F413608
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 338 | 156 | 676 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300038735|Ga0400485_21985|Ga0400485_21985_2302_3333 |
| Length | 343 |
| Sequence | VGKLYDVYRIKVGAADYYAERQWGARRPPYKFESFERRYNKMTAQLIKGTEIREQILEEITAEVAKIKEKHGVVPGLVTILVGENPASISYVTLKIKTAHRVGFNEIQDTQSVDISEADLLALIDKYNKDESINGILVQLPLPKHIDEKKVLNAIDPDKDVDGFHPVNVGRLMIGGDEVKFAPCTPAGIQEMIVRAGVETKGAEVVVVGRSNIVGKPIANMMLQKGAGANSTVTIVHTGTKDLAGHCQRADILIVAAGVPGLVKPEWIKAGACVIDVGVNRVGEKISEKTGKKIAVLRGDVDFDAAKEIAGYITPVPGGVGPMTITMLMLNTLKSLKFKLGIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 68 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 69 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 70 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 71 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 72 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 73 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 74 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 75 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 76 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 77 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 78 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 80 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 82 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 83 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 84 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 85 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 86 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 87 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 88 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 91 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 92 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 93 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 95 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 96 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 97 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 98 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 99 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 100 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 105 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 106 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 108 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 109 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 110 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 111 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 112 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 113 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 114 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 115 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 116 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 117 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 148 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 149 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 150 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 151 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 156 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.49 |
| Metatranscriptomes | 6.21 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 89.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0400485_21985 | 3300038735 | Bacteria | 3636 |
| 2 | JGI25406J46586_10032672 | 3300003203 | Bacteria | 1931 |
| 3 | Ga0065715_10113880 | 3300005293 | Bacteria | 2472 |
| 4 | Ga0065707_10148110 | 3300005295 | Bacteria | 1690 |
| 5 | Ga0070676_10037077 | 3300005328 | Bacteria | 2811 |
| 6 | Ga0070670_100265171 | 3300005331 | Bacteria | 1498 |
| 7 | Ga0070680_100015057 | 3300005336 | Bacteria | 6054 |
| 8 | Ga0070682_100165478 | 3300005337 | Bacteria | 1532 |
| 9 | Ga0068868_100048795 | 3300005338 | Bacteria | 3321 |
| 10 | Ga0070689_100128050 | 3300005340 | Bacteria | 2034 |
| 11 | Ga0070691_10034506 | 3300005341 | Bacteria | 2382 |
| 12 | Ga0070661_100165628 | 3300005344 | Bacteria | 1676 |
| 13 | Ga0070668_100318141 | 3300005347 | Bacteria | 1309 |
| 14 | Ga0070669_100052184 | 3300005353 | Bacteria | 2991 |
| 15 | Ga0070667_100028885 | 3300005367 | Bacteria | 4617 |
| 16 | Ga0070703_10072154 | 3300005406 | Bacteria | 1156 |
| 17 | Ga0070714_100001187 | 3300005435 | Bacteria | 18748 |
| 18 | Ga0070714_100335799 | 3300005435 | Bacteria | 1416 |
| 19 | Ga0070694_100404862 | 3300005444 | Unclassified | 1069 |
| 20 | Ga0070708_100000308 | 3300005445 | Bacteria | 36695 |
| 21 | Ga0070681_10022100 | 3300005458 | Bacteria | 6384 |
| 22 | Ga0070681_10027053 | 3300005458 | Bacteria | 5767 |
| 23 | Ga0070681_10085452 | 3300005458 | Bacteria | 3107 |
| 24 | Ga0070681_10324175 | 3300005458 | Bacteria | 1450 |
| 25 | Ga0070706_100085298 | 3300005467 | Bacteria | 2926 |
| 26 | Ga0070707_100005242 | 3300005468 | Bacteria | 12130 |
| 27 | Ga0070698_100176085 | 3300005471 | Bacteria | 2078 |
| 28 | Ga0070698_100214886 | 3300005471 | Bacteria | 1857 |
| 29 | Ga0070699_100110146 | 3300005518 | Bacteria | 2417 |
| 30 | Ga0070699_100420754 | 3300005518 | Bacteria | 1209 |
| 31 | Ga0070679_100025413 | 3300005530 | Bacteria | 5811 |
| 32 | Ga0070679_100038759 | 3300005530 | Bacteria | 4738 |
| 33 | Ga0070679_100045042 | 3300005530 | Bacteria | 4395 |
| 34 | Ga0070679_100072074 | 3300005530 | Bacteria | 3446 |
| 35 | Ga0070679_100353070 | 3300005530 | Bacteria | 1418 |
| 36 | Ga0070679_100377245 | 3300005530 | Bacteria | 1365 |
| 37 | Ga0070684_100025814 | 3300005535 | Bacteria | 4942 |
| 38 | Ga0070697_100026777 | 3300005536 | Bacteria | 4610 |
| 39 | Ga0068853_100211723 | 3300005539 | Bacteria | 1767 |
| 40 | Ga0070686_100016182 | 3300005544 | Bacteria | 4336 |
| 41 | Ga0070696_100098312 | 3300005546 | Bacteria | 2093 |
| 42 | Ga0070693_100105048 | 3300005547 | Bacteria | 1727 |
| 43 | Ga0070704_100033502 | 3300005549 | Bacteria | 3474 |
| 44 | Ga0068855_100372583 | 3300005563 | Bacteria | 1569 |
| 45 | Ga0070664_100011418 | 3300005564 | Bacteria | 7206 |
| 46 | Ga0070664_100026909 | 3300005564 | Bacteria | 4777 |
| 47 | Ga0081539_10000261 | 3300005985 | Bacteria | 121256 |
| 48 | Ga0075436_100050901 | 3300006914 | Bacteria | 2858 |
| 49 | Ga0075435_100198599 | 3300007076 | Bacteria | 1699 |
| 50 | Ga0105245_10302475 | 3300009098 | Bacteria | 1570 |
| 51 | Ga0105241_10010375 | 3300009174 | Bacteria | 6836 |
| 52 | Ga0105241_10540824 | 3300009174 | Bacteria | 1044 |
| 53 | Ga0105242_10217825 | 3300009176 | Bacteria | 1704 |
| 54 | Ga0157373_10210249 | 3300013100 | Bacteria | 1372 |
| 55 | Ga0157371_10119466 | 3300013102 | Bacteria | 1874 |
| 56 | Ga0157370_10010970 | 3300013104 | Bacteria | 9508 |
| 57 | Ga0157378_10019948 | 3300013297 | Bacteria | 5895 |
| 58 | Ga0157378_10032972 | 3300013297 | Bacteria | 4578 |
| 59 | Ga0163162_10421023 | 3300013306 | Bacteria | 1468 |
| 60 | Ga0157372_10388547 | 3300013307 | Unclassified | 1626 |
| 61 | Ga0207692_10145931 | 3300025898 | Bacteria | 1350 |
| 62 | Ga0207645_10045557 | 3300025907 | Bacteria | 2803 |
| 63 | Ga0207684_10053019 | 3300025910 | Bacteria | 3443 |
| 64 | Ga0207684_10126665 | 3300025910 | Bacteria | 2192 |
| 65 | Ga0207707_10031084 | 3300025912 | Bacteria | 4671 |
| 66 | Ga0207707_10149093 | 3300025912 | Bacteria | 2045 |
| 67 | Ga0207663_10072612 | 3300025916 | Bacteria | 2225 |
| 68 | Ga0207660_10067438 | 3300025917 | Bacteria | 2591 |
| 69 | Ga0207660_10097143 | 3300025917 | Bacteria | 2194 |
| 70 | Ga0207649_10167333 | 3300025920 | Bacteria | 1528 |
| 71 | Ga0207652_10227399 | 3300025921 | Bacteria | 1681 |
| 72 | Ga0207652_10228218 | 3300025921 | Bacteria | 1678 |
| 73 | Ga0207646_10006631 | 3300025922 | Bacteria | 11938 |
| 74 | Ga0207646_10063707 | 3300025922 | Bacteria | 3291 |
| 75 | Ga0207664_10104663 | 3300025929 | Bacteria | 2344 |
| 76 | Ga0207706_10041851 | 3300025933 | Bacteria | 4060 |
| 77 | Ga0207670_10234639 | 3300025936 | Bacteria | 1410 |
| 78 | Ga0207661_10059783 | 3300025944 | Bacteria | 3072 |
| 79 | Ga0207679_10018198 | 3300025945 | Bacteria | 4703 |
| 80 | Ga0207651_10012426 | 3300025960 | Bacteria | 4819 |
| 81 | Ga0207640_10101126 | 3300025981 | Bacteria | 2022 |
| 82 | Ga0207677_10249672 | 3300026023 | Bacteria | 1440 |
| 83 | Ga0207639_10077189 | 3300026041 | Bacteria | 2625 |
| 84 | Ga0207678_10326713 | 3300026067 | Bacteria | 1320 |
| 85 | Ga0207648_10025571 | 3300026089 | Bacteria | 5257 |
| 86 | Ga0265337_1000559 | 3300028556 | Bacteria | 19577 |
| 87 | Ga0265337_1018000 | 3300028556 | Bacteria | 2252 |
| 88 | Ga0265326_10000430 | 3300028558 | Bacteria | 16586 |
| 89 | Ga0265319_1000195 | 3300028563 | Bacteria | 46017 |
| 90 | Ga0265319_1001022 | 3300028563 | Bacteria | 17495 |
| 91 | Ga0265334_10043491 | 3300028573 | Bacteria | 1748 |
| 92 | Ga0265318_10003449 | 3300028577 | Bacteria | 7937 |
| 93 | Ga0265323_10000802 | 3300028653 | Bacteria | 16863 |
| 94 | Ga0265323_10005478 | 3300028653 | Bacteria | 5391 |
| 95 | Ga0265323_10007714 | 3300028653 | Bacteria | 4456 |
| 96 | Ga0265323_10034365 | 3300028653 | Bacteria | 1873 |
| 97 | Ga0265322_10000412 | 3300028654 | Bacteria | 17552 |
| 98 | Ga0265336_10000067 | 3300028666 | Bacteria | 93268 |
| 99 | Ga0265338_10000126 | 3300028800 | Bacteria | 140495 |
| 100 | Ga0265338_10000612 | 3300028800 | Bacteria | 62574 |
| 101 | Ga0265338_10001417 | 3300028800 | Bacteria | 39003 |
| 102 | Ga0265338_10031609 | 3300028800 | Bacteria | 5186 |
| 103 | Ga0265324_10001309 | 3300029957 | Bacteria | 14623 |
| 104 | Ga0265324_10016676 | 3300029957 | Bacteria | 2677 |
| 105 | Ga0265330_10002985 | 3300031235 | Bacteria | 9000 |
| 106 | Ga0265330_10015770 | 3300031235 | Bacteria | 3491 |
| 107 | Ga0265332_10001796 | 3300031238 | Bacteria | 11535 |
| 108 | Ga0265332_10002961 | 3300031238 | Bacteria | 8340 |
| 109 | Ga0265332_10049177 | 3300031238 | Bacteria | 1814 |
| 110 | Ga0265328_10005492 | 3300031239 | Bacteria | 5428 |
| 111 | Ga0265320_10000946 | 3300031240 | Bacteria | 21662 |
| 112 | Ga0265320_10003121 | 3300031240 | Bacteria | 11245 |
| 113 | Ga0265325_10082337 | 3300031241 | Bacteria | 1597 |
| 114 | Ga0265329_10001663 | 3300031242 | Bacteria | 10653 |
| 115 | Ga0265327_10051719 | 3300031251 | Bacteria | 2143 |
| 116 | Ga0265316_10003319 | 3300031344 | Bacteria | 16310 |
| 117 | Ga0265316_10005654 | 3300031344 | Bacteria | 12098 |
| 118 | Ga0265316_10008240 | 3300031344 | Bacteria | 9700 |
| 119 | Ga0265316_10009318 | 3300031344 | Bacteria | 9046 |
| 120 | Ga0265316_10017488 | 3300031344 | Bacteria | 6192 |
| 121 | Ga0265316_10020683 | 3300031344 | Bacteria | 5594 |
| 122 | Ga0265316_10024529 | 3300031344 | Bacteria | 5050 |
| 123 | Ga0265316_10043445 | 3300031344 | Bacteria | 3581 |
| 124 | Ga0265316_10054633 | 3300031344 | Bacteria | 3126 |
| 125 | Ga0265313_10001625 | 3300031595 | Bacteria | 20858 |
| 126 | Ga0316575_10010308 | 3300031665 | Bacteria | 3430 |
| 127 | Ga0316575_10024833 | 3300031665 | Bacteria | 2321 |
| 128 | Ga0316575_10025129 | 3300031665 | Bacteria | 2308 |
| 129 | Ga0316575_10027674 | 3300031665 | Bacteria | 2206 |
| 130 | Ga0316575_10038864 | 3300031665 | Bacteria | 1877 |
| 131 | Ga0316579_10000598 | 3300031691 | Bacteria | 12114 |
| 132 | Ga0316579_10003797 | 3300031691 | Bacteria | 5948 |
| 133 | Ga0316579_10011900 | 3300031691 | Bacteria | 3712 |
| 134 | Ga0316579_10019453 | 3300031691 | Bacteria | 3001 |
| 135 | Ga0316579_10066764 | 3300031691 | Bacteria | 1699 |
| 136 | Ga0316579_10095862 | 3300031691 | Bacteria | 1418 |
| 137 | Ga0265314_10000893 | 3300031711 | Bacteria | 35529 |
| 138 | Ga0265342_10007076 | 3300031712 | Bacteria | 8268 |
| 139 | Ga0265342_10044341 | 3300031712 | Bacteria | 2681 |
| 140 | Ga0265342_10091107 | 3300031712 | Bacteria | 1748 |
| 141 | Ga0316576_10001795 | 3300031727 | Bacteria | 11881 |
| 142 | Ga0316576_10001871 | 3300031727 | Bacteria | 11705 |
| 143 | Ga0316576_10001890 | 3300031727 | Bacteria | 11649 |
| 144 | Ga0316576_10011340 | 3300031727 | Bacteria | 5837 |
| 145 | Ga0316576_10029804 | 3300031727 | Bacteria | 3860 |
| 146 | Ga0316576_10031971 | 3300031727 | Bacteria | 3738 |
| 147 | Ga0316576_10046782 | 3300031727 | Bacteria | 3133 |
| 148 | Ga0316576_10060046 | 3300031727 | Bacteria | 2784 |
| 149 | Ga0316576_10228800 | 3300031727 | Bacteria | 1398 |
| 150 | Ga0316578_10000240 | 3300031728 | Bacteria | 16234 |
| 151 | Ga0316578_10004452 | 3300031728 | Bacteria | 6620 |
| 152 | Ga0316578_10157627 | 3300031728 | Bacteria | 1368 |
| 153 | Ga0316577_10001841 | 3300031733 | Bacteria | 10244 |
| 154 | Ga0316577_10002618 | 3300031733 | Bacteria | 8948 |
| 155 | Ga0316577_10026635 | 3300031733 | Bacteria | 3220 |
| 156 | Ga0316577_10032107 | 3300031733 | Bacteria | 2933 |
| 157 | Ga0316577_10058411 | 3300031733 | Bacteria | 2154 |
| 158 | Ga0316577_10090317 | 3300031733 | Bacteria | 1715 |
| 159 | Ga0316577_10126051 | 3300031733 | Bacteria | 1440 |
| 160 | Ga0316577_10222895 | 3300031733 | Bacteria | 1066 |
| 161 | Ga0316577_10265333 | 3300031733 | Bacteria | 971 |
| 162 | Ga0307412_10146592 | 3300031911 | Bacteria | 1736 |
| 163 | Ga0307409_100311931 | 3300031995 | Bacteria | 1468 |
| 164 | Ga0307411_10137833 | 3300032005 | Bacteria | 1795 |
| 165 | Ga0316583_10003881 | 3300032133 | Bacteria | 5309 |
| 166 | Ga0316583_10009190 | 3300032133 | Bacteria | 3563 |
| 167 | Ga0316583_10013212 | 3300032133 | Bacteria | 2979 |
| 168 | Ga0316583_10013586 | 3300032133 | Bacteria | 2939 |
| 169 | Ga0316583_10018437 | 3300032133 | Bacteria | 2505 |
| 170 | Ga0316583_10022297 | 3300032133 | Bacteria | 2267 |
| 171 | Ga0316583_10033383 | 3300032133 | Bacteria | 1828 |
| 172 | Ga0316583_10037338 | 3300032133 | Bacteria | 1722 |
| 173 | Ga0316583_10069714 | 3300032133 | Bacteria | 1230 |
| 174 | Ga0316585_10000056 | 3300032137 | Bacteria | 18155 |
| 175 | Ga0316585_10002920 | 3300032137 | Bacteria | 4670 |
| 176 | Ga0316585_10011411 | 3300032137 | Bacteria | 2621 |
| 177 | Ga0316585_10018928 | 3300032137 | Bacteria | 2095 |
| 178 | Ga0316585_10050698 | 3300032137 | Bacteria | 1333 |
| 179 | Ga0316580_10002181 | 3300032139 | Bacteria | 5335 |
| 180 | Ga0316580_10002777 | 3300032139 | Bacteria | 4881 |
| 181 | Ga0316580_10004002 | 3300032139 | Bacteria | 4241 |
| 182 | Ga0316580_10009867 | 3300032139 | Bacteria | 2874 |
| 183 | Ga0316580_10034817 | 3300032139 | Bacteria | 1558 |
| 184 | Ga0316593_10025961 | 3300032168 | Bacteria | 1870 |
| 185 | Ga0316593_10089337 | 3300032168 | Bacteria | 1084 |
| 186 | Ga0316593_10098151 | 3300032168 | Bacteria | 1037 |
| 187 | Ga0316593_10107700 | 3300032168 | Bacteria | 993 |
| 188 | Ga0316593_10114075 | 3300032168 | Bacteria | 966 |
| 189 | Ga0316586_1005311 | 3300033527 | Bacteria | 1804 |
| 190 | Ga0316586_1015178 | 3300033527 | Bacteria | 1223 |
| 191 | Ga0316586_1023310 | 3300033527 | Bacteria | 1033 |
| 192 | Ga0316588_1000033 | 3300033528 | Bacteria | 10146 |
| 193 | Ga0316588_1009994 | 3300033528 | Bacteria | 1990 |
| 194 | Ga0316588_1013761 | 3300033528 | Bacteria | 1761 |
| 195 | Ga0316588_1017884 | 3300033528 | Bacteria | 1583 |
| 196 | Ga0316588_1019124 | 3300033528 | Bacteria | 1540 |
| 197 | Ga0316588_1045447 | 3300033528 | Bacteria | 1057 |
| 198 | Ga0316588_1048751 | 3300033528 | Bacteria | 1025 |
| 199 | Ga0316587_1025397 | 3300033529 | Bacteria | 1029 |
| 200 | Ga0316587_1027003 | 3300033529 | Bacteria | 1003 |
| 201 | Ga0316596_1027503 | 3300033541 | Bacteria | 1468 |
| 202 | Ga0316596_1050937 | 3300033541 | Bacteria | 1095 |
| 203 | Ga0316596_1054276 | 3300033541 | Bacteria | 1063 |
| 204 | Ga0316596_1059748 | 3300033541 | Bacteria | 1016 |
| 205 | Ga0373944_0042716 | 3300035089 | Bacteria | 1407 |
| 206 | Ga0373943_0030214 | 3300035170 | Bacteria | 2564 |
| 207 | Ga0316574_0000449 | 3300035398 | Bacteria | 16485 |
| 208 | Ga0316574_0001749 | 3300035398 | Bacteria | 10517 |
| 209 | Ga0316574_0003291 | 3300035398 | Bacteria | 8307 |
| 210 | Ga0316574_0024752 | 3300035398 | Bacteria | 3596 |
| 211 | Ga0316574_0027879 | 3300035398 | Bacteria | 3402 |
| 212 | Ga0316574_0050288 | 3300035398 | Bacteria | 2594 |
| 213 | Ga0316574_0052233 | 3300035398 | Bacteria | 2548 |
| 214 | Ga0316574_0276418 | 3300035398 | Bacteria | 1070 |
| 215 | Ga0316582_0001098 | 3300036647 | Bacteria | 11408 |
| 216 | Ga0316582_0005024 | 3300036647 | Bacteria | 6760 |
| 217 | Ga0316582_0005332 | 3300036647 | Bacteria | 6608 |
| 218 | Ga0316582_0005408 | 3300036647 | Bacteria | 6575 |
| 219 | Ga0316582_0012125 | 3300036647 | Bacteria | 4797 |
| 220 | Ga0316582_0022810 | 3300036647 | Bacteria | 3722 |
| 221 | Ga0316582_0027430 | 3300036647 | Bacteria | 3440 |
| 222 | Ga0316582_0038234 | 3300036647 | Bacteria | 2981 |
| 223 | Ga0316582_0051931 | 3300036647 | Bacteria | 2604 |
| 224 | Ga0316582_0074336 | 3300036647 | Bacteria | 2206 |
| 225 | Ga0316582_0134887 | 3300036647 | Bacteria | 1661 |
| 226 | Ga0316582_0287909 | 3300036647 | Bacteria | 1128 |
| 227 | Ga0316582_0295372 | 3300036647 | Bacteria | 1113 |
| 228 | Ga0316584_0000912 | 3300036712 | Bacteria | 16822 |
| 229 | Ga0316584_0001733 | 3300036712 | Bacteria | 13386 |
| 230 | Ga0316584_0003938 | 3300036712 | Bacteria | 9756 |
| 231 | Ga0316584_0005091 | 3300036712 | Bacteria | 8768 |
| 232 | Ga0316584_0010779 | 3300036712 | Bacteria | 6400 |
| 233 | Ga0316584_0011773 | 3300036712 | Bacteria | 6157 |
| 234 | Ga0316584_0013862 | 3300036712 | Bacteria | 5718 |
| 235 | Ga0316584_0028311 | 3300036712 | Bacteria | 4131 |
| 236 | Ga0316584_0035295 | 3300036712 | Bacteria | 3710 |
| 237 | Ga0316584_0049533 | 3300036712 | Bacteria | 3140 |
| 238 | Ga0316584_0087170 | 3300036712 | Bacteria | 2337 |
| 239 | Ga0316584_0089635 | 3300036712 | Bacteria | 2303 |
| 240 | Ga0316584_0144502 | 3300036712 | Bacteria | 1773 |
| 241 | Ga0316584_0233707 | 3300036712 | Bacteria | 1347 |
| 242 | Ga0316584_0255091 | 3300036712 | Bacteria | 1280 |
| 243 | Ga0316584_0301605 | 3300036712 | Bacteria | 1160 |
| 244 | Ga0316584_0349939 | 3300036712 | Bacteria | 1061 |
| 245 | Ga0316581_0033388 | 3300037588 | Bacteria | 1555 |
| 246 | Ga0316581_0036997 | 3300037588 | Bacteria | 1482 |
| 247 | Ga0316581_0079933 | 3300037588 | Bacteria | 1006 |
| 248 | Ga0400484_29949 | 3300038725 | Bacteria | 8166 |
| 249 | Ga0400490_13851 | 3300038726 | Bacteria | 2659 |
| 250 | Ga0400490_26700 | 3300038726 | Bacteria | 16276 |
| 251 | Ga0400490_30478 | 3300038726 | Bacteria | 3533 |
| 252 | Ga0400491_14784 | 3300038727 | Bacteria | 2782 |
| 253 | Ga0400485_03194 | 3300038735 | Bacteria | 2466 |
| 254 | Ga0400485_14777 | 3300038735 | Bacteria | 21061 |
| 255 | Ga0400488_41040 | 3300038741 | Bacteria | 5253 |
| 256 | Ga0400488_41500 | 3300038741 | Bacteria | 9989 |
| 257 | Ga0400488_60968 | 3300038741 | Bacteria | 4771 |
| 258 | Ga0400488_63662 | 3300038741 | Bacteria | 5622 |
| 259 | Ga0400486_02085 | 3300038742 | Bacteria | 25117 |
| 260 | Ga0400486_15387 | 3300038742 | Bacteria | 13546 |
| 261 | Ga0400486_16162 | 3300038742 | Bacteria | 14808 |
| 262 | Ga0400486_22630 | 3300038742 | Bacteria | 21629 |
| 263 | Ga0400483_008525 | 3300039062 | Bacteria | 9492 |
| 264 | Ga0400483_021534 | 3300039062 | Bacteria | 3706 |
| 265 | Ga0400483_027424 | 3300039062 | Bacteria | 3975 |
| 266 | Ga0400483_071908 | 3300039062 | Bacteria | 11244 |
| 267 | Ga0400483_204226 | 3300039062 | Bacteria | 3426 |
| 268 | Ga0400483_232415 | 3300039062 | Bacteria | 1477 |
| 269 | Ga0400483_279390 | 3300039062 | Bacteria | 1392 |
| 270 | Ga0400483_282195 | 3300039062 | Bacteria | 9869 |
| 271 | Ga0400489_10290 | 3300039093 | Bacteria | 15334 |
| 272 | Ga0400489_12948 | 3300039093 | Bacteria | 15166 |
| 273 | Ga0400489_19306 | 3300039093 | Bacteria | 1486 |
| 274 | Ga0400489_23168 | 3300039093 | Bacteria | 1036 |
| 275 | Ga0400489_25882 | 3300039093 | Bacteria | 4498 |
| 276 | Ga0400489_54455 | 3300039093 | Bacteria | 62028 |
| 277 | Ga0400489_86539 | 3300039093 | Bacteria | 12592 |
| 278 | Ga0400487_07508 | 3300039110 | Bacteria | 36752 |
| 279 | Ga0400487_30347 | 3300039110 | Bacteria | 1172 |
| 280 | Ga0400487_35200 | 3300039110 | Bacteria | 8148 |
| 281 | Ga0400487_36967 | 3300039110 | Bacteria | 1581 |
| 282 | Ga0400487_40723 | 3300039110 | Bacteria | 1670 |
| 283 | Ga0451577_0000181 | 3300042876 | Bacteria | 134503 |
| 284 | Ga0451577_0000741 | 3300042876 | Bacteria | 50246 |
| 285 | Ga0451577_0001270 | 3300042876 | Bacteria | 34801 |
| 286 | Ga0451577_0010274 | 3300042876 | Bacteria | 8961 |
| 287 | Ga0451577_0459930 | 3300042876 | Bacteria | 1156 |
| 288 | Ga0453683_0000955 | 3300044673 | Bacteria | 27499 |
| 289 | Ga0453683_0009601 | 3300044673 | Bacteria | 6453 |
| 290 | Ga0453684_0000039 | 3300044712 | Bacteria | 697730 |
| 291 | Ga0453684_0000592 | 3300044712 | Bacteria | 134503 |
| 292 | Ga0453684_0003605 | 3300044712 | Bacteria | 34545 |
| 293 | Ga0453684_0004830 | 3300044712 | Bacteria | 27679 |
| 294 | Ga0453684_0056960 | 3300044712 | Bacteria | 5065 |
| 295 | Ga0453684_0160197 | 3300044712 | Bacteria | 2662 |
| 296 | Ga0453684_0260918 | 3300044712 | Bacteria | 1985 |
| 297 | Ga0453684_0275929 | 3300044712 | Bacteria | 1919 |
| 298 | Ga0453684_0364228 | 3300044712 | Bacteria | 1627 |
| 299 | Ga0451576_0071500 | 3300045051 | Bacteria | 3611 |
| 300 | Ga0451576_0113998 | 3300045051 | Bacteria | 2814 |
| 301 | Ga0495627_009753 | 3300046453 | Bacteria | 3520 |
| 302 | Ga0495639_0039944 | 3300046475 | Bacteria | 2110 |
| 303 | Ga0495584_0054641 | 3300046491 | Bacteria | 2009 |
| 304 | Ga0495606_0075262 | 3300046507 | Bacteria | 2113 |
| 305 | Ga0495631_0042489 | 3300046518 | Bacteria | 2008 |
| 306 | Ga0495663_0017531 | 3300046525 | Bacteria | 2033 |
| 307 | Ga0495597_0027583 | 3300046542 | Bacteria | 2603 |
| 308 | Ga0495633_0012306 | 3300046558 | Bacteria | 4559 |
| 309 | Ga0495656_0011859 | 3300046615 | Bacteria | 3205 |
| 310 | Ga0495668_0017216 | 3300046616 | Bacteria | 4196 |
| 311 | Ga0495661_0011927 | 3300046665 | Bacteria | 5882 |
| 312 | Ga0495588_0046500 | 3300046674 | Bacteria | 2226 |
| 313 | Ga0495647_0143636 | 3300046681 | Bacteria | 1019 |
| 314 | Ga0495613_0084270 | 3300046689 | Bacteria | 2308 |
| 315 | Ga0495589_0038142 | 3300046794 | Bacteria | 2406 |
| 316 | Ga0495636_0000521 | 3300047318 | Bacteria | 14155 |
| 317 | Ga0495636_0007659 | 3300047318 | Bacteria | 4245 |
| 318 | Ga0495677_0010998 | 3300047445 | Bacteria | 3315 |
| 319 | Ga0495681_0088632 | 3300047470 | Bacteria | 1369 |
| 320 | Ga0495686_0003258 | 3300047472 | Bacteria | 14238 |
| 321 | Ga0501036_0113064 | 3300049572 | Bacteria | 2295 |
| 322 | Ga0501037_0058877 | 3300049573 | Bacteria | 2803 |
| 323 | Ga0501037_0064907 | 3300049573 | Bacteria | 2660 |
| 324 | Ga0501038_0021029 | 3300049574 | Bacteria | 5863 |
| 325 | Ga0501047_0006630 | 3300049581 | Bacteria | 10888 |
| 326 | Ga0501069_0005501 | 3300049585 | Bacteria | 6594 |
| 327 | Ga0501070_0000747 | 3300049586 | Bacteria | 29640 |
| 328 | Ga0501257_004918 | 3300049686 | Bacteria | 2927 |
| 329 | Ga0501225_0069181 | 3300049705 | Bacteria | 1002 |
| 330 | Ga0501266_009471 | 3300049763 | Bacteria | 1233 |
| 331 | Ga0501268_002357 | 3300049765 | Bacteria | 2482 |
| 332 | Ga0501035_0003478 | 3300049822 | Bacteria | 15066 |
| 333 | Ga0501044_0004843 | 3300049823 | Bacteria | 15052 |
| 334 | nmdc:mga0rr50_281964_c1 | 3300050513 | Bacteria | 1386 |
| 335 | nmdc:mga08x19_236116_c1 | 3300050514 | Bacteria | 1259 |
| 336 | nmdc:mga08x19_93755_c1 | 3300050514 | Bacteria | 1984 |
| 337 | Ga0501084_0213506 | 3300054114 | Bacteria | 1628 |
| 338 | 2740990112 | 2740891818 | Bacteria | 6711283 |
| 339 | Ga0400485_21985 | |||
| 340 | JGI25406J46586_10032672 | |||
| 341 | Ga0065715_10113880 | |||
| 342 | Ga0065707_10148110 | |||
| 343 | Ga0070676_10037077 | |||
| 344 | Ga0070670_100265171 | |||
| 345 | Ga0070680_100015057 | |||
| 346 | Ga0070682_100165478 | |||
| 347 | Ga0068868_100048795 | |||
| 348 | Ga0070689_100128050 | |||
| 349 | Ga0070691_10034506 | |||
| 350 | Ga0070661_100165628 | |||
| 351 | Ga0070668_100318141 | |||
| 352 | Ga0070669_100052184 | |||
| 353 | Ga0070667_100028885 | |||
| 354 | Ga0070703_10072154 | |||
| 355 | Ga0070714_100001187 | |||
| 356 | Ga0070714_100335799 | |||
| 357 | Ga0070694_100404862 | |||
| 358 | Ga0070708_100000308 | |||
| 359 | Ga0070681_10022100 | |||
| 360 | Ga0070681_10027053 | |||
| 361 | Ga0070681_10085452 | |||
| 362 | Ga0070681_10324175 | |||
| 363 | Ga0070706_100085298 | |||
| 364 | Ga0070707_100005242 | |||
| 365 | Ga0070698_100176085 | |||
| 366 | Ga0070698_100214886 | |||
| 367 | Ga0070699_100110146 | |||
| 368 | Ga0070699_100420754 | |||
| 369 | Ga0070679_100025413 | |||
| 370 | Ga0070679_100038759 | |||
| 371 | Ga0070679_100045042 | |||
| 372 | Ga0070679_100072074 | |||
| 373 | Ga0070679_100353070 | |||
| 374 | Ga0070679_100377245 | |||
| 375 | Ga0070684_100025814 | |||
| 376 | Ga0070697_100026777 | |||
| 377 | Ga0068853_100211723 | |||
| 378 | Ga0070686_100016182 | |||
| 379 | Ga0070696_100098312 | |||
| 380 | Ga0070693_100105048 | |||
| 381 | Ga0070704_100033502 | |||
| 382 | Ga0068855_100372583 | |||
| 383 | Ga0070664_100011418 | |||
| 384 | Ga0070664_100026909 | |||
| 385 | Ga0081539_10000261 | |||
| 386 | Ga0075436_100050901 | |||
| 387 | Ga0075435_100198599 | |||
| 388 | Ga0105245_10302475 | |||
| 389 | Ga0105241_10010375 | |||
| 390 | Ga0105241_10540824 | |||
| 391 | Ga0105242_10217825 | |||
| 392 | Ga0157373_10210249 | |||
| 393 | Ga0157371_10119466 | |||
| 394 | Ga0157370_10010970 | |||
| 395 | Ga0157378_10019948 | |||
| 396 | Ga0157378_10032972 | |||
| 397 | Ga0163162_10421023 | |||
| 398 | Ga0157372_10388547 | |||
| 399 | Ga0207692_10145931 | |||
| 400 | Ga0207645_10045557 | |||
| 401 | Ga0207684_10053019 | |||
| 402 | Ga0207684_10126665 | |||
| 403 | Ga0207707_10031084 | |||
| 404 | Ga0207707_10149093 | |||
| 405 | Ga0207663_10072612 | |||
| 406 | Ga0207660_10067438 | |||
| 407 | Ga0207660_10097143 | |||
| 408 | Ga0207649_10167333 | |||
| 409 | Ga0207652_10227399 | |||
| 410 | Ga0207652_10228218 | |||
| 411 | Ga0207646_10006631 | |||
| 412 | Ga0207646_10063707 | |||
| 413 | Ga0207664_10104663 | |||
| 414 | Ga0207706_10041851 | |||
| 415 | Ga0207670_10234639 | |||
| 416 | Ga0207661_10059783 | |||
| 417 | Ga0207679_10018198 | |||
| 418 | Ga0207651_10012426 | |||
| 419 | Ga0207640_10101126 | |||
| 420 | Ga0207677_10249672 | |||
| 421 | Ga0207639_10077189 | |||
| 422 | Ga0207678_10326713 | |||
| 423 | Ga0207648_10025571 | |||
| 424 | Ga0265337_1000559 | |||
| 425 | Ga0265337_1018000 | |||
| 426 | Ga0265326_10000430 | |||
| 427 | Ga0265319_1000195 | |||
| 428 | Ga0265319_1001022 | |||
| 429 | Ga0265334_10043491 | |||
| 430 | Ga0265318_10003449 | |||
| 431 | Ga0265323_10000802 | |||
| 432 | Ga0265323_10005478 | |||
| 433 | Ga0265323_10007714 | |||
| 434 | Ga0265323_10034365 | |||
| 435 | Ga0265322_10000412 | |||
| 436 | Ga0265336_10000067 | |||
| 437 | Ga0265338_10000126 | |||
| 438 | Ga0265338_10000612 | |||
| 439 | Ga0265338_10001417 | |||
| 440 | Ga0265338_10031609 | |||
| 441 | Ga0265324_10001309 | |||
| 442 | Ga0265324_10016676 | |||
| 443 | Ga0265330_10002985 | |||
| 444 | Ga0265330_10015770 | |||
| 445 | Ga0265332_10001796 | |||
| 446 | Ga0265332_10002961 | |||
| 447 | Ga0265332_10049177 | |||
| 448 | Ga0265328_10005492 | |||
| 449 | Ga0265320_10000946 | |||
| 450 | Ga0265320_10003121 | |||
| 451 | Ga0265325_10082337 | |||
| 452 | Ga0265329_10001663 | |||
| 453 | Ga0265327_10051719 | |||
| 454 | Ga0265316_10003319 | |||
| 455 | Ga0265316_10005654 | |||
| 456 | Ga0265316_10008240 | |||
| 457 | Ga0265316_10009318 | |||
| 458 | Ga0265316_10017488 | |||
| 459 | Ga0265316_10020683 | |||
| 460 | Ga0265316_10024529 | |||
| 461 | Ga0265316_10043445 | |||
| 462 | Ga0265316_10054633 | |||
| 463 | Ga0265313_10001625 | |||
| 464 | Ga0316575_10010308 | |||
| 465 | Ga0316575_10024833 | |||
| 466 | Ga0316575_10025129 | |||
| 467 | Ga0316575_10027674 | |||
| 468 | Ga0316575_10038864 | |||
| 469 | Ga0316579_10000598 | |||
| 470 | Ga0316579_10003797 | |||
| 471 | Ga0316579_10011900 | |||
| 472 | Ga0316579_10019453 | |||
| 473 | Ga0316579_10066764 | |||
| 474 | Ga0316579_10095862 | |||
| 475 | Ga0265314_10000893 | |||
| 476 | Ga0265342_10007076 | |||
| 477 | Ga0265342_10044341 | |||
| 478 | Ga0265342_10091107 | |||
| 479 | Ga0316576_10001795 | |||
| 480 | Ga0316576_10001871 | |||
| 481 | Ga0316576_10001890 | |||
| 482 | Ga0316576_10011340 | |||
| 483 | Ga0316576_10029804 | |||
| 484 | Ga0316576_10031971 | |||
| 485 | Ga0316576_10046782 | |||
| 486 | Ga0316576_10060046 | |||
| 487 | Ga0316576_10228800 | |||
| 488 | Ga0316578_10000240 | |||
| 489 | Ga0316578_10004452 | |||
| 490 | Ga0316578_10157627 | |||
| 491 | Ga0316577_10001841 | |||
| 492 | Ga0316577_10002618 | |||
| 493 | Ga0316577_10026635 | |||
| 494 | Ga0316577_10032107 | |||
| 495 | Ga0316577_10058411 | |||
| 496 | Ga0316577_10090317 | |||
| 497 | Ga0316577_10126051 | |||
| 498 | Ga0316577_10222895 | |||
| 499 | Ga0316577_10265333 | |||
| 500 | Ga0307412_10146592 | |||
| 501 | Ga0307409_100311931 | |||
| 502 | Ga0307411_10137833 | |||
| 503 | Ga0316583_10003881 | |||
| 504 | Ga0316583_10009190 | |||
| 505 | Ga0316583_10013212 | |||
| 506 | Ga0316583_10013586 | |||
| 507 | Ga0316583_10018437 | |||
| 508 | Ga0316583_10022297 | |||
| 509 | Ga0316583_10033383 | |||
| 510 | Ga0316583_10037338 | |||
| 511 | Ga0316583_10069714 | |||
| 512 | Ga0316585_10000056 | |||
| 513 | Ga0316585_10002920 | |||
| 514 | Ga0316585_10011411 | |||
| 515 | Ga0316585_10018928 | |||
| 516 | Ga0316585_10050698 | |||
| 517 | Ga0316580_10002181 | |||
| 518 | Ga0316580_10002777 | |||
| 519 | Ga0316580_10004002 | |||
| 520 | Ga0316580_10009867 | |||
| 521 | Ga0316580_10034817 | |||
| 522 | Ga0316593_10025961 | |||
| 523 | Ga0316593_10089337 | |||
| 524 | Ga0316593_10098151 | |||
| 525 | Ga0316593_10107700 | |||
| 526 | Ga0316593_10114075 | |||
| 527 | Ga0316586_1005311 | |||
| 528 | Ga0316586_1015178 | |||
| 529 | Ga0316586_1023310 | |||
| 530 | Ga0316588_1000033 | |||
| 531 | Ga0316588_1009994 | |||
| 532 | Ga0316588_1013761 | |||
| 533 | Ga0316588_1017884 | |||
| 534 | Ga0316588_1019124 | |||
| 535 | Ga0316588_1045447 | |||
| 536 | Ga0316588_1048751 | |||
| 537 | Ga0316587_1025397 | |||
| 538 | Ga0316587_1027003 | |||
| 539 | Ga0316596_1027503 | |||
| 540 | Ga0316596_1050937 | |||
| 541 | Ga0316596_1054276 | |||
| 542 | Ga0316596_1059748 | |||
| 543 | Ga0373944_0042716 | |||
| 544 | Ga0373943_0030214 | |||
| 545 | Ga0316574_0000449 | |||
| 546 | Ga0316574_0001749 | |||
| 547 | Ga0316574_0003291 | |||
| 548 | Ga0316574_0024752 | |||
| 549 | Ga0316574_0027879 | |||
| 550 | Ga0316574_0050288 | |||
| 551 | Ga0316574_0052233 | |||
| 552 | Ga0316574_0276418 | |||
| 553 | Ga0316582_0001098 | |||
| 554 | Ga0316582_0005024 | |||
| 555 | Ga0316582_0005332 | |||
| 556 | Ga0316582_0005408 | |||
| 557 | Ga0316582_0012125 | |||
| 558 | Ga0316582_0022810 | |||
| 559 | Ga0316582_0027430 | |||
| 560 | Ga0316582_0038234 | |||
| 561 | Ga0316582_0051931 | |||
| 562 | Ga0316582_0074336 | |||
| 563 | Ga0316582_0134887 | |||
| 564 | Ga0316582_0287909 | |||
| 565 | Ga0316582_0295372 | |||
| 566 | Ga0316584_0000912 | |||
| 567 | Ga0316584_0001733 | |||
| 568 | Ga0316584_0003938 | |||
| 569 | Ga0316584_0005091 | |||
| 570 | Ga0316584_0010779 | |||
| 571 | Ga0316584_0011773 | |||
| 572 | Ga0316584_0013862 | |||
| 573 | Ga0316584_0028311 | |||
| 574 | Ga0316584_0035295 | |||
| 575 | Ga0316584_0049533 | |||
| 576 | Ga0316584_0087170 | |||
| 577 | Ga0316584_0089635 | |||
| 578 | Ga0316584_0144502 | |||
| 579 | Ga0316584_0233707 | |||
| 580 | Ga0316584_0255091 | |||
| 581 | Ga0316584_0301605 | |||
| 582 | Ga0316584_0349939 | |||
| 583 | Ga0316581_0033388 | |||
| 584 | Ga0316581_0036997 | |||
| 585 | Ga0316581_0079933 | |||
| 586 | Ga0400484_29949 | |||
| 587 | Ga0400490_13851 | |||
| 588 | Ga0400490_26700 | |||
| 589 | Ga0400490_30478 | |||
| 590 | Ga0400491_14784 | |||
| 591 | Ga0400485_03194 | |||
| 592 | Ga0400485_14777 | |||
| 593 | Ga0400488_41040 | |||
| 594 | Ga0400488_41500 | |||
| 595 | Ga0400488_60968 | |||
| 596 | Ga0400488_63662 | |||
| 597 | Ga0400486_02085 | |||
| 598 | Ga0400486_15387 | |||
| 599 | Ga0400486_16162 | |||
| 600 | Ga0400486_22630 | |||
| 601 | Ga0400483_008525 | |||
| 602 | Ga0400483_021534 | |||
| 603 | Ga0400483_027424 | |||
| 604 | Ga0400483_071908 | |||
| 605 | Ga0400483_204226 | |||
| 606 | Ga0400483_232415 | |||
| 607 | Ga0400483_279390 | |||
| 608 | Ga0400483_282195 | |||
| 609 | Ga0400489_10290 | |||
| 610 | Ga0400489_12948 | |||
| 611 | Ga0400489_19306 | |||
| 612 | Ga0400489_23168 | |||
| 613 | Ga0400489_25882 | |||
| 614 | Ga0400489_54455 | |||
| 615 | Ga0400489_86539 | |||
| 616 | Ga0400487_07508 | |||
| 617 | Ga0400487_30347 | |||
| 618 | Ga0400487_35200 | |||
| 619 | Ga0400487_36967 | |||
| 620 | Ga0400487_40723 | |||
| 621 | Ga0451577_0000181 | |||
| 622 | Ga0451577_0000741 | |||
| 623 | Ga0451577_0001270 | |||
| 624 | Ga0451577_0010274 | |||
| 625 | Ga0451577_0459930 | |||
| 626 | Ga0453683_0000955 | |||
| 627 | Ga0453683_0009601 | |||
| 628 | Ga0453684_0000039 | |||
| 629 | Ga0453684_0000592 | |||
| 630 | Ga0453684_0003605 | |||
| 631 | Ga0453684_0004830 | |||
| 632 | Ga0453684_0056960 | |||
| 633 | Ga0453684_0160197 | |||
| 634 | Ga0453684_0260918 | |||
| 635 | Ga0453684_0275929 | |||
| 636 | Ga0453684_0364228 | |||
| 637 | Ga0451576_0071500 | |||
| 638 | Ga0451576_0113998 | |||
| 639 | Ga0495627_009753 | |||
| 640 | Ga0495639_0039944 | |||
| 641 | Ga0495584_0054641 | |||
| 642 | Ga0495606_0075262 | |||
| 643 | Ga0495631_0042489 | |||
| 644 | Ga0495663_0017531 | |||
| 645 | Ga0495597_0027583 | |||
| 646 | Ga0495633_0012306 | |||
| 647 | Ga0495656_0011859 | |||
| 648 | Ga0495668_0017216 | |||
| 649 | Ga0495661_0011927 | |||
| 650 | Ga0495588_0046500 | |||
| 651 | Ga0495647_0143636 | |||
| 652 | Ga0495613_0084270 | |||
| 653 | Ga0495589_0038142 | |||
| 654 | Ga0495636_0000521 | |||
| 655 | Ga0495636_0007659 | |||
| 656 | Ga0495677_0010998 | |||
| 657 | Ga0495681_0088632 | |||
| 658 | Ga0495686_0003258 | |||
| 659 | Ga0501036_0113064 | |||
| 660 | Ga0501037_0058877 | |||
| 661 | Ga0501037_0064907 | |||
| 662 | Ga0501038_0021029 | |||
| 663 | Ga0501047_0006630 | |||
| 664 | Ga0501069_0005501 | |||
| 665 | Ga0501070_0000747 | |||
| 666 | Ga0501257_004918 | |||
| 667 | Ga0501225_0069181 | |||
| 668 | Ga0501266_009471 | |||
| 669 | Ga0501268_002357 | |||
| 670 | Ga0501035_0003478 | |||
| 671 | Ga0501044_0004843 | |||
| 672 | nmdc:mga0rr50_281964_c1 | |||
| 673 | nmdc:mga08x19_236116_c1 | |||
| 674 | nmdc:mga08x19_93755_c1 | |||
| 675 | Ga0501084_0213506 | |||
| 676 | 2740990112 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF02882
THF_DHG_CYH_C
Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
165
340
0.95
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6de8-assembly1.cif.gz_A | crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni | 0.9839 | 19 | 304 |
| 6ape-assembly1.cif.gz_A | crystal structure of bifunctional protein fold from helicobacter pylori | 0.9829 | 18 | 307 |
| 6v6y-assembly1.cif.gz_A-2 | crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) | 0.9773 | 17 | 304 |
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.9738 | 18 | 305 |
| 6ape-assembly1.cif.gz_A | crystal structure of bifunctional protein fold from helicobacter pylori | 0.9727 | 18 | 307 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0F3H3_60_174_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9902 | 28 | 139 | 3.40.50.10860 |
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.988 | 48 | 128 | 3.40.50.10860 |
| af_P9WG81_7_102_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.9844 | 22 | 117 | 3.40.50.1220 |
| af_P9WG81_104_273_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9795 | 119 | 296 | 3.40.50.10860 |
| 4cjxA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9775 | 44 | 129 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524J193-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 1.001 | 220 | 304 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
| AF-A0A1C3VT20-F1-model_v4 | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain | 0.9934 | 19 | 162 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A7Z7YRP5-F1-model_v4 | methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) | 0.9934 | 34 | 165 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A8A8TLP2-F1-model_v4 | deleted | 0.9933 | 17 | 309 |
|
| AF-A0A7W0WIY7-F1-model_v4 | methylenetetrahydrofolate dehydrogenase (NADP(+)) (EC 1.5.1.5) | 0.9933 | 18 | 172 |
GO:0004477
GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |