F413608

General Info

Members Datasets Scaffolds Average Seq Length
338 156 676 295

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_21985|Ga0400485_21985_2302_3333
Length 343
Sequence VGKLYDVYRIKVGAADYYAERQWGARRPPYKFESFERRYNKMTAQLIKGTEIREQILEEITAEVAKIKEKHGVVPGLVTILVGENPASISYVTLKIKTAHRVGFNEIQDTQSVDISEADLLALIDKYNKDESINGILVQLPLPKHIDEKKVLNAIDPDKDVDGFHPVNVGRLMIGGDEVKFAPCTPAGIQEMIVRAGVETKGAEVVVVGRSNIVGKPIANMMLQKGAGANSTVTIVHTGTKDLAGHCQRADILIVAAGVPGLVKPEWIKAGACVIDVGVNRVGEKISEKTGKKIAVLRGDVDFDAAKEIAGYITPVPGGVGPMTITMLMLNTLKSLKFKLGIE

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
97 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
98 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
99 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
110 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
111 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
112 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
113 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
114 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
115 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
116 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
117 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.49
Metatranscriptomes 6.21
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_21985 3300038735 Bacteria 3636
2 JGI25406J46586_10032672 3300003203 Bacteria 1931
3 Ga0065715_10113880 3300005293 Bacteria 2472
4 Ga0065707_10148110 3300005295 Bacteria 1690
5 Ga0070676_10037077 3300005328 Bacteria 2811
6 Ga0070670_100265171 3300005331 Bacteria 1498
7 Ga0070680_100015057 3300005336 Bacteria 6054
8 Ga0070682_100165478 3300005337 Bacteria 1532
9 Ga0068868_100048795 3300005338 Bacteria 3321
10 Ga0070689_100128050 3300005340 Bacteria 2034
11 Ga0070691_10034506 3300005341 Bacteria 2382
12 Ga0070661_100165628 3300005344 Bacteria 1676
13 Ga0070668_100318141 3300005347 Bacteria 1309
14 Ga0070669_100052184 3300005353 Bacteria 2991
15 Ga0070667_100028885 3300005367 Bacteria 4617
16 Ga0070703_10072154 3300005406 Bacteria 1156
17 Ga0070714_100001187 3300005435 Bacteria 18748
18 Ga0070714_100335799 3300005435 Bacteria 1416
19 Ga0070694_100404862 3300005444 Unclassified 1069
20 Ga0070708_100000308 3300005445 Bacteria 36695
21 Ga0070681_10022100 3300005458 Bacteria 6384
22 Ga0070681_10027053 3300005458 Bacteria 5767
23 Ga0070681_10085452 3300005458 Bacteria 3107
24 Ga0070681_10324175 3300005458 Bacteria 1450
25 Ga0070706_100085298 3300005467 Bacteria 2926
26 Ga0070707_100005242 3300005468 Bacteria 12130
27 Ga0070698_100176085 3300005471 Bacteria 2078
28 Ga0070698_100214886 3300005471 Bacteria 1857
29 Ga0070699_100110146 3300005518 Bacteria 2417
30 Ga0070699_100420754 3300005518 Bacteria 1209
31 Ga0070679_100025413 3300005530 Bacteria 5811
32 Ga0070679_100038759 3300005530 Bacteria 4738
33 Ga0070679_100045042 3300005530 Bacteria 4395
34 Ga0070679_100072074 3300005530 Bacteria 3446
35 Ga0070679_100353070 3300005530 Bacteria 1418
36 Ga0070679_100377245 3300005530 Bacteria 1365
37 Ga0070684_100025814 3300005535 Bacteria 4942
38 Ga0070697_100026777 3300005536 Bacteria 4610
39 Ga0068853_100211723 3300005539 Bacteria 1767
40 Ga0070686_100016182 3300005544 Bacteria 4336
41 Ga0070696_100098312 3300005546 Bacteria 2093
42 Ga0070693_100105048 3300005547 Bacteria 1727
43 Ga0070704_100033502 3300005549 Bacteria 3474
44 Ga0068855_100372583 3300005563 Bacteria 1569
45 Ga0070664_100011418 3300005564 Bacteria 7206
46 Ga0070664_100026909 3300005564 Bacteria 4777
47 Ga0081539_10000261 3300005985 Bacteria 121256
48 Ga0075436_100050901 3300006914 Bacteria 2858
49 Ga0075435_100198599 3300007076 Bacteria 1699
50 Ga0105245_10302475 3300009098 Bacteria 1570
51 Ga0105241_10010375 3300009174 Bacteria 6836
52 Ga0105241_10540824 3300009174 Bacteria 1044
53 Ga0105242_10217825 3300009176 Bacteria 1704
54 Ga0157373_10210249 3300013100 Bacteria 1372
55 Ga0157371_10119466 3300013102 Bacteria 1874
56 Ga0157370_10010970 3300013104 Bacteria 9508
57 Ga0157378_10019948 3300013297 Bacteria 5895
58 Ga0157378_10032972 3300013297 Bacteria 4578
59 Ga0163162_10421023 3300013306 Bacteria 1468
60 Ga0157372_10388547 3300013307 Unclassified 1626
61 Ga0207692_10145931 3300025898 Bacteria 1350
62 Ga0207645_10045557 3300025907 Bacteria 2803
63 Ga0207684_10053019 3300025910 Bacteria 3443
64 Ga0207684_10126665 3300025910 Bacteria 2192
65 Ga0207707_10031084 3300025912 Bacteria 4671
66 Ga0207707_10149093 3300025912 Bacteria 2045
67 Ga0207663_10072612 3300025916 Bacteria 2225
68 Ga0207660_10067438 3300025917 Bacteria 2591
69 Ga0207660_10097143 3300025917 Bacteria 2194
70 Ga0207649_10167333 3300025920 Bacteria 1528
71 Ga0207652_10227399 3300025921 Bacteria 1681
72 Ga0207652_10228218 3300025921 Bacteria 1678
73 Ga0207646_10006631 3300025922 Bacteria 11938
74 Ga0207646_10063707 3300025922 Bacteria 3291
75 Ga0207664_10104663 3300025929 Bacteria 2344
76 Ga0207706_10041851 3300025933 Bacteria 4060
77 Ga0207670_10234639 3300025936 Bacteria 1410
78 Ga0207661_10059783 3300025944 Bacteria 3072
79 Ga0207679_10018198 3300025945 Bacteria 4703
80 Ga0207651_10012426 3300025960 Bacteria 4819
81 Ga0207640_10101126 3300025981 Bacteria 2022
82 Ga0207677_10249672 3300026023 Bacteria 1440
83 Ga0207639_10077189 3300026041 Bacteria 2625
84 Ga0207678_10326713 3300026067 Bacteria 1320
85 Ga0207648_10025571 3300026089 Bacteria 5257
86 Ga0265337_1000559 3300028556 Bacteria 19577
87 Ga0265337_1018000 3300028556 Bacteria 2252
88 Ga0265326_10000430 3300028558 Bacteria 16586
89 Ga0265319_1000195 3300028563 Bacteria 46017
90 Ga0265319_1001022 3300028563 Bacteria 17495
91 Ga0265334_10043491 3300028573 Bacteria 1748
92 Ga0265318_10003449 3300028577 Bacteria 7937
93 Ga0265323_10000802 3300028653 Bacteria 16863
94 Ga0265323_10005478 3300028653 Bacteria 5391
95 Ga0265323_10007714 3300028653 Bacteria 4456
96 Ga0265323_10034365 3300028653 Bacteria 1873
97 Ga0265322_10000412 3300028654 Bacteria 17552
98 Ga0265336_10000067 3300028666 Bacteria 93268
99 Ga0265338_10000126 3300028800 Bacteria 140495
100 Ga0265338_10000612 3300028800 Bacteria 62574
101 Ga0265338_10001417 3300028800 Bacteria 39003
102 Ga0265338_10031609 3300028800 Bacteria 5186
103 Ga0265324_10001309 3300029957 Bacteria 14623
104 Ga0265324_10016676 3300029957 Bacteria 2677
105 Ga0265330_10002985 3300031235 Bacteria 9000
106 Ga0265330_10015770 3300031235 Bacteria 3491
107 Ga0265332_10001796 3300031238 Bacteria 11535
108 Ga0265332_10002961 3300031238 Bacteria 8340
109 Ga0265332_10049177 3300031238 Bacteria 1814
110 Ga0265328_10005492 3300031239 Bacteria 5428
111 Ga0265320_10000946 3300031240 Bacteria 21662
112 Ga0265320_10003121 3300031240 Bacteria 11245
113 Ga0265325_10082337 3300031241 Bacteria 1597
114 Ga0265329_10001663 3300031242 Bacteria 10653
115 Ga0265327_10051719 3300031251 Bacteria 2143
116 Ga0265316_10003319 3300031344 Bacteria 16310
117 Ga0265316_10005654 3300031344 Bacteria 12098
118 Ga0265316_10008240 3300031344 Bacteria 9700
119 Ga0265316_10009318 3300031344 Bacteria 9046
120 Ga0265316_10017488 3300031344 Bacteria 6192
121 Ga0265316_10020683 3300031344 Bacteria 5594
122 Ga0265316_10024529 3300031344 Bacteria 5050
123 Ga0265316_10043445 3300031344 Bacteria 3581
124 Ga0265316_10054633 3300031344 Bacteria 3126
125 Ga0265313_10001625 3300031595 Bacteria 20858
126 Ga0316575_10010308 3300031665 Bacteria 3430
127 Ga0316575_10024833 3300031665 Bacteria 2321
128 Ga0316575_10025129 3300031665 Bacteria 2308
129 Ga0316575_10027674 3300031665 Bacteria 2206
130 Ga0316575_10038864 3300031665 Bacteria 1877
131 Ga0316579_10000598 3300031691 Bacteria 12114
132 Ga0316579_10003797 3300031691 Bacteria 5948
133 Ga0316579_10011900 3300031691 Bacteria 3712
134 Ga0316579_10019453 3300031691 Bacteria 3001
135 Ga0316579_10066764 3300031691 Bacteria 1699
136 Ga0316579_10095862 3300031691 Bacteria 1418
137 Ga0265314_10000893 3300031711 Bacteria 35529
138 Ga0265342_10007076 3300031712 Bacteria 8268
139 Ga0265342_10044341 3300031712 Bacteria 2681
140 Ga0265342_10091107 3300031712 Bacteria 1748
141 Ga0316576_10001795 3300031727 Bacteria 11881
142 Ga0316576_10001871 3300031727 Bacteria 11705
143 Ga0316576_10001890 3300031727 Bacteria 11649
144 Ga0316576_10011340 3300031727 Bacteria 5837
145 Ga0316576_10029804 3300031727 Bacteria 3860
146 Ga0316576_10031971 3300031727 Bacteria 3738
147 Ga0316576_10046782 3300031727 Bacteria 3133
148 Ga0316576_10060046 3300031727 Bacteria 2784
149 Ga0316576_10228800 3300031727 Bacteria 1398
150 Ga0316578_10000240 3300031728 Bacteria 16234
151 Ga0316578_10004452 3300031728 Bacteria 6620
152 Ga0316578_10157627 3300031728 Bacteria 1368
153 Ga0316577_10001841 3300031733 Bacteria 10244
154 Ga0316577_10002618 3300031733 Bacteria 8948
155 Ga0316577_10026635 3300031733 Bacteria 3220
156 Ga0316577_10032107 3300031733 Bacteria 2933
157 Ga0316577_10058411 3300031733 Bacteria 2154
158 Ga0316577_10090317 3300031733 Bacteria 1715
159 Ga0316577_10126051 3300031733 Bacteria 1440
160 Ga0316577_10222895 3300031733 Bacteria 1066
161 Ga0316577_10265333 3300031733 Bacteria 971
162 Ga0307412_10146592 3300031911 Bacteria 1736
163 Ga0307409_100311931 3300031995 Bacteria 1468
164 Ga0307411_10137833 3300032005 Bacteria 1795
165 Ga0316583_10003881 3300032133 Bacteria 5309
166 Ga0316583_10009190 3300032133 Bacteria 3563
167 Ga0316583_10013212 3300032133 Bacteria 2979
168 Ga0316583_10013586 3300032133 Bacteria 2939
169 Ga0316583_10018437 3300032133 Bacteria 2505
170 Ga0316583_10022297 3300032133 Bacteria 2267
171 Ga0316583_10033383 3300032133 Bacteria 1828
172 Ga0316583_10037338 3300032133 Bacteria 1722
173 Ga0316583_10069714 3300032133 Bacteria 1230
174 Ga0316585_10000056 3300032137 Bacteria 18155
175 Ga0316585_10002920 3300032137 Bacteria 4670
176 Ga0316585_10011411 3300032137 Bacteria 2621
177 Ga0316585_10018928 3300032137 Bacteria 2095
178 Ga0316585_10050698 3300032137 Bacteria 1333
179 Ga0316580_10002181 3300032139 Bacteria 5335
180 Ga0316580_10002777 3300032139 Bacteria 4881
181 Ga0316580_10004002 3300032139 Bacteria 4241
182 Ga0316580_10009867 3300032139 Bacteria 2874
183 Ga0316580_10034817 3300032139 Bacteria 1558
184 Ga0316593_10025961 3300032168 Bacteria 1870
185 Ga0316593_10089337 3300032168 Bacteria 1084
186 Ga0316593_10098151 3300032168 Bacteria 1037
187 Ga0316593_10107700 3300032168 Bacteria 993
188 Ga0316593_10114075 3300032168 Bacteria 966
189 Ga0316586_1005311 3300033527 Bacteria 1804
190 Ga0316586_1015178 3300033527 Bacteria 1223
191 Ga0316586_1023310 3300033527 Bacteria 1033
192 Ga0316588_1000033 3300033528 Bacteria 10146
193 Ga0316588_1009994 3300033528 Bacteria 1990
194 Ga0316588_1013761 3300033528 Bacteria 1761
195 Ga0316588_1017884 3300033528 Bacteria 1583
196 Ga0316588_1019124 3300033528 Bacteria 1540
197 Ga0316588_1045447 3300033528 Bacteria 1057
198 Ga0316588_1048751 3300033528 Bacteria 1025
199 Ga0316587_1025397 3300033529 Bacteria 1029
200 Ga0316587_1027003 3300033529 Bacteria 1003
201 Ga0316596_1027503 3300033541 Bacteria 1468
202 Ga0316596_1050937 3300033541 Bacteria 1095
203 Ga0316596_1054276 3300033541 Bacteria 1063
204 Ga0316596_1059748 3300033541 Bacteria 1016
205 Ga0373944_0042716 3300035089 Bacteria 1407
206 Ga0373943_0030214 3300035170 Bacteria 2564
207 Ga0316574_0000449 3300035398 Bacteria 16485
208 Ga0316574_0001749 3300035398 Bacteria 10517
209 Ga0316574_0003291 3300035398 Bacteria 8307
210 Ga0316574_0024752 3300035398 Bacteria 3596
211 Ga0316574_0027879 3300035398 Bacteria 3402
212 Ga0316574_0050288 3300035398 Bacteria 2594
213 Ga0316574_0052233 3300035398 Bacteria 2548
214 Ga0316574_0276418 3300035398 Bacteria 1070
215 Ga0316582_0001098 3300036647 Bacteria 11408
216 Ga0316582_0005024 3300036647 Bacteria 6760
217 Ga0316582_0005332 3300036647 Bacteria 6608
218 Ga0316582_0005408 3300036647 Bacteria 6575
219 Ga0316582_0012125 3300036647 Bacteria 4797
220 Ga0316582_0022810 3300036647 Bacteria 3722
221 Ga0316582_0027430 3300036647 Bacteria 3440
222 Ga0316582_0038234 3300036647 Bacteria 2981
223 Ga0316582_0051931 3300036647 Bacteria 2604
224 Ga0316582_0074336 3300036647 Bacteria 2206
225 Ga0316582_0134887 3300036647 Bacteria 1661
226 Ga0316582_0287909 3300036647 Bacteria 1128
227 Ga0316582_0295372 3300036647 Bacteria 1113
228 Ga0316584_0000912 3300036712 Bacteria 16822
229 Ga0316584_0001733 3300036712 Bacteria 13386
230 Ga0316584_0003938 3300036712 Bacteria 9756
231 Ga0316584_0005091 3300036712 Bacteria 8768
232 Ga0316584_0010779 3300036712 Bacteria 6400
233 Ga0316584_0011773 3300036712 Bacteria 6157
234 Ga0316584_0013862 3300036712 Bacteria 5718
235 Ga0316584_0028311 3300036712 Bacteria 4131
236 Ga0316584_0035295 3300036712 Bacteria 3710
237 Ga0316584_0049533 3300036712 Bacteria 3140
238 Ga0316584_0087170 3300036712 Bacteria 2337
239 Ga0316584_0089635 3300036712 Bacteria 2303
240 Ga0316584_0144502 3300036712 Bacteria 1773
241 Ga0316584_0233707 3300036712 Bacteria 1347
242 Ga0316584_0255091 3300036712 Bacteria 1280
243 Ga0316584_0301605 3300036712 Bacteria 1160
244 Ga0316584_0349939 3300036712 Bacteria 1061
245 Ga0316581_0033388 3300037588 Bacteria 1555
246 Ga0316581_0036997 3300037588 Bacteria 1482
247 Ga0316581_0079933 3300037588 Bacteria 1006
248 Ga0400484_29949 3300038725 Bacteria 8166
249 Ga0400490_13851 3300038726 Bacteria 2659
250 Ga0400490_26700 3300038726 Bacteria 16276
251 Ga0400490_30478 3300038726 Bacteria 3533
252 Ga0400491_14784 3300038727 Bacteria 2782
253 Ga0400485_03194 3300038735 Bacteria 2466
254 Ga0400485_14777 3300038735 Bacteria 21061
255 Ga0400488_41040 3300038741 Bacteria 5253
256 Ga0400488_41500 3300038741 Bacteria 9989
257 Ga0400488_60968 3300038741 Bacteria 4771
258 Ga0400488_63662 3300038741 Bacteria 5622
259 Ga0400486_02085 3300038742 Bacteria 25117
260 Ga0400486_15387 3300038742 Bacteria 13546
261 Ga0400486_16162 3300038742 Bacteria 14808
262 Ga0400486_22630 3300038742 Bacteria 21629
263 Ga0400483_008525 3300039062 Bacteria 9492
264 Ga0400483_021534 3300039062 Bacteria 3706
265 Ga0400483_027424 3300039062 Bacteria 3975
266 Ga0400483_071908 3300039062 Bacteria 11244
267 Ga0400483_204226 3300039062 Bacteria 3426
268 Ga0400483_232415 3300039062 Bacteria 1477
269 Ga0400483_279390 3300039062 Bacteria 1392
270 Ga0400483_282195 3300039062 Bacteria 9869
271 Ga0400489_10290 3300039093 Bacteria 15334
272 Ga0400489_12948 3300039093 Bacteria 15166
273 Ga0400489_19306 3300039093 Bacteria 1486
274 Ga0400489_23168 3300039093 Bacteria 1036
275 Ga0400489_25882 3300039093 Bacteria 4498
276 Ga0400489_54455 3300039093 Bacteria 62028
277 Ga0400489_86539 3300039093 Bacteria 12592
278 Ga0400487_07508 3300039110 Bacteria 36752
279 Ga0400487_30347 3300039110 Bacteria 1172
280 Ga0400487_35200 3300039110 Bacteria 8148
281 Ga0400487_36967 3300039110 Bacteria 1581
282 Ga0400487_40723 3300039110 Bacteria 1670
283 Ga0451577_0000181 3300042876 Bacteria 134503
284 Ga0451577_0000741 3300042876 Bacteria 50246
285 Ga0451577_0001270 3300042876 Bacteria 34801
286 Ga0451577_0010274 3300042876 Bacteria 8961
287 Ga0451577_0459930 3300042876 Bacteria 1156
288 Ga0453683_0000955 3300044673 Bacteria 27499
289 Ga0453683_0009601 3300044673 Bacteria 6453
290 Ga0453684_0000039 3300044712 Bacteria 697730
291 Ga0453684_0000592 3300044712 Bacteria 134503
292 Ga0453684_0003605 3300044712 Bacteria 34545
293 Ga0453684_0004830 3300044712 Bacteria 27679
294 Ga0453684_0056960 3300044712 Bacteria 5065
295 Ga0453684_0160197 3300044712 Bacteria 2662
296 Ga0453684_0260918 3300044712 Bacteria 1985
297 Ga0453684_0275929 3300044712 Bacteria 1919
298 Ga0453684_0364228 3300044712 Bacteria 1627
299 Ga0451576_0071500 3300045051 Bacteria 3611
300 Ga0451576_0113998 3300045051 Bacteria 2814
301 Ga0495627_009753 3300046453 Bacteria 3520
302 Ga0495639_0039944 3300046475 Bacteria 2110
303 Ga0495584_0054641 3300046491 Bacteria 2009
304 Ga0495606_0075262 3300046507 Bacteria 2113
305 Ga0495631_0042489 3300046518 Bacteria 2008
306 Ga0495663_0017531 3300046525 Bacteria 2033
307 Ga0495597_0027583 3300046542 Bacteria 2603
308 Ga0495633_0012306 3300046558 Bacteria 4559
309 Ga0495656_0011859 3300046615 Bacteria 3205
310 Ga0495668_0017216 3300046616 Bacteria 4196
311 Ga0495661_0011927 3300046665 Bacteria 5882
312 Ga0495588_0046500 3300046674 Bacteria 2226
313 Ga0495647_0143636 3300046681 Bacteria 1019
314 Ga0495613_0084270 3300046689 Bacteria 2308
315 Ga0495589_0038142 3300046794 Bacteria 2406
316 Ga0495636_0000521 3300047318 Bacteria 14155
317 Ga0495636_0007659 3300047318 Bacteria 4245
318 Ga0495677_0010998 3300047445 Bacteria 3315
319 Ga0495681_0088632 3300047470 Bacteria 1369
320 Ga0495686_0003258 3300047472 Bacteria 14238
321 Ga0501036_0113064 3300049572 Bacteria 2295
322 Ga0501037_0058877 3300049573 Bacteria 2803
323 Ga0501037_0064907 3300049573 Bacteria 2660
324 Ga0501038_0021029 3300049574 Bacteria 5863
325 Ga0501047_0006630 3300049581 Bacteria 10888
326 Ga0501069_0005501 3300049585 Bacteria 6594
327 Ga0501070_0000747 3300049586 Bacteria 29640
328 Ga0501257_004918 3300049686 Bacteria 2927
329 Ga0501225_0069181 3300049705 Bacteria 1002
330 Ga0501266_009471 3300049763 Bacteria 1233
331 Ga0501268_002357 3300049765 Bacteria 2482
332 Ga0501035_0003478 3300049822 Bacteria 15066
333 Ga0501044_0004843 3300049823 Bacteria 15052
334 nmdc:mga0rr50_281964_c1 3300050513 Bacteria 1386
335 nmdc:mga08x19_236116_c1 3300050514 Bacteria 1259
336 nmdc:mga08x19_93755_c1 3300050514 Bacteria 1984
337 Ga0501084_0213506 3300054114 Bacteria 1628
338 2740990112 2740891818 Bacteria 6711283
339 Ga0400485_21985
340 JGI25406J46586_10032672
341 Ga0065715_10113880
342 Ga0065707_10148110
343 Ga0070676_10037077
344 Ga0070670_100265171
345 Ga0070680_100015057
346 Ga0070682_100165478
347 Ga0068868_100048795
348 Ga0070689_100128050
349 Ga0070691_10034506
350 Ga0070661_100165628
351 Ga0070668_100318141
352 Ga0070669_100052184
353 Ga0070667_100028885
354 Ga0070703_10072154
355 Ga0070714_100001187
356 Ga0070714_100335799
357 Ga0070694_100404862
358 Ga0070708_100000308
359 Ga0070681_10022100
360 Ga0070681_10027053
361 Ga0070681_10085452
362 Ga0070681_10324175
363 Ga0070706_100085298
364 Ga0070707_100005242
365 Ga0070698_100176085
366 Ga0070698_100214886
367 Ga0070699_100110146
368 Ga0070699_100420754
369 Ga0070679_100025413
370 Ga0070679_100038759
371 Ga0070679_100045042
372 Ga0070679_100072074
373 Ga0070679_100353070
374 Ga0070679_100377245
375 Ga0070684_100025814
376 Ga0070697_100026777
377 Ga0068853_100211723
378 Ga0070686_100016182
379 Ga0070696_100098312
380 Ga0070693_100105048
381 Ga0070704_100033502
382 Ga0068855_100372583
383 Ga0070664_100011418
384 Ga0070664_100026909
385 Ga0081539_10000261
386 Ga0075436_100050901
387 Ga0075435_100198599
388 Ga0105245_10302475
389 Ga0105241_10010375
390 Ga0105241_10540824
391 Ga0105242_10217825
392 Ga0157373_10210249
393 Ga0157371_10119466
394 Ga0157370_10010970
395 Ga0157378_10019948
396 Ga0157378_10032972
397 Ga0163162_10421023
398 Ga0157372_10388547
399 Ga0207692_10145931
400 Ga0207645_10045557
401 Ga0207684_10053019
402 Ga0207684_10126665
403 Ga0207707_10031084
404 Ga0207707_10149093
405 Ga0207663_10072612
406 Ga0207660_10067438
407 Ga0207660_10097143
408 Ga0207649_10167333
409 Ga0207652_10227399
410 Ga0207652_10228218
411 Ga0207646_10006631
412 Ga0207646_10063707
413 Ga0207664_10104663
414 Ga0207706_10041851
415 Ga0207670_10234639
416 Ga0207661_10059783
417 Ga0207679_10018198
418 Ga0207651_10012426
419 Ga0207640_10101126
420 Ga0207677_10249672
421 Ga0207639_10077189
422 Ga0207678_10326713
423 Ga0207648_10025571
424 Ga0265337_1000559
425 Ga0265337_1018000
426 Ga0265326_10000430
427 Ga0265319_1000195
428 Ga0265319_1001022
429 Ga0265334_10043491
430 Ga0265318_10003449
431 Ga0265323_10000802
432 Ga0265323_10005478
433 Ga0265323_10007714
434 Ga0265323_10034365
435 Ga0265322_10000412
436 Ga0265336_10000067
437 Ga0265338_10000126
438 Ga0265338_10000612
439 Ga0265338_10001417
440 Ga0265338_10031609
441 Ga0265324_10001309
442 Ga0265324_10016676
443 Ga0265330_10002985
444 Ga0265330_10015770
445 Ga0265332_10001796
446 Ga0265332_10002961
447 Ga0265332_10049177
448 Ga0265328_10005492
449 Ga0265320_10000946
450 Ga0265320_10003121
451 Ga0265325_10082337
452 Ga0265329_10001663
453 Ga0265327_10051719
454 Ga0265316_10003319
455 Ga0265316_10005654
456 Ga0265316_10008240
457 Ga0265316_10009318
458 Ga0265316_10017488
459 Ga0265316_10020683
460 Ga0265316_10024529
461 Ga0265316_10043445
462 Ga0265316_10054633
463 Ga0265313_10001625
464 Ga0316575_10010308
465 Ga0316575_10024833
466 Ga0316575_10025129
467 Ga0316575_10027674
468 Ga0316575_10038864
469 Ga0316579_10000598
470 Ga0316579_10003797
471 Ga0316579_10011900
472 Ga0316579_10019453
473 Ga0316579_10066764
474 Ga0316579_10095862
475 Ga0265314_10000893
476 Ga0265342_10007076
477 Ga0265342_10044341
478 Ga0265342_10091107
479 Ga0316576_10001795
480 Ga0316576_10001871
481 Ga0316576_10001890
482 Ga0316576_10011340
483 Ga0316576_10029804
484 Ga0316576_10031971
485 Ga0316576_10046782
486 Ga0316576_10060046
487 Ga0316576_10228800
488 Ga0316578_10000240
489 Ga0316578_10004452
490 Ga0316578_10157627
491 Ga0316577_10001841
492 Ga0316577_10002618
493 Ga0316577_10026635
494 Ga0316577_10032107
495 Ga0316577_10058411
496 Ga0316577_10090317
497 Ga0316577_10126051
498 Ga0316577_10222895
499 Ga0316577_10265333
500 Ga0307412_10146592
501 Ga0307409_100311931
502 Ga0307411_10137833
503 Ga0316583_10003881
504 Ga0316583_10009190
505 Ga0316583_10013212
506 Ga0316583_10013586
507 Ga0316583_10018437
508 Ga0316583_10022297
509 Ga0316583_10033383
510 Ga0316583_10037338
511 Ga0316583_10069714
512 Ga0316585_10000056
513 Ga0316585_10002920
514 Ga0316585_10011411
515 Ga0316585_10018928
516 Ga0316585_10050698
517 Ga0316580_10002181
518 Ga0316580_10002777
519 Ga0316580_10004002
520 Ga0316580_10009867
521 Ga0316580_10034817
522 Ga0316593_10025961
523 Ga0316593_10089337
524 Ga0316593_10098151
525 Ga0316593_10107700
526 Ga0316593_10114075
527 Ga0316586_1005311
528 Ga0316586_1015178
529 Ga0316586_1023310
530 Ga0316588_1000033
531 Ga0316588_1009994
532 Ga0316588_1013761
533 Ga0316588_1017884
534 Ga0316588_1019124
535 Ga0316588_1045447
536 Ga0316588_1048751
537 Ga0316587_1025397
538 Ga0316587_1027003
539 Ga0316596_1027503
540 Ga0316596_1050937
541 Ga0316596_1054276
542 Ga0316596_1059748
543 Ga0373944_0042716
544 Ga0373943_0030214
545 Ga0316574_0000449
546 Ga0316574_0001749
547 Ga0316574_0003291
548 Ga0316574_0024752
549 Ga0316574_0027879
550 Ga0316574_0050288
551 Ga0316574_0052233
552 Ga0316574_0276418
553 Ga0316582_0001098
554 Ga0316582_0005024
555 Ga0316582_0005332
556 Ga0316582_0005408
557 Ga0316582_0012125
558 Ga0316582_0022810
559 Ga0316582_0027430
560 Ga0316582_0038234
561 Ga0316582_0051931
562 Ga0316582_0074336
563 Ga0316582_0134887
564 Ga0316582_0287909
565 Ga0316582_0295372
566 Ga0316584_0000912
567 Ga0316584_0001733
568 Ga0316584_0003938
569 Ga0316584_0005091
570 Ga0316584_0010779
571 Ga0316584_0011773
572 Ga0316584_0013862
573 Ga0316584_0028311
574 Ga0316584_0035295
575 Ga0316584_0049533
576 Ga0316584_0087170
577 Ga0316584_0089635
578 Ga0316584_0144502
579 Ga0316584_0233707
580 Ga0316584_0255091
581 Ga0316584_0301605
582 Ga0316584_0349939
583 Ga0316581_0033388
584 Ga0316581_0036997
585 Ga0316581_0079933
586 Ga0400484_29949
587 Ga0400490_13851
588 Ga0400490_26700
589 Ga0400490_30478
590 Ga0400491_14784
591 Ga0400485_03194
592 Ga0400485_14777
593 Ga0400488_41040
594 Ga0400488_41500
595 Ga0400488_60968
596 Ga0400488_63662
597 Ga0400486_02085
598 Ga0400486_15387
599 Ga0400486_16162
600 Ga0400486_22630
601 Ga0400483_008525
602 Ga0400483_021534
603 Ga0400483_027424
604 Ga0400483_071908
605 Ga0400483_204226
606 Ga0400483_232415
607 Ga0400483_279390
608 Ga0400483_282195
609 Ga0400489_10290
610 Ga0400489_12948
611 Ga0400489_19306
612 Ga0400489_23168
613 Ga0400489_25882
614 Ga0400489_54455
615 Ga0400489_86539
616 Ga0400487_07508
617 Ga0400487_30347
618 Ga0400487_35200
619 Ga0400487_36967
620 Ga0400487_40723
621 Ga0451577_0000181
622 Ga0451577_0000741
623 Ga0451577_0001270
624 Ga0451577_0010274
625 Ga0451577_0459930
626 Ga0453683_0000955
627 Ga0453683_0009601
628 Ga0453684_0000039
629 Ga0453684_0000592
630 Ga0453684_0003605
631 Ga0453684_0004830
632 Ga0453684_0056960
633 Ga0453684_0160197
634 Ga0453684_0260918
635 Ga0453684_0275929
636 Ga0453684_0364228
637 Ga0451576_0071500
638 Ga0451576_0113998
639 Ga0495627_009753
640 Ga0495639_0039944
641 Ga0495584_0054641
642 Ga0495606_0075262
643 Ga0495631_0042489
644 Ga0495663_0017531
645 Ga0495597_0027583
646 Ga0495633_0012306
647 Ga0495656_0011859
648 Ga0495668_0017216
649 Ga0495661_0011927
650 Ga0495588_0046500
651 Ga0495647_0143636
652 Ga0495613_0084270
653 Ga0495589_0038142
654 Ga0495636_0000521
655 Ga0495636_0007659
656 Ga0495677_0010998
657 Ga0495681_0088632
658 Ga0495686_0003258
659 Ga0501036_0113064
660 Ga0501037_0058877
661 Ga0501037_0064907
662 Ga0501038_0021029
663 Ga0501047_0006630
664 Ga0501069_0005501
665 Ga0501070_0000747
666 Ga0501257_004918
667 Ga0501225_0069181
668 Ga0501266_009471
669 Ga0501268_002357
670 Ga0501035_0003478
671 Ga0501044_0004843
672 nmdc:mga0rr50_281964_c1
673 nmdc:mga08x19_236116_c1
674 nmdc:mga08x19_93755_c1
675 Ga0501084_0213506
676 2740990112

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

47

162

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

165

340

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9839 19 304
6ape-assembly1.cif.gz_A crystal structure of bifunctional protein fold from helicobacter pylori 0.9829 18 307
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9773 17 304
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9738 18 305
6ape-assembly1.cif.gz_A crystal structure of bifunctional protein fold from helicobacter pylori 0.9727 18 307
ID Description Score Start End Superfamily
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9902 28 139 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.988 48 128 3.40.50.10860
af_P9WG81_7_102_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9844 22 117 3.40.50.1220
af_P9WG81_104_273_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9795 119 296 3.40.50.10860
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9775 44 129 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A524J193-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 1.001 220 304 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A1C3VT20-F1-model_v4 Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain 0.9934 19 162 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A7Z7YRP5-F1-model_v4 methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) 0.9934 34 165 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A8A8TLP2-F1-model_v4 deleted 0.9933 17 309
AF-A0A7W0WIY7-F1-model_v4 methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) 0.9933 18 172 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Map