F413357

General Info

Members Datasets Scaffolds Average Seq Length
338 210 676 300

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10006332|Ga0070658_100063327
Length 300
Sequence MIEQAGGVPRGDTRLEALGWTHVYSGKVRDLYTSPAAPGRVLVVASDRVSAFDRMLEPSIPNKGALLTQLSLWWFGRLGMRNHLAAAHPSLGEHLPPGIAERAMLVHELDMHPIEAVVRGYLVGSGWAEYQKVQSVCGIPLPAGLSNGDQLPEPIYTPAFKAPAGQHDENISFERTVELVGADTAAAIRDAALAIYAAAATTAAERGLILADTKFEFGDDPESGELTLADEVLTSDSSRYWDAEGYAAGGPHRLDSFDKQIVRDWLLAHWDKTGTPPELPADIVALTADRYQSLIDRLTA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
103 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
104 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
105 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
199 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
200 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
206 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
210 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.73
Nodule 0
Rhizoplane 1.78
Rhizosphere 86.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10006332 3300005327 Bacteria 9592
2 rootH2_10009552 3300003320 Bacteria 9839
3 rootL2_10002635 3300003322 Bacteria 2581
4 rootL2_10228481 3300003322 Bacteria 3853
5 rootH1_10045608 3300003323 Bacteria 4320
6 rootH1_10045609 3300003323 Bacteria 5892
7 Ga0070658_10099166 3300005327 Bacteria 2407
8 Ga0070683_100004142 3300005329 Bacteria 11884
9 Ga0070683_100038631 3300005329 Bacteria 4377
10 Ga0068869_100000285 3300005334 Bacteria 26944
11 Ga0068868_100026031 3300005338 Bacteria 4455
12 Ga0070660_100158549 3300005339 Bacteria 1822
13 Ga0070661_100032480 3300005344 Bacteria 3779
14 Ga0070671_100145568 3300005355 Bacteria 2000
15 Ga0070671_100234560 3300005355 Bacteria 1557
16 Ga0070659_100003920 3300005366 Bacteria 10588
17 Ga0070667_100011846 3300005367 Bacteria 7211
18 Ga0068853_100023306 3300005539 Bacteria 5180
19 Ga0070672_100090797 3300005543 Bacteria 2464
20 Ga0070695_100099679 3300005545 Bacteria 1954
21 Ga0068855_100012913 3300005563 Bacteria 10078
22 Ga0068855_100108750 3300005563 Bacteria 3184
23 Ga0068855_100148836 3300005563 Bacteria 2663
24 Ga0068857_100044882 3300005577 Bacteria 3920
25 Ga0068857_100163061 3300005577 Bacteria 2023
26 Ga0068856_100009904 3300005614 Bacteria 9256
27 Ga0068856_100194632 3300005614 Bacteria 2041
28 Ga0068856_100390270 3300005614 Bacteria 1412
29 Ga0068852_100054177 3300005616 Bacteria 3456
30 Ga0068852_100521660 3300005616 Bacteria 1185
31 Ga0068859_100056714 3300005617 Bacteria 3944
32 Ga0068851_10000030 3300005834 Bacteria 114502
33 Ga0068863_100113790 3300005841 Bacteria 2578
34 Ga0068858_100000519 3300005842 Bacteria 40469
35 Ga0068858_100310809 3300005842 Bacteria 1505
36 Ga0070717_10000030 3300006028 Bacteria 142934
37 Ga0075364_10000835 3300006051 Bacteria 16244
38 Ga0097621_100004784 3300006237 Bacteria 9474
39 Ga0068871_100003470 3300006358 Bacteria 10837
40 Ga0075434_100048700 3300006871 Bacteria 4205
41 Ga0097620_100056711 3300006931 Bacteria 3944
42 Ga0105240_10001647 3300009093 Bacteria 37919
43 Ga0105240_10446633 3300009093 Bacteria 1448
44 Ga0105245_10007232 3300009098 Bacteria 9724
45 Ga0105245_10042462 3300009098 Bacteria 4058
46 Ga0105247_10031193 3300009101 Bacteria 3234
47 Ga0105241_10006332 3300009174 Bacteria 8731
48 Ga0105248_10004394 3300009177 Bacteria 15605
49 Ga0105248_10022957 3300009177 Bacteria 6928
50 Ga0105237_10000724 3300009545 Bacteria 45653
51 Ga0105237_10022589 3300009545 Bacteria 6452
52 Ga0105237_10032438 3300009545 Bacteria 5288
53 Ga0105238_10095787 3300009551 Bacteria 2954
54 Ga0157369_10221685 3300013105 Bacteria 1980
55 Ga0163163_10008898 3300014325 Bacteria 8942
56 Ga0163163_10115396 3300014325 Bacteria 2717
57 Ga0157379_10002899 3300014968 Bacteria 14472
58 Ga0209148_1000744 3300025254 Bacteria 25149
59 Ga0209233_1018307 3300025261 Bacteria 1888
60 Ga0207656_10000001 3300025321 Bacteria 1323684
61 Ga0207692_10004369 3300025898 Bacteria 5599
62 Ga0207710_10051807 3300025900 Bacteria 1844
63 Ga0207685_10001735 3300025905 Bacteria 4735
64 Ga0207699_10228242 3300025906 Bacteria 1274
65 Ga0207705_10176463 3300025909 Bacteria 1611
66 Ga0207654_10000001 3300025911 Bacteria 1816198
67 Ga0207695_10001789 3300025913 Bacteria 33914
68 Ga0207671_10000001 3300025914 Bacteria 1318881
69 Ga0207671_10061350 3300025914 Bacteria 2789
70 Ga0207693_10048439 3300025915 Bacteria 3337
71 Ga0207657_10001206 3300025919 Bacteria 27523
72 Ga0207649_10096201 3300025920 Bacteria 1950
73 Ga0207694_10004764 3300025924 Bacteria 10550
74 Ga0207694_10130816 3300025924 Bacteria 2011
75 Ga0207664_10123127 3300025929 Bacteria 2173
76 Ga0207644_10106616 3300025931 Bacteria 2113
77 Ga0207690_10001234 3300025932 Bacteria 16156
78 Ga0207704_10001069 3300025938 Bacteria 12176
79 Ga0207665_10046201 3300025939 Bacteria 2918
80 Ga0207691_10085704 3300025940 Bacteria 2827
81 Ga0207711_10006178 3300025941 Bacteria 10122
82 Ga0207711_10013078 3300025941 Bacteria 6894
83 Ga0207689_10001017 3300025942 Bacteria 26945
84 Ga0207661_10042162 3300025944 Bacteria 3597
85 Ga0207667_10005520 3300025949 Bacteria 15431
86 Ga0207667_10013652 3300025949 Bacteria 9284
87 Ga0207658_10020988 3300025986 Bacteria 4528
88 Ga0207703_10000813 3300026035 Bacteria 30797
89 Ga0207639_10140404 3300026041 Bacteria 2012
90 Ga0207702_10004924 3300026078 Bacteria 11741
91 Ga0207702_10321315 3300026078 Bacteria 1474
92 Ga0207641_10621791 3300026088 Bacteria 1059
93 Ga0207674_10014478 3300026116 Bacteria 8709
94 Ga0207674_10180017 3300026116 Bacteria 2065
95 Ga0207698_10047276 3300026142 Bacteria 3258
96 Ga0265319_1000487 3300028563 Bacteria 27649
97 Ga0265319_1004083 3300028563 Bacteria 7357
98 Ga0265319_1004276 3300028563 Bacteria 7109
99 Ga0265319_1005161 3300028563 Bacteria 6312
100 Ga0265319_1017362 3300028563 Bacteria 2737
101 Ga0265334_10001295 3300028573 Bacteria 12072
102 Ga0265334_10001950 3300028573 Bacteria 9782
103 Ga0265334_10040390 3300028573 Bacteria 1828
104 Ga0265318_10000016 3300028577 Bacteria 184782
105 Ga0265318_10000369 3300028577 Bacteria 35381
106 Ga0265318_10000668 3300028577 Bacteria 23380
107 Ga0265318_10032142 3300028577 Bacteria 2032
108 Ga0265318_10040344 3300028577 Bacteria 1777
109 Ga0265323_10000024 3300028653 Bacteria 82291
110 Ga0265323_10004435 3300028653 Bacteria 6048
111 Ga0265323_10004782 3300028653 Bacteria 5803
112 Ga0265323_10008292 3300028653 Bacteria 4290
113 Ga0265323_10036404 3300028653 Bacteria 1809
114 Ga0265322_10000210 3300028654 Bacteria 25740
115 Ga0265322_10001512 3300028654 Bacteria 7539
116 Ga0265336_10020271 3300028666 Bacteria 2136
117 Ga0307515_10166947 3300028794 Bacteria 2214
118 Ga0265338_10000132 3300028800 Bacteria 137378
119 Ga0265338_10004352 3300028800 Bacteria 19166
120 Ga0265324_10007780 3300029957 Bacteria 4311
121 Ga0265324_10011089 3300029957 Bacteria 3447
122 Ga0265330_10005889 3300031235 Bacteria 6073
123 Ga0265330_10012800 3300031235 Bacteria 3915
124 Ga0265332_10051678 3300031238 Bacteria 1765
125 Ga0265320_10000638 3300031240 Bacteria 26800
126 Ga0265320_10001893 3300031240 Bacteria 14759
127 Ga0265320_10001956 3300031240 Bacteria 14549
128 Ga0265320_10004453 3300031240 Bacteria 9179
129 Ga0265320_10016732 3300031240 Bacteria 4100
130 Ga0265320_10061230 3300031240 Bacteria 1794
131 Ga0265320_10062986 3300031240 Bacteria 1765
132 Ga0265320_10070471 3300031240 Bacteria 1649
133 Ga0265320_10077119 3300031240 Bacteria 1560
134 Ga0265329_10029973 3300031242 Bacteria 1775
135 Ga0265329_10069920 3300031242 Bacteria 1110
136 Ga0265340_10002544 3300031247 Bacteria 10365
137 Ga0265339_10025720 3300031249 Bacteria 3375
138 Ga0265339_10155762 3300031249 Bacteria 1152
139 Ga0265331_10006709 3300031250 Bacteria 6755
140 Ga0265331_10012383 3300031250 Bacteria 4620
141 Ga0265331_10023851 3300031250 Bacteria 3101
142 Ga0265327_10000029 3300031251 Bacteria 352607
143 Ga0265327_10000664 3300031251 Bacteria 55153
144 Ga0265327_10022186 3300031251 Bacteria 3806
145 Ga0265327_10023658 3300031251 Bacteria 3633
146 Ga0265327_10027282 3300031251 Bacteria 3290
147 Ga0265327_10076367 3300031251 Bacteria 1665
148 Ga0265316_10001702 3300031344 Bacteria 23329
149 Ga0265316_10050540 3300031344 Bacteria 3269
150 Ga0265316_10169167 3300031344 Bacteria 1631
151 Ga0307513_10394040 3300031456 Bacteria 1121
152 Ga0307408_100000009 3300031548 Bacteria 426576
153 Ga0265313_10000214 3300031595 Bacteria 62177
154 Ga0265313_10000456 3300031595 Bacteria 43250
155 Ga0265313_10002309 3300031595 Bacteria 16712
156 Ga0265313_10005764 3300031595 Bacteria 9011
157 Ga0265313_10033792 3300031595 Bacteria 2594
158 Ga0265313_10101432 3300031595 Bacteria 1277
159 Ga0307508_10000044 3300031616 Bacteria 143750
160 Ga0307514_10020115 3300031649 Bacteria 5453
161 Ga0265314_10001590 3300031711 Bacteria 24962
162 Ga0265314_10002340 3300031711 Bacteria 19566
163 Ga0265314_10019905 3300031711 Bacteria 5189
164 Ga0265314_10048425 3300031711 Bacteria 2983
165 Ga0265314_10074296 3300031711 Bacteria 2265
166 Ga0265314_10148438 3300031711 Bacteria 1441
167 Ga0265342_10006235 3300031712 Bacteria 8906
168 Ga0265342_10012037 3300031712 Bacteria 5874
169 Ga0265342_10038155 3300031712 Bacteria 2927
170 Ga0265342_10143038 3300031712 Bacteria 1333
171 Ga0307410_10000017 3300031852 Bacteria 69760
172 Ga0307407_10000071 3300031903 Bacteria 39282
173 Ga0307409_100000007 3300031995 Bacteria 81489
174 Ga0307416_100000023 3300032002 Bacteria 186960
175 Ga0307414_10256422 3300032004 Bacteria 1457
176 Ga0373940_0035656 3300035088 Bacteria 1347
177 Ga0373944_0015442 3300035089 Bacteria 2143
178 Ga0373949_0058058 3300035090 Bacteria 990
179 Ga0373951_0018127 3300035091 Bacteria 1598
180 Ga0373923_0011747 3300035111 Bacteria 3223
181 Ga0373932_0004605 3300035112 Bacteria 3257
182 Ga0373936_0089618 3300035113 Bacteria 1288
183 Ga0373941_0002547 3300035115 Bacteria 4031
184 Ga0373953_0014232 3300035117 Bacteria 2857
185 Ga0373954_0023953 3300035118 Bacteria 2781
186 Ga0373956_0024525 3300035119 Bacteria 2599
187 Ga0373957_0025483 3300035120 Bacteria 2131
188 Ga0373946_0014111 3300035171 Bacteria 3009
189 Ga0373955_0052513 3300035172 Bacteria 2223
190 Ga0373942_0040770 3300035207 Bacteria 1267
191 Ga0373935_0030792 3300035692 Bacteria 3326
192 Ga0373927_0159555 3300035695 Bacteria 1477
193 Ga0373933_0004635 3300035724 Bacteria 7529
194 Ga0373947_0069358 3300035725 Bacteria 2157
195 Ga0373947_0094661 3300035725 Bacteria 1868
196 Ga0373937_0001958 3300036401 Bacteria 17262
197 Ga0373937_0304824 3300036401 Bacteria 1506
198 Ga0395905_0000026 3300037471 Bacteria 315051
199 Ga0395901_0050165 3300038443 Bacteria 4337
200 Ga0451577_0000023 3300042876 Bacteria 419051
201 Ga0451577_0041316 3300042876 Bacteria 4139
202 Ga0451577_0072797 3300042876 Bacteria 3066
203 Ga0451577_0179991 3300042876 Bacteria 1906
204 Ga0453683_0000322 3300044673 Bacteria 58997
205 Ga0453684_0000287 3300044712 Bacteria 216926
206 Ga0453684_0040136 3300044712 Bacteria 6365
207 Ga0453684_0157839 3300044712 Bacteria 2687
208 Ga0453684_0456009 3300044712 Bacteria 1422
209 Ga0451576_0000052 3300045051 Bacteria 310414
210 Ga0451576_0000672 3300045051 Bacteria 70045
211 Ga0451576_0001913 3300045051 Bacteria 33348
212 Ga0451576_0031599 3300045051 Bacteria 5642
213 Ga0451576_0078897 3300045051 Bacteria 3426
214 Ga0451576_0127285 3300045051 Bacteria 2654
215 Ga0466967_0053707 3300045976 Bacteria 3542
216 Ga0495592_0005801 3300046454 Bacteria 9153
217 Ga0495603_0080134 3300046455 Bacteria 1913
218 Ga0495590_0000874 3300046457 Bacteria 13506
219 Ga0495629_0025156 3300046459 Bacteria 4234
220 Ga0495651_0014941 3300046462 Bacteria 6002
221 Ga0495653_0026588 3300046463 Bacteria 4637
222 Ga0495653_0083986 3300046463 Bacteria 2346
223 Ga0495650_0000130 3300046471 Bacteria 175669
224 Ga0495580_0140432 3300046472 Bacteria 1674
225 Ga0495662_0025221 3300046476 Bacteria 2870
226 Ga0495664_0016313 3300046477 Bacteria 4229
227 Ga0495594_0020762 3300046499 Bacteria 3501
228 Ga0495608_0007252 3300046511 Bacteria 7840
229 Ga0495628_0082785 3300046516 Bacteria 2492
230 Ga0495666_0024593 3300046526 Bacteria 2975
231 Ga0495666_0113970 3300046526 Bacteria 1269
232 Ga0495652_0349587 3300046529 Bacteria 1059
233 Ga0495640_0045316 3300046533 Bacteria 3052
234 Ga0495586_0084275 3300046535 Bacteria 1749
235 Ga0495645_0060618 3300046543 Bacteria 2742
236 Ga0495634_0044035 3300046642 Bacteria 3022
237 Ga0495635_0048053 3300046663 Bacteria 2941
238 Ga0495635_0082625 3300046663 Bacteria 2198
239 Ga0495657_0072725 3300046675 Bacteria 2241
240 Ga0495599_0028113 3300046678 Bacteria 3523
241 Ga0495623_0009186 3300046679 Bacteria 6414
242 Ga0495658_0029663 3300046683 Bacteria 2964
243 Ga0495581_0019562 3300047315 Bacteria 3929
244 Ga0495604_0117078 3300047317 Bacteria 1933
245 Ga0495674_0081336 3300047319 Bacteria 2778
246 Ga0495672_0029498 3300047320 Bacteria 3454
247 Ga0495680_0079063 3300047322 Bacteria 2487
248 Ga0495675_0014009 3300047444 Bacteria 5069
249 Ga0495602_0049634 3300048088 Bacteria 3756
250 Ga0496101_0142724 3300048904 Bacteria 1826
251 Ga0496102_0119074 3300048905 Bacteria 2465
252 Ga0496106_0079127 3300048909 Bacteria 2523
253 Ga0496107_0064686 3300048910 Bacteria 2651
254 Ga0496112_0051962 3300048915 Bacteria 4021
255 Ga0496114_0124616 3300048917 Bacteria 2219
256 Ga0496117_0033320 3300048920 Bacteria 3897
257 Ga0496117_0127829 3300048920 Bacteria 1547
258 Ga0496118_0024197 3300048921 Bacteria 5250
259 Ga0496118_0138308 3300048921 Bacteria 1550
260 Ga0496119_0001781 3300048922 Bacteria 25111
261 Ga0496119_0001915 3300048922 Bacteria 23846
262 Ga0496120_0001628 3300048923 Bacteria 26017
263 Ga0496120_0009177 3300048923 Bacteria 7050
264 Ga0496120_0010090 3300048923 Bacteria 6623
265 Ga0496120_0027111 3300048923 Bacteria 3530
266 Ga0496121_0000046 3300048924 Bacteria 335942
267 Ga0501032_0000091 3300049569 Bacteria 78893
268 Ga0501032_0020041 3300049569 Bacteria 4664
269 Ga0501032_0049202 3300049569 Bacteria 2844
270 Ga0501033_0000041 3300049570 Bacteria 139951
271 Ga0501033_0000200 3300049570 Bacteria 57307
272 Ga0501034_0018850 3300049571 Bacteria 7072
273 Ga0501034_0021126 3300049571 Bacteria 6641
274 Ga0501034_0057621 3300049571 Bacteria 3905
275 Ga0501034_0067323 3300049571 Bacteria 3594
276 Ga0501036_0002642 3300049572 Bacteria 14128
277 Ga0501037_0042156 3300049573 Bacteria 3354
278 Ga0501037_0059457 3300049573 Bacteria 2788
279 Ga0501038_0000092 3300049574 Bacteria 76372
280 Ga0501041_0247829 3300049577 Bacteria 1120
281 Ga0501043_0004178 3300049579 Bacteria 11802
282 Ga0501043_0032721 3300049579 Bacteria 4089
283 Ga0501043_0066974 3300049579 Bacteria 2820
284 Ga0501043_0110350 3300049579 Bacteria 2160
285 Ga0501046_0001092 3300049580 Bacteria 26566
286 Ga0501046_0003237 3300049580 Bacteria 14964
287 Ga0501046_0011299 3300049580 Bacteria 7640
288 Ga0501046_0012905 3300049580 Bacteria 7104
289 Ga0501047_0000858 3300049581 Bacteria 31137
290 Ga0501047_0006775 3300049581 Bacteria 10765
291 Ga0501047_0028280 3300049581 Bacteria 5404
292 Ga0501047_0037842 3300049581 Bacteria 4666
293 Ga0501047_0076240 3300049581 Bacteria 3227
294 Ga0501048_0043467 3300049582 Bacteria 3216
295 Ga0501048_0089533 3300049582 Bacteria 2171
296 Ga0501070_0003296 3300049586 Bacteria 14014
297 Ga0501070_0122088 3300049586 Bacteria 2153
298 Ga0501071_0273378 3300049587 Bacteria 1278
299 Ga0501072_0137960 3300049588 Bacteria 1945
300 Ga0501073_0079609 3300049589 Bacteria 2280
301 Ga0501080_0000085 3300049742 Bacteria 62675
302 Ga0501080_0170452 3300049742 Bacteria 2008
303 Ga0501083_0003655 3300049744 Bacteria 10793
304 Ga0501083_0074429 3300049744 Bacteria 2256
305 Ga0501083_0109472 3300049744 Bacteria 1817
306 Ga0501035_0000264 3300049822 Bacteria 62238
307 Ga0501035_0003702 3300049822 Bacteria 14579
308 Ga0501035_0014445 3300049822 Bacteria 7287
309 Ga0501035_0038905 3300049822 Bacteria 4306
310 Ga0501035_0285449 3300049822 Bacteria 1394
311 Ga0501044_0005596 3300049823 Bacteria 13950
312 Ga0501044_0007889 3300049823 Bacteria 11702
313 Ga0501044_0051535 3300049823 Bacteria 4243
314 Ga0501044_0140535 3300049823 Bacteria 2403
315 Ga0501044_0141550 3300049823 Bacteria 2394
316 nmdc:mga0yw44_41438_c1 3300050492 Bacteria 2741
317 nmdc:mga08y16_263817_c1 3300050511 Bacteria 1778
318 nmdc:mga0n895_98497_c1 3300050512 Bacteria 2931
319 nmdc:mga0rr50_216591_c1 3300050513 Bacteria 1580
320 nmdc:mga0sz30_150514_c1 3300050516 Bacteria 1029
321 Ga0495612_0016855 3300053078 Bacteria 2927
322 Ga0495595_0031686 3300053084 Bacteria 2377
323 Ga0495619_0106151 3300053085 Bacteria 1915
324 Ga0500651_0000109 3300053093 Bacteria 50554
325 Ga0500554_033121 3300053102 Bacteria 1539
326 Ga0500572_000590 3300053111 Bacteria 12247
327 Ga0500559_0000113 3300053136 Bacteria 63512
328 Ga0500559_0053843 3300053136 Bacteria 1782
329 Ga0500568_0004884 3300053139 Bacteria 7066
330 Ga0500568_0007371 3300053139 Bacteria 5403
331 Ga0500590_001629 3300053148 Bacteria 9360
332 Ga0500616_0015019 3300053153 Bacteria 4437
333 Ga0500620_000318 3300053155 Bacteria 9099
334 Ga0500552_003552 3300053733 Bacteria 1592
335 Ga0501084_0284098 3300054114 Bacteria 1397
336 Ga0501082_0327046 3300060353 Bacteria 1336
337 2788437462 2786546940 Bacteria 6396474
338 2857739063 2857737099 Bacteria 3104305
339 Ga0070658_10006332
340 rootH2_10009552
341 rootL2_10002635
342 rootL2_10228481
343 rootH1_10045608
344 rootH1_10045609
345 Ga0070658_10099166
346 Ga0070683_100004142
347 Ga0070683_100038631
348 Ga0068869_100000285
349 Ga0068868_100026031
350 Ga0070660_100158549
351 Ga0070661_100032480
352 Ga0070671_100145568
353 Ga0070671_100234560
354 Ga0070659_100003920
355 Ga0070667_100011846
356 Ga0068853_100023306
357 Ga0070672_100090797
358 Ga0070695_100099679
359 Ga0068855_100012913
360 Ga0068855_100108750
361 Ga0068855_100148836
362 Ga0068857_100044882
363 Ga0068857_100163061
364 Ga0068856_100009904
365 Ga0068856_100194632
366 Ga0068856_100390270
367 Ga0068852_100054177
368 Ga0068852_100521660
369 Ga0068859_100056714
370 Ga0068851_10000030
371 Ga0068863_100113790
372 Ga0068858_100000519
373 Ga0068858_100310809
374 Ga0070717_10000030
375 Ga0075364_10000835
376 Ga0097621_100004784
377 Ga0068871_100003470
378 Ga0075434_100048700
379 Ga0097620_100056711
380 Ga0105240_10001647
381 Ga0105240_10446633
382 Ga0105245_10007232
383 Ga0105245_10042462
384 Ga0105247_10031193
385 Ga0105241_10006332
386 Ga0105248_10004394
387 Ga0105248_10022957
388 Ga0105237_10000724
389 Ga0105237_10022589
390 Ga0105237_10032438
391 Ga0105238_10095787
392 Ga0157369_10221685
393 Ga0163163_10008898
394 Ga0163163_10115396
395 Ga0157379_10002899
396 Ga0209148_1000744
397 Ga0209233_1018307
398 Ga0207656_10000001
399 Ga0207692_10004369
400 Ga0207710_10051807
401 Ga0207685_10001735
402 Ga0207699_10228242
403 Ga0207705_10176463
404 Ga0207654_10000001
405 Ga0207695_10001789
406 Ga0207671_10000001
407 Ga0207671_10061350
408 Ga0207693_10048439
409 Ga0207657_10001206
410 Ga0207649_10096201
411 Ga0207694_10004764
412 Ga0207694_10130816
413 Ga0207664_10123127
414 Ga0207644_10106616
415 Ga0207690_10001234
416 Ga0207704_10001069
417 Ga0207665_10046201
418 Ga0207691_10085704
419 Ga0207711_10006178
420 Ga0207711_10013078
421 Ga0207689_10001017
422 Ga0207661_10042162
423 Ga0207667_10005520
424 Ga0207667_10013652
425 Ga0207658_10020988
426 Ga0207703_10000813
427 Ga0207639_10140404
428 Ga0207702_10004924
429 Ga0207702_10321315
430 Ga0207641_10621791
431 Ga0207674_10014478
432 Ga0207674_10180017
433 Ga0207698_10047276
434 Ga0265319_1000487
435 Ga0265319_1004083
436 Ga0265319_1004276
437 Ga0265319_1005161
438 Ga0265319_1017362
439 Ga0265334_10001295
440 Ga0265334_10001950
441 Ga0265334_10040390
442 Ga0265318_10000016
443 Ga0265318_10000369
444 Ga0265318_10000668
445 Ga0265318_10032142
446 Ga0265318_10040344
447 Ga0265323_10000024
448 Ga0265323_10004435
449 Ga0265323_10004782
450 Ga0265323_10008292
451 Ga0265323_10036404
452 Ga0265322_10000210
453 Ga0265322_10001512
454 Ga0265336_10020271
455 Ga0307515_10166947
456 Ga0265338_10000132
457 Ga0265338_10004352
458 Ga0265324_10007780
459 Ga0265324_10011089
460 Ga0265330_10005889
461 Ga0265330_10012800
462 Ga0265332_10051678
463 Ga0265320_10000638
464 Ga0265320_10001893
465 Ga0265320_10001956
466 Ga0265320_10004453
467 Ga0265320_10016732
468 Ga0265320_10061230
469 Ga0265320_10062986
470 Ga0265320_10070471
471 Ga0265320_10077119
472 Ga0265329_10029973
473 Ga0265329_10069920
474 Ga0265340_10002544
475 Ga0265339_10025720
476 Ga0265339_10155762
477 Ga0265331_10006709
478 Ga0265331_10012383
479 Ga0265331_10023851
480 Ga0265327_10000029
481 Ga0265327_10000664
482 Ga0265327_10022186
483 Ga0265327_10023658
484 Ga0265327_10027282
485 Ga0265327_10076367
486 Ga0265316_10001702
487 Ga0265316_10050540
488 Ga0265316_10169167
489 Ga0307513_10394040
490 Ga0307408_100000009
491 Ga0265313_10000214
492 Ga0265313_10000456
493 Ga0265313_10002309
494 Ga0265313_10005764
495 Ga0265313_10033792
496 Ga0265313_10101432
497 Ga0307508_10000044
498 Ga0307514_10020115
499 Ga0265314_10001590
500 Ga0265314_10002340
501 Ga0265314_10019905
502 Ga0265314_10048425
503 Ga0265314_10074296
504 Ga0265314_10148438
505 Ga0265342_10006235
506 Ga0265342_10012037
507 Ga0265342_10038155
508 Ga0265342_10143038
509 Ga0307410_10000017
510 Ga0307407_10000071
511 Ga0307409_100000007
512 Ga0307416_100000023
513 Ga0307414_10256422
514 Ga0373940_0035656
515 Ga0373944_0015442
516 Ga0373949_0058058
517 Ga0373951_0018127
518 Ga0373923_0011747
519 Ga0373932_0004605
520 Ga0373936_0089618
521 Ga0373941_0002547
522 Ga0373953_0014232
523 Ga0373954_0023953
524 Ga0373956_0024525
525 Ga0373957_0025483
526 Ga0373946_0014111
527 Ga0373955_0052513
528 Ga0373942_0040770
529 Ga0373935_0030792
530 Ga0373927_0159555
531 Ga0373933_0004635
532 Ga0373947_0069358
533 Ga0373947_0094661
534 Ga0373937_0001958
535 Ga0373937_0304824
536 Ga0395905_0000026
537 Ga0395901_0050165
538 Ga0451577_0000023
539 Ga0451577_0041316
540 Ga0451577_0072797
541 Ga0451577_0179991
542 Ga0453683_0000322
543 Ga0453684_0000287
544 Ga0453684_0040136
545 Ga0453684_0157839
546 Ga0453684_0456009
547 Ga0451576_0000052
548 Ga0451576_0000672
549 Ga0451576_0001913
550 Ga0451576_0031599
551 Ga0451576_0078897
552 Ga0451576_0127285
553 Ga0466967_0053707
554 Ga0495592_0005801
555 Ga0495603_0080134
556 Ga0495590_0000874
557 Ga0495629_0025156
558 Ga0495651_0014941
559 Ga0495653_0026588
560 Ga0495653_0083986
561 Ga0495650_0000130
562 Ga0495580_0140432
563 Ga0495662_0025221
564 Ga0495664_0016313
565 Ga0495594_0020762
566 Ga0495608_0007252
567 Ga0495628_0082785
568 Ga0495666_0024593
569 Ga0495666_0113970
570 Ga0495652_0349587
571 Ga0495640_0045316
572 Ga0495586_0084275
573 Ga0495645_0060618
574 Ga0495634_0044035
575 Ga0495635_0048053
576 Ga0495635_0082625
577 Ga0495657_0072725
578 Ga0495599_0028113
579 Ga0495623_0009186
580 Ga0495658_0029663
581 Ga0495581_0019562
582 Ga0495604_0117078
583 Ga0495674_0081336
584 Ga0495672_0029498
585 Ga0495680_0079063
586 Ga0495675_0014009
587 Ga0495602_0049634
588 Ga0496101_0142724
589 Ga0496102_0119074
590 Ga0496106_0079127
591 Ga0496107_0064686
592 Ga0496112_0051962
593 Ga0496114_0124616
594 Ga0496117_0033320
595 Ga0496117_0127829
596 Ga0496118_0024197
597 Ga0496118_0138308
598 Ga0496119_0001781
599 Ga0496119_0001915
600 Ga0496120_0001628
601 Ga0496120_0009177
602 Ga0496120_0010090
603 Ga0496120_0027111
604 Ga0496121_0000046
605 Ga0501032_0000091
606 Ga0501032_0020041
607 Ga0501032_0049202
608 Ga0501033_0000041
609 Ga0501033_0000200
610 Ga0501034_0018850
611 Ga0501034_0021126
612 Ga0501034_0057621
613 Ga0501034_0067323
614 Ga0501036_0002642
615 Ga0501037_0042156
616 Ga0501037_0059457
617 Ga0501038_0000092
618 Ga0501041_0247829
619 Ga0501043_0004178
620 Ga0501043_0032721
621 Ga0501043_0066974
622 Ga0501043_0110350
623 Ga0501046_0001092
624 Ga0501046_0003237
625 Ga0501046_0011299
626 Ga0501046_0012905
627 Ga0501047_0000858
628 Ga0501047_0006775
629 Ga0501047_0028280
630 Ga0501047_0037842
631 Ga0501047_0076240
632 Ga0501048_0043467
633 Ga0501048_0089533
634 Ga0501070_0003296
635 Ga0501070_0122088
636 Ga0501071_0273378
637 Ga0501072_0137960
638 Ga0501073_0079609
639 Ga0501080_0000085
640 Ga0501080_0170452
641 Ga0501083_0003655
642 Ga0501083_0074429
643 Ga0501083_0109472
644 Ga0501035_0000264
645 Ga0501035_0003702
646 Ga0501035_0014445
647 Ga0501035_0038905
648 Ga0501035_0285449
649 Ga0501044_0005596
650 Ga0501044_0007889
651 Ga0501044_0051535
652 Ga0501044_0140535
653 Ga0501044_0141550
654 nmdc:mga0yw44_41438_c1
655 nmdc:mga08y16_263817_c1
656 nmdc:mga0n895_98497_c1
657 nmdc:mga0rr50_216591_c1
658 nmdc:mga0sz30_150514_c1
659 Ga0495612_0016855
660 Ga0495595_0031686
661 Ga0495619_0106151
662 Ga0500651_0000109
663 Ga0500554_033121
664 Ga0500572_000590
665 Ga0500559_0000113
666 Ga0500559_0053843
667 Ga0500568_0004884
668 Ga0500568_0007371
669 Ga0500590_001629
670 Ga0500616_0015019
671 Ga0500620_000318
672 Ga0500552_003552
673 Ga0501084_0284098
674 Ga0501082_0327046
675 2788437462
676 2857739063

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01259

SAICAR_synt

SAICAR synthetase

22

277

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z0r-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with fragment 1 0.9082 18 303
2cnq-assembly1.cif.gz_A atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate 0.9075 16 303
3r9r-assembly1.cif.gz_A structure of a phosphoribosylaminoimidazole-succinocarboxamide synthase from mycobacterium abscessus atcc 19977 / dsm 44196 0.9065 17 303
6yyb-assembly1.cif.gz_A crystal structure of saicar synthetase (purc) from mycobacterium abscessus in complex with inhibitor 0.8986 18 303
1obg-assembly1.cif.gz_A saicar-synthase complexed with atp 0.8983 16 301
ID Description Score Start End Superfamily
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9706 115 258 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9579 115 259 3.30.470.20
3r9rA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9576 115 258 3.30.470.20
1obgA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9453 115 259 3.30.470.20
af_P38025_185_330_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9284 117 250 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A556QJB8-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9936 1 303 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A1V5JQR1-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9935 111 301 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-T1CG79-F1-model_v4 phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) 0.9926 107 257 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A139SK24-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9912 1 303 GO:0004639
GO:0005524
GO:0005737
GO:0006189
AF-A0A2E4J3Z3-F1-model_v4 Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) 0.9908 1 303 GO:0004639
GO:0005524
GO:0005737
GO:0006189

Map