 3300005718 Bacteria 30436
58 Ga0068866_10126669 3300005718 Bacteria 1446
59 Ga0068861_100002341 3300005719 Bacteria 12319
60 Ga0068861_100195907 3300005719 Bacteria 1692
61 Ga0068870_10075880 3300005840 Bacteria 1844
62 Ga0068858_100001484 3300005842 Bacteria 24147
63 Ga0068858_100067436 3300005842 Bacteria 3314
64 Ga0068860_100005557 3300005843 Bacteria 12752
65 Ga0068862_100001621 3300005844 Bacteria 20493
66 Ga0068862_100004960 3300005844 Bacteria 11206
67 Ga0097621_100000836 3300006237 Bacteria 21659
68 Ga0068871_100001789 3300006358 Bacteria 14490
69 Ga0075428_100000527 3300006844 Bacteria 38918
70 Ga0075428_100030383 3300006844 Bacteria 5975
71 Ga0075428_100069393 3300006844 Bacteria 3853
72 Ga0075428_100080556 3300006844 Bacteria 3553
73 Ga0075430_100317217 3300006846 Bacteria 1289
74 Ga0075430_100579706 3300006846 Bacteria 925
75 Ga0075431_100112772 3300006847 Bacteria 2806
76 Ga0075431_100209204 3300006847 Bacteria 1993
77 Ga0075431_100404181 3300006847 Bacteria 1366
78 Ga0075431_100730517 3300006847 Bacteria 966
79 Ga0075433_10006353 3300006852 Bacteria 9342
80 Ga0075434_100000004 3300006871 Bacteria 112839
81 Ga0075434_100002226 3300006871 Bacteria 16934
82 Ga0075429_100017054 3300006880 Bacteria 6280
83 Ga0075429_100022320 3300006880 Bacteria 5489
84 Ga0075429_100052673 3300006880 Bacteria 3541
85 Ga0068865_100000254 3300006881 Bacteria 29586
86 Ga0068865_100413934 3300006881 Bacteria 1107
87 Ga0075436_100002173 3300006914 Bacteria 13516
88 Ga0075436_100026321 3300006914 Bacteria 4005
89 Ga0097620_100000543 3300006931 Bacteria 37386
90 Ga0075435_100000806 3300007076 Bacteria 19514
91 Ga0075435_100020867 3300007076 Bacteria 5029
92 Ga0075435_101003130 3300007076 Bacteria 729
93 Ga0099794_10087431 3300007265 Bacteria 1544
94 Ga0111539_10081294 3300009094 Bacteria 3811
95 Ga0111539_10126270 3300009094 Bacteria 2997
96 Ga0111539_11170452 3300009094 Bacteria 893
97 Ga0111539_11544497 3300009094 Bacteria 770
98 Ga0105245_10001077 3300009098 Bacteria 24735
99 Ga0114129_10026155 3300009147 Bacteria 8264
100 Ga0114129_10046145 3300009147 Bacteria 6124
101 Ga0114129_10103721 3300009147 Bacteria 3931
102 Ga0114129_10453247 3300009147 Bacteria 1682
103 Ga0105243_10000508 3300009148 Bacteria 39703
104 Ga0105243_10004182 3300009148 Bacteria 11444
105 Ga0105243_10139504 3300009148 Bacteria 2066
106 Ga0105243_10979480 3300009148 Bacteria 847
107 Ga0105241_10071080 3300009174 Bacteria 2701
108 Ga0105242_10000746 3300009176 Bacteria 25338
109 Ga0105242_10028600 3300009176 Bacteria 4439
110 Ga0105237_10991242 3300009545 Bacteria 847
111 Ga0105238_10353024 3300009551 Bacteria 1460
112 Ga0105249_10005738 3300009553 Bacteria 10735
113 Ga0105249_10479177 3300009553 Bacteria 1287
114 Ga0105239_10269520 3300010375 Bacteria 1915
115 Ga0157371_10139790 3300013102 Bacteria 1725
116 Ga0157378_10000714 3300013297 Bacteria 31062
117 Ga0163162_11224342 3300013306 Bacteria 852
118 Ga0157380_10479261 3300014326 Bacteria 1203
119 Ga0157377_10099910 3300014745 Bacteria 1727
120 Ga0157377_10271678 3300014745 Bacteria 1107
121 Ga0157376_10007133 3300014969 Bacteria 7936
122 Ga0207692_10126920 3300025898 Bacteria 1436
123 Ga0207642_10000728 3300025899 Bacteria 10170
124 Ga0207688_10049992 3300025901 Bacteria 2339
125 Ga0207647_10288859 3300025904 Bacteria 935
126 Ga0207645_10079927 3300025907 Bacteria 2096
127 Ga0207643_10024298 3300025908 Bacteria 3343
128 Ga0207707_10118851 3300025912 Bacteria 2310
129 Ga0207660_10000830 3300025917 Bacteria 20366
130 Ga0207660_10030138 3300025917 Bacteria 3727
131 Ga0207662_10217738 3300025918 Bacteria 1242
132 Ga0207662_10252078 3300025918 Bacteria 1159
133 Ga0207652_10008174 3300025921 Bacteria 8402
134 Ga0207681_10011674 3300025923 Bacteria 5399
135 Ga0207650_10523662 3300025925 Bacteria 992
136 Ga0207659_10008165 3300025926 Bacteria 6481
137 Ga0207687_10021650 3300025927 Bacteria 4273
138 Ga0207644_10046341 3300025931 Bacteria 3097
139 Ga0207706_10097056 3300025933 Bacteria 2592
140 Ga0207686_10000852 3300025934 Bacteria 18528
141 Ga0207686_10029978 3300025934 Bacteria 3216
142 Ga0207709_10003152 3300025935 Bacteria 9912
143 Ga0207670_10003105 3300025936 Bacteria 8789
144 Ga0207670_10059381 3300025936 Bacteria 2601
145 Ga0207704_10004456 3300025938 Bacteria 6403
146 Ga0207704_10208093 3300025938 Bacteria 1437
147 Ga0207691_10123262 3300025940 Bacteria 2294
148 Ga0207689_10001501 3300025942 Bacteria 22293
149 Ga0207667_10018908 3300025949 Bacteria 7706
150 Ga0207712_10003362 3300025961 Bacteria 10122
151 Ga0207712_10269171 3300025961 Bacteria 1385
152 Ga0207677_10102818 3300026023 Bacteria 2107
153 Ga0207703_10006646 3300026035 Bacteria 9223
154 Ga0207703_10498868 3300026035 Bacteria 1142
155 Ga0207639_10407715 3300026041 Bacteria 1226
156 Ga0207708_10000327 3300026075 Bacteria 37451
157 Ga0207708_10003562 3300026075 Bacteria 11479
158 Ga0207708_10184398 3300026075 Bacteria 1658
159 Ga0207708_10631622 3300026075 Bacteria 910
160 Ga0207702_10146246 3300026078 Bacteria 2145
161 Ga0207702_10418206 3300026078 Bacteria 1296
162 Ga0207648_10000706 3300026089 Bacteria 37476
163 Ga0207648_10000792 3300026089 Bacteria 35602
164 Ga0207674_10357251 3300026116 Bacteria 1412
165 Ga0207675_100000616 3300026118 Bacteria 34778
166 Ga0207675_100116528 3300026118 Bacteria 2525
167 Ga0207675_100612304 3300026118 Bacteria 1093
168 Ga0207683_10093285 3300026121 Bacteria 2683
169 Ga0209967_1034228 3300027364 Bacteria 765
170 Ga0209981_1002133 3300027378 Bacteria 2517
171 Ga0209996_1010870 3300027395 Bacteria 1211
172 Ga0210000_1047613 3300027462 Bacteria 686
173 Ga0209995_1042235 3300027471 Bacteria 771
174 Ga0209999_1045393 3300027543 Bacteria 826
175 Ga0209983_1009006 3300027665 Bacteria 2039
176 Ga0209983_1076533 3300027665 Bacteria 748
177 Ga0209974_10073520 3300027876 Bacteria 1169
178 Ga0207428_10013137 3300027907 Bacteria 7249
179 Ga0207428_10022279 3300027907 Bacteria 5349
180 Ga0207428_10110948 3300027907 Bacteria 2111
181 Ga0207428_10300677 3300027907 Bacteria 1187
182 Ga0268265_10002153 3300028380 Bacteria 15253
183 Ga0268265_10018605 3300028380 Bacteria 4816
184 Ga0268264_10001855 3300028381 Bacteria 19216
185 Ga0265319_1009877 3300028563 Bacteria 4025
186 Ga0265319_1016890 3300028563 Bacteria 2791
187 Ga0265320_10000515 3300031240 Bacteria 29979
188 Ga0307408_100066891 3300031548 Bacteria 2641
189 Ga0307408_100174247 3300031548 Bacteria 1720
190 Ga0316579_10000120 3300031691 Bacteria 21316
191 Ga0316578_10236690 3300031728 Bacteria 1096
192 Ga0307405_10662026 3300031731 Bacteria 860
193 Ga0307406_10222799 3300031901 Bacteria 1403
194 Ga0307407_10646398 3300031903 Bacteria 792
195 Ga0307416_101379942 3300032002 Bacteria 810
196 Ga0307414_10535070 3300032004 Bacteria 1042
197 Ga0307411_10196277 3300032005 Bacteria 1546
198 Ga0307411_10348417 3300032005 Bacteria 1206
199 Ga0316583_10046567 3300032133 Bacteria 1530
200 Ga0373950_0024427 3300034818 Bacteria 1086
201 Ga0373926_0073325 3300035083 Bacteria 1259
202 Ga0373929_0006769 3300035085 Bacteria 2078
203 Ga0373934_0021360 3300035086 Bacteria 2493
204 Ga0373934_0186522 3300035086 Bacteria 853
205 Ga0373944_0005418 3300035089 Bacteria 3361
206 Ga0373952_0020528 3300035092 Bacteria 1385
207 Ga0373923_0246340 3300035111 Bacteria 836
208 Ga0373936_0008546 3300035113 Bacteria 3855
209 Ga0373939_0034309 3300035114 Bacteria 1488
210 Ga0373939_0129220 3300035114 Bacteria 900
211 Ga0373954_0000018 3300035118 Bacteria 62651
212 Ga0373956_0009179 3300035119 Bacteria 4013
213 Ga0373956_0201573 3300035119 Bacteria 943
214 Ga0373943_0217300 3300035170 Bacteria 1063
215 Ga0373946_0006207 3300035171 Bacteria 4328
216 Ga0373955_0008817 3300035172 Bacteria 4701
217 Ga0373961_0094760 3300035241 Bacteria 959
218 Ga0373924_0130324 3300035410 Bacteria 1094
219 Ga0373924_0165304 3300035410 Bacteria 971
220 Ga0373931_0057601 3300035691 Bacteria 2084
221 Ga0373935_0023969 3300035692 Bacteria 3751
222 Ga0373935_0398883 3300035692 Bacteria 988
223 Ga0373927_0037659 3300035695 Bacteria 3142
224 Ga0373933_0007840 3300035724 Bacteria 5833
225 Ga0373933_0010680 3300035724 Bacteria 5035
226 Ga0373947_0151806 3300035725 Bacteria 1492
227 Ga0373947_0303741 3300035725 Bacteria 1064
228 Ga0373937_0001545 3300036401 Bacteria 19332
229 Ga0373937_0103642 3300036401 Bacteria 2642
230 Ga0373937_0240143 3300036401 Bacteria 1707
231 Ga0373937_0332037 3300036401 Bacteria 1439
232 Ga0316584_0120430 3300036712 Bacteria 1961
233 Ga0373925_0029399 3300037068 Bacteria 4032
234 Ga0373925_0035506 3300037068 Bacteria 3678
235 Ga0242420_042986 3300038996 Bacteria 867
236 Ga0439461_0012954 3300041410 Bacteria 1567
237 Ga0439441_002884 3300042001 Bacteria 2470
238 Ga0439441_106797 3300042001 Bacteria 632
239 Ga0439451_044940 3300042009 Bacteria 885
240 Ga0439434_0038688 3300042435 Bacteria 1462
241 Ga0439435_0003149 3300042436 Bacteria 3389
242 Ga0439444_0001195 3300042437 Bacteria 3281
243 Ga0439444_0004540 3300042437 Bacteria 2023
244 Ga0439460_0000698 3300042461 Bacteria 7457
245 Ga0439460_0038070 3300042461 Bacteria 1401
246 Ga0451576_0007141 3300045051 Bacteria 13476
247 Ga0451576_0144701 3300045051 Bacteria 2478
248 Ga0495592_0366099 3300046454 Bacteria 921
249 Ga0495603_0143436 3300046455 Bacteria 1389
250 Ga0495580_0004188 3300046472 Bacteria 12138
251 Ga0495582_0039101 3300046473 Bacteria 2612
252 Ga0495594_0103171 3300046499 Bacteria 1605
253 Ga0495608_0089933 3300046511 Bacteria 1987
254 Ga0495586_0018435 3300046535 Bacteria 3716
255 Ga0495598_0045388 3300046537 Bacteria 1302
256 Ga0495598_0092849 3300046537 Bacteria 987
257 Ga0495656_0005384 3300046615 Bacteria 4415
258 Ga0495588_0076285 3300046674 Bacteria 1747
259 Ga0495657_0063719 3300046675 Bacteria 2431
260 Ga0495647_0006496 3300046681 Bacteria 3877
261 Ga0495624_0341518 3300046690 Bacteria 901
262 Ga0495581_0022629 3300047315 Bacteria 3641
263 Ga0495674_0086786 3300047319 Bacteria 2679
264 Ga0495676_0066220 3300047321 Bacteria 2801
265 Ga0495680_0062641 3300047322 Bacteria 2859
266 Ga0501298_058893 3300049521 Bacteria 810
267 Ga0501299_052123 3300049522 Bacteria 848
268 Ga0501299_063993 3300049522 Bacteria 785
269 Ga0501299_073455 3300049522 Bacteria 747
270 Ga0501031_0034628 3300049568 Bacteria 3296
271 Ga0501031_0064852 3300049568 Bacteria 2379
272 Ga0501031_0166894 3300049568 Bacteria 1439
273 Ga0501033_0003706 3300049570 Bacteria 12433
274 Ga0501034_0008901 3300049571 Bacteria 10550
275 Ga0501036_0037968 3300049572 Bacteria 4075
276 Ga0501036_0119139 3300049572 Bacteria 2229
277 Ga0501038_0006387 3300049574 Bacteria 10916
278 Ga0501039_0004962 3300049575 Bacteria 10094
279 Ga0501039_0596198 3300049575 Bacteria 866
280 Ga0501040_0000262 3300049576 Bacteria 30759
281 Ga0501041_0001364 3300049577 Bacteria 13461
282 Ga0501042_0103960 3300049578 Bacteria 2043
283 Ga0501043_0274281 3300049579 Bacteria 1294
284 Ga0501043_0647470 3300049579 Bacteria 776
285 Ga0501046_0000630 3300049580 Bacteria 34607
286 Ga0501046_0279862 3300049580 Bacteria 1222
287 Ga0501047_0371090 3300049581 Bacteria 1266
288 Ga0501048_0201184 3300049582 Bacteria 1412
289 Ga0501070_0314494 3300049586 Bacteria 1274
290 Ga0501071_0037488 3300049587 Bacteria 3462
291 Ga0501072_0001764 3300049588 Bacteria 16084
292 Ga0501074_0189601 3300049590 Bacteria 1466
293 Ga0501074_0245131 3300049590 Bacteria 1274
294 Ga0501074_0609016 3300049590 Bacteria 772
295 Ga0501075_0006060 3300049591 Bacteria 8295
296 Ga0501076_0008124 3300049592 Bacteria 7675
297 Ga0501077_0002163 3300049593 Bacteria 11874
298 Ga0501077_0373528 3300049593 Bacteria 911
299 Ga0501079_0018465 3300049741 Bacteria 5328
300 Ga0501079_0080357 3300049741 Bacteria 2521
301 Ga0501079_0198972 3300049741 Bacteria 1565
302 Ga0501080_0008641 3300049742 Bacteria 9245
303 Ga0501081_0114834 3300049743 Bacteria 1913
304 Ga0501035_0041043 3300049822 Bacteria 4179
305 Ga0501045_0000167 3300049824 Bacteria 35865
306 Ga0501045_0167530 3300049824 Bacteria 1636
307 nmdc:mga05p37_28380_c1 3300050507 Bacteria 6824
308 nmdc:mga05p37_88382_c1 3300050507 Bacteria 3819
309 nmdc:mga05p37_9963_c1 3300050507 Bacteria 11286
310 nmdc:mga09592_27803_c1 3300050508 Bacteria 4695
311 nmdc:mga09592_49978_c1 3300050508 Bacteria 3526
312 nmdc:mga09592_506_c1 3300050508 Bacteria 29447
313 nmdc:mga0qj67_195902_c1 3300050509 Bacteria 1642
314 nmdc:mga0qj67_257068_c1 3300050509 Bacteria 1417
315 nmdc:mga0qj67_2695_c1 3300050509 Bacteria 12739
316 nmdc:mga0qj67_386691_c1 3300050509 Bacteria 1130
317 nmdc:mga06r32_132845_c1 3300050510 Bacteria 2462
318 nmdc:mga06r32_28499_c1 3300050510 Bacteria 5227
319 nmdc:mga06r32_522476_c1 3300050510 Bacteria 1163
320 nmdc:mga06r32_81743_c1 3300050510 Bacteria 3147
321 nmdc:mga08y16_1452829_c1 3300050511 Bacteria 647
322 nmdc:mga08y16_173412_c1 3300050511 Bacteria 2240
323 nmdc:mga08y16_28027_c1 3300050511 Bacteria 5938
324 nmdc:mga08y16_412169_c1 3300050511 Bacteria 1382
325 nmdc:mga08y16_415875_c1 3300050511 Bacteria 1375
326 nmdc:mga0n895_1352_c1 3300050512 Bacteria 18198
327 nmdc:mga0n895_3882_c1 3300050512 Bacteria 12141
328 nmdc:mga0rr50_2379_c1 3300050513 Bacteria 10582
329 nmdc:mga0rr50_48209_c1 3300050513 Bacteria 3148
330 nmdc:mga0rr50_835725_c1 3300050513 Bacteria 785
331 nmdc:mga08x19_10070_c1 3300050514 Bacteria 5669
332 nmdc:mga08x19_87369_c1 3300050514 Bacteria 2054
333 nmdc:mga0a205_10546_c1 3300050515 Bacteria 8491
334 nmdc:mga0a205_1240571_c1 3300050515 Bacteria 593
335 Ga0495595_0107979 3300053084 Bacteria 1348
336 Ga0501084_0001772 3300054114 Bacteria 17179
337 Ga0501084_0039709 3300054114 Bacteria 3936
338 Ga0501082_0006958 3300060353 Bacteria 9771
339 Ga0530510_0000026 3300061734 Bacteria 67071
340 Ga0070694_100769140
341 Ga0065707_10019929
342 Ga0065707_10231676
343 Ga0070690_100000277
344 Ga0070670_100396675
345 Ga0068869_100000362
346 Ga0068869_100139025
347 Ga0070680_100012670
348 Ga0070680_100032441
349 Ga0070682_100149590
350 Ga0068868_100003571
351 Ga0070689_100023014
352 Ga0070691_10000756
353 Ga0070692_10001209
354 Ga0070692_10034685
355 Ga0070669_100043105
356 Ga0070669_100324147
357 Ga0070675_100305875
358 Ga0070674_100112368
359 Ga0070674_100459381
360 Ga0070703_10019884
361 Ga0070710_10023530
362 Ga0070701_10065080
363 Ga0070701_10334040
364 Ga0070701_10534324
365 Ga0070705_100003134
366 Ga0070705_100020644
367 Ga0070700_100000605
368 Ga0070694_100004026
369 Ga0070694_100011462
370 Ga0070694_100040923
371 Ga0070694_100361337
372 Ga0070662_100059621
373 Ga0070681_10102327
374 Ga0068867_100000406
375 Ga0068867_100004615
376 Ga0068867_100544338
377 Ga0070679_100012881
378 Ga0070697_100081088
379 Ga0068853_100436095
380 Ga0070672_100714865
381 Ga0070686_100004039
382 Ga0070695_100002250
383 Ga0070695_100034491
384 Ga0070696_100001321
385 Ga0070696_100056151
386 Ga0070696_100080864
387 Ga0070696_100663622
388 Ga0070693_100000483
389 Ga0070704_100000068
390 Ga0070704_100247729
391 Ga0070704_100375349
392 Ga0068855_100002155
393 Ga0068856_100037369
394 Ga0070702_100005707
395 Ga0068859_100000543
396 Ga0068866_10000166
397 Ga0068866_10126669
398 Ga0068861_100002341
399 Ga0068861_100195907
400 Ga0068870_10075880
401 Ga0068858_100001484
402 Ga0068858_100067436
403 Ga0068860_100005557
404 Ga0068862_100001621
405 Ga0068862_100004960
406 Ga0097621_100000836
407 Ga0068871_100001789
408 Ga0075428_100000527
409 Ga0075428_100030383
410 Ga0075428_100069393
411 Ga0075428_100080556
412 Ga0075430_100317217
413 Ga0075430_100579706
414 Ga0075431_100112772
415 Ga0075431_100209204
416 Ga0075431_100404181
417 Ga0075431_100730517
418 Ga0075433_10006353
419 Ga0075434_100000004
420 Ga0075434_100002226
421 Ga0075429_100017054
422 Ga0075429_100022320
423 Ga0075429_100052673
424 Ga0068865_100000254
425 Ga0068865_100413934
426 Ga0075436_100002173
427 Ga0075436_100026321
428 Ga0097620_100000543
429 Ga0075435_100000806
430 Ga0075435_100020867
431 Ga0075435_101003130
432 Ga0099794_10087431
433 Ga0111539_10081294
434 Ga0111539_10126270
435 Ga0111539_11170452
436 Ga0111539_11544497
437 Ga0105245_10001077
438 Ga0114129_10026155
439 Ga0114129_10046145
440 Ga0114129_10103721
441 Ga0114129_10453247
442 Ga0105243_10000508
443 Ga0105243_10004182
444 Ga0105243_10139504
445 Ga0105243_10979480
446 Ga0105241_10071080
447 Ga0105242_10000746
448 Ga0105242_10028600
449 Ga0105237_10991242
450 Ga0105238_10353024
451 Ga0105249_10005738
452 Ga0105249_10479177
453 Ga0105239_10269520
454 Ga0157371_10139790
455 Ga0157378_10000714
456 Ga0163162_11224342
457 Ga0157380_10479261
458 Ga0157377_10099910
459 Ga0157377_10271678
460 Ga0157376_10007133
461 Ga0207692_10126920
462 Ga0207642_10000728
463 Ga0207688_10049992
464 Ga0207647_10288859
465 Ga0207645_10079927
466 Ga0207643_10024298
467 Ga0207707_10118851
468 Ga0207660_10000830
469 Ga0207660_10030138
470 Ga0207662_10217738
471 Ga0207662_10252078
472 Ga0207652_10008174
473 Ga0207681_10011674
474 Ga0207650_10523662
475 Ga0207659_10008165
476 Ga0207687_10021650
477 Ga0207644_10046341
478 Ga0207706_10097056
479 Ga0207686_10000852
480 Ga0207686_10029978
481 Ga0207709_10003152
482 Ga0207670_10003105
483 Ga0207670_10059381
484 Ga0207704_10004456
485 Ga0207704_10208093
486 Ga0207691_10123262
487 Ga0207689_10001501
488 Ga0207667_10018908
489 Ga0207712_10003362
490 Ga0207712_10269171
491 Ga0207677_10102818
492 Ga0207703_10006646
493 Ga0207703_10498868
494 Ga0207639_10407715
495 Ga0207708_10000327
496 Ga0207708_10003562
497 Ga0207708_10184398
498 Ga0207708_10631622
499 Ga0207702_10146246
500 Ga0207702_10418206
501 Ga0207648_10000706
502 Ga0207648_10000792
503 Ga0207674_10357251
504 Ga0207675_100000616
505 Ga0207675_100116528
506 Ga0207675_100612304
507 Ga0207683_10093285
508 Ga0209967_1034228
509 Ga0209981_1002133
510 Ga0209996_1010870
511 Ga0210000_1047613
512 Ga0209995_1042235
513 Ga0209999_1045393
514 Ga0209983_1009006
515 Ga0209983_1076533
516 Ga0209974_10073520
517 Ga0207428_10013137
518 Ga0207428_10022279
519 Ga0207428_10110948
520 Ga0207428_10300677
521 Ga0268265_10002153
522 Ga0268265_10018605
523 Ga0268264_10001855
524 Ga0265319_1009877
525 Ga0265319_1016890
526 Ga0265320_10000515
527 Ga0307408_100066891
528 Ga0307408_100174247
529 Ga0316579_10000120
530 Ga0316578_10236690
531 Ga0307405_10662026
532 Ga0307406_10222799
533 Ga0307407_10646398
534 Ga0307416_101379942
535 Ga0307414_10535070
536 Ga0307411_10196277
537 Ga0307411_10348417
538 Ga0316583_10046567
539 Ga0373950_0024427
540 Ga0373926_0073325
541 Ga0373929_0006769
542 Ga0373934_0021360
543 Ga0373934_0186522
544 Ga0373944_0005418
545 Ga0373952_0020528
546 Ga0373923_0246340
547 Ga0373936_0008546
548 Ga0373939_0034309
549 Ga0373939_0129220
550 Ga0373954_0000018
551 Ga0373956_0009179
552 Ga0373956_0201573
553 Ga0373943_0217300
554 Ga0373946_0006207
555 Ga0373955_0008817
556 Ga0373961_0094760
557 Ga0373924_0130324
558 Ga0373924_0165304
559 Ga0373931_0057601
560 Ga0373935_0023969
561 Ga0373935_0398883
562 Ga0373927_0037659
563 Ga0373933_0007840
564 Ga0373933_0010680
565 Ga0373947_0151806
566 Ga0373947_0303741
567 Ga0373937_0001545
568 Ga0373937_0103642
569 Ga0373937_0240143
570 Ga0373937_0332037
571 Ga0316584_0120430
572 Ga0373925_0029399
573 Ga0373925_0035506
574 Ga0242420_042986
575 Ga0439461_0012954
576 Ga0439441_002884
577 Ga0439441_106797
578 Ga0439451_044940
579 Ga0439434_0038688
580 Ga0439435_0003149
581 Ga0439444_0001195
582 Ga0439444_0004540
583 Ga0439460_0000698
584 Ga0439460_0038070
585 Ga0451576_0007141
586 Ga0451576_0144701
587 Ga0495592_0366099
588 Ga0495603_0143436
589 Ga0495580_0004188
590 Ga0495582_0039101
591 Ga0495594_0103171
592 Ga0495608_0089933
593 Ga0495586_0018435
594 Ga0495598_0045388
595 Ga0495598_0092849
596 Ga0495656_0005384
597 Ga0495588_0076285
598 Ga0495657_0063719
599 Ga0495647_0006496
600 Ga0495624_0341518
601 Ga0495581_0022629
602 Ga0495674_0086786
603 Ga0495676_0066220
604 Ga0495680_0062641
605 Ga0501298_058893
606 Ga0501299_052123
607 Ga0501299_063993
608 Ga0501299_073455
609 Ga0501031_0034628
610 Ga0501031_0064852
611 Ga0501031_0166894
612 Ga0501033_0003706
613 Ga0501034_0008901
614 Ga0501036_0037968
615 Ga0501036_0119139
616 Ga0501038_0006387
617 Ga0501039_0004962
618 Ga0501039_0596198
619 Ga0501040_0000262
620 Ga0501041_0001364
621 Ga0501042_0103960
622 Ga0501043_0274281
623 Ga0501043_0647470
624 Ga0501046_0000630
625 Ga0501046_0279862
626 Ga0501047_0371090
627 Ga0501048_0201184
628 Ga0501070_0314494
629 Ga0501071_0037488
630 Ga0501072_0001764
631 Ga0501074_0189601
632 Ga0501074_0245131
633 Ga0501074_0609016
634 Ga0501075_0006060
635 Ga0501076_0008124
636 Ga0501077_0002163
637 Ga0501077_0373528
638 Ga0501079_0018465
639 Ga0501079_0080357
640 Ga0501079_0198972
641 Ga0501080_0008641
642 Ga0501081_0114834
643 Ga0501035_0041043
644 Ga0501045_0000167
645 Ga0501045_0167530
646 nmdc:mga05p37_28380_c1
647 nmdc:mga05p37_88382_c1
648 nmdc:mga05p37_9963_c1
649 nmdc:mga09592_27803_c1
650 nmdc:mga09592_49978_c1
651 nmdc:mga09592_506_c1
652 nmdc:mga0qj67_195902_c1
653 nmdc:mga0qj67_257068_c1
654 nmdc:mga0qj67_2695_c1
655 nmdc:mga0qj67_386691_c1
656 nmdc:mga06r32_132845_c1
657 nmdc:mga06r32_28499_c1
658 nmdc:mga06r32_522476_c1
659 nmdc:mga06r32_81743_c1
660 nmdc:mga08y16_1452829_c1
661 nmdc:mga08y16_173412_c1
662 nmdc:mga08y16_28027_c1
663 nmdc:mga08y16_412169_c1
664 nmdc:mga08y16_415875_c1
665 nmdc:mga0n895_1352_c1
666 nmdc:mga0n895_3882_c1
667 nmdc:mga0rr50_2379_c1
668 nmdc:mga0rr50_48209_c1
669 nmdc:mga0rr50_835725_c1
670 nmdc:mga08x19_10070_c1
671 nmdc:mga08x19_87369_c1
672 nmdc:mga0a205_10546_c1
673 nmdc:mga0a205_1240571_c1
674 Ga0495595_0107979
675 Ga0501084_0001772
676 Ga0501084_0039709
677 Ga0501082_0006958
678 Ga0530510_0000026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

5

176

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7894 4 182
7drk-assembly1.cif.gz_B crystal structure of phosphatidylglycerol phosphate synthase in complex with cytidine diphosphate-diacylglycerol 0.7626 4 182
5d91-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7372 6 188
5d92-assembly2.cif.gz_B structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.731 4 188
5d92-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.7113 6 188
ID Description Score Start End Superfamily
af_P9WPG3_21_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9018 6 185 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.9011 4 183 1.20.120.1760
af_P9WPG5_6_192_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8889 2 189 1.20.120.1760
af_A0A1D6JYP0_117_317_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8765 3 187 1.20.120.1760
af_P0ABF8_3_179_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8719 4 183 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A1S3QYL7-F1-model_v4 cardiolipin synthase (CMP-forming) (EC 2.7.8.41) 0.973 4 171 GO:0008444
GO:0016020
GO:0046474
AF-A0A6L6YGA9-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.968 1 190 GO:0008444
GO:0016020
GO:0046474
AF-A0A536Y5A3-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9673 1 162 GO:0008444
GO:0016020
GO:0046474
AF-A0A537BT42-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9653 1 191 GO:0008444
GO:0016020
GO:0046474
AF-R6A4F5-F1-model_v4 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5) 0.9641 4 190 GO:0008444
GO:0016020
GO:0046474

Map