F413196

General Info

Members Datasets Scaffolds Average Seq Length
337 234 674 152

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0481814|Ga0451576_0481814_344_859
Length 171
Sequence MAEDTKPPGQGAALGPKDRPRASWDEYFMGIAQVVATRSTCPRKYVGSVLVRNRTILSTGYNGSIRGMPHCSDVGHMMEDNHCVATIHAEANAIIQAARNGVMIEGASCYVTASPCWNCFKQLANAGVTRICYGEFYRDERIFKVAKEIGIELVHVGLPGVDLPTLPPQIP

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
149 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
150 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
151 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
152 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
153 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
181 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
182 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
183 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
184 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
185 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
186 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
187 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
188 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
191 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
210 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
214 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
215 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
216 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
221 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
229 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
230 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
231 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
232 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
233 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.61
Nodule 0
Rhizoplane 1.78
Rhizosphere 83.38
Stem 0
Stem Tuber 0
Unclassified 3.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0481814 3300045051 Bacteria 1303
2 Ga0070658_10231026 3300005327 Bacteria 1566
3 Ga0070683_100250184 3300005329 Bacteria 1686
4 Ga0070683_100382277 3300005329 Bacteria 1342
5 Ga0070683_100398990 3300005329 Bacteria 1311
6 Ga0070690_100014861 3300005330 Bacteria 4629
7 Ga0068869_100117910 3300005334 Bacteria 2027
8 Ga0068869_100180051 3300005334 Bacteria 1657
9 Ga0068869_100705573 3300005334 Bacteria 861
10 Ga0070680_100654654 3300005336 Bacteria 903
11 Ga0070682_100188117 3300005337 Bacteria 1448
12 Ga0070660_101471036 3300005339 Bacteria 579
13 Ga0070689_100000003 3300005340 Bacteria 579260
14 Ga0070689_100050748 3300005340 Bacteria 3206
15 Ga0070689_100300567 3300005340 Bacteria 1336
16 Ga0070689_100372746 3300005340 Bacteria 1201
17 Ga0070687_100069815 3300005343 Bacteria 1883
18 Ga0070692_10623384 3300005345 Bacteria 717
19 Ga0070668_101202527 3300005347 Bacteria 687
20 Ga0070669_100267448 3300005353 Bacteria 1366
21 Ga0070669_101066216 3300005353 Bacteria 695
22 Ga0070675_100062254 3300005354 Bacteria 3083
23 Ga0070674_100327106 3300005356 Bacteria 1231
24 Ga0070688_100441109 3300005365 Bacteria 971
25 Ga0070703_10049228 3300005406 Bacteria 1341
26 Ga0070709_10111077 3300005434 Bacteria 1843
27 Ga0070714_100215265 3300005435 Bacteria 1763
28 Ga0070713_100310614 3300005436 Bacteria 1454
29 Ga0070701_10055864 3300005438 Bacteria 2064
30 Ga0070705_100210829 3300005440 Bacteria 1339
31 Ga0070678_100221923 3300005456 Bacteria 1571
32 Ga0070681_10411678 3300005458 Bacteria 1264
33 Ga0070706_100016740 3300005467 Bacteria 6771
34 Ga0070707_100229192 3300005468 Bacteria 1809
35 Ga0070707_101051529 3300005468 Bacteria 780
36 Ga0070698_100014602 3300005471 Bacteria 8297
37 Ga0070699_100677218 3300005518 Bacteria 942
38 Ga0070679_100011254 3300005530 Bacteria 8527
39 Ga0070679_100379209 3300005530 Bacteria 1361
40 Ga0070679_100462048 3300005530 Bacteria 1214
41 Ga0070684_100024889 3300005535 Bacteria 5024
42 Ga0070684_100661557 3300005535 Bacteria 973
43 Ga0070684_100734790 3300005535 Bacteria 921
44 Ga0070686_100551330 3300005544 Bacteria 902
45 Ga0070665_100013149 3300005548 Bacteria 8336
46 Ga0068855_100049018 3300005563 Bacteria 4984
47 Ga0068855_100192717 3300005563 Bacteria 2298
48 Ga0068857_100714780 3300005577 Bacteria 952
49 Ga0070702_100028212 3300005615 Bacteria 3041
50 Ga0070702_100488223 3300005615 Bacteria 902
51 Ga0068859_100194581 3300005617 Bacteria 2112
52 Ga0068864_100008639 3300005618 Bacteria 8403
53 Ga0068861_100111633 3300005719 Bacteria 2191
54 Ga0068870_10131559 3300005840 Bacteria 1454
55 Ga0068863_100153099 3300005841 Bacteria 2207
56 Ga0068863_100348815 3300005841 Bacteria 1441
57 Ga0068860_100267473 3300005843 Bacteria 1668
58 Ga0070717_10043032 3300006028 Bacteria 3685
59 Ga0070717_10068172 3300006028 Bacteria 2961
60 Ga0070717_10154112 3300006028 Bacteria 1989
61 Ga0068871_100172668 3300006358 Bacteria 1854
62 Ga0068871_100685758 3300006358 Bacteria 938
63 Ga0068871_100737119 3300006358 Bacteria 905
64 Ga0075428_100906744 3300006844 Bacteria 935
65 Ga0075430_100065834 3300006846 Bacteria 3044
66 Ga0075431_100252870 3300006847 Bacteria 1790
67 Ga0075431_100690459 3300006847 Bacteria 999
68 Ga0075434_101880303 3300006871 Unclassified 605
69 Ga0075429_100061595 3300006880 Bacteria 3269
70 Ga0075429_100083907 3300006880 Bacteria 2777
71 Ga0075429_100201264 3300006880 Bacteria 1745
72 Ga0068865_100692910 3300006881 Bacteria 870
73 Ga0097620_100194571 3300006931 Bacteria 2112
74 Ga0075435_100980290 3300007076 Bacteria 738
75 Ga0111539_10056880 3300009094 Bacteria 4648
76 Ga0111539_10110142 3300009094 Bacteria 3231
77 Ga0111539_11875527 3300009094 Bacteria 695
78 Ga0105245_10000686 3300009098 Bacteria 30522
79 Ga0105245_10218285 3300009098 Bacteria 1839
80 Ga0114129_10649346 3300009147 Bacteria 1362
81 Ga0114129_12316552 3300009147 Bacteria 644
82 Ga0105243_10315359 3300009148 Bacteria 1423
83 Ga0105243_10678076 3300009148 Bacteria 1002
84 Ga0105241_11873376 3300009174 Bacteria 587
85 Ga0105242_10422856 3300009176 Bacteria 1249
86 Ga0105248_10895566 3300009177 Bacteria 1002
87 Ga0105237_11094677 3300009545 Bacteria 804
88 Ga0105238_10549756 3300009551 Bacteria 1159
89 Ga0105238_11533904 3300009551 Bacteria 695
90 Ga0105238_11644400 3300009551 Bacteria 673
91 Ga0105249_10055550 3300009553 Bacteria 3623
92 Ga0105239_10127905 3300010375 Bacteria 2825
93 Ga0105246_10286985 3300011119 Bacteria 1323
94 Ga0105246_10503758 3300011119 Bacteria 1029
95 Ga0157374_10042628 3300013296 Bacteria 4186
96 Ga0157374_10216205 3300013296 Bacteria 1880
97 Ga0157374_10381308 3300013296 Bacteria 1404
98 Ga0157374_11528396 3300013296 Bacteria 691
99 Ga0157377_10493413 3300014745 Bacteria 854
100 Ga0157377_10599328 3300014745 Unclassified 786
101 Ga0157377_11028363 3300014745 Bacteria 626
102 Ga0157376_10183653 3300014969 Bacteria 1913
103 Ga0157376_11121775 3300014969 Bacteria 813
104 Ga0213876_10129987 3300021384 Bacteria 1338
105 Ga0207642_10717955 3300025899 Bacteria 631
106 Ga0207699_10187961 3300025906 Bacteria 1392
107 Ga0207643_10049255 3300025908 Bacteria 2387
108 Ga0207705_10247215 3300025909 Bacteria 1360
109 Ga0207684_10021027 3300025910 Bacteria 5572
110 Ga0207684_10896149 3300025910 Bacteria 746
111 Ga0207707_10399646 3300025912 Bacteria 1180
112 Ga0207707_10527465 3300025912 Bacteria 1005
113 Ga0207660_10424892 3300025917 Bacteria 1072
114 Ga0207662_10122505 3300025918 Bacteria 1632
115 Ga0207662_10146426 3300025918 Bacteria 1499
116 Ga0207662_10234222 3300025918 Bacteria 1200
117 Ga0207652_10626063 3300025921 Bacteria 963
118 Ga0207646_10370064 3300025922 Bacteria 1295
119 Ga0207681_10333279 3300025923 Bacteria 1210
120 Ga0207681_10854805 3300025923 Bacteria 761
121 Ga0207659_10193067 3300025926 Bacteria 1621
122 Ga0207687_10000876 3300025927 Bacteria 20380
123 Ga0207664_10383467 3300025929 Bacteria 1248
124 Ga0207686_10301292 3300025934 Bacteria 1190
125 Ga0207670_10000006 3300025936 Bacteria 401723
126 Ga0207670_10445766 3300025936 Bacteria 1043
127 Ga0207669_10117423 3300025937 Bacteria 1798
128 Ga0207704_10627800 3300025938 Bacteria 883
129 Ga0207689_10034770 3300025942 Bacteria 4184
130 Ga0207689_10163425 3300025942 Bacteria 1834
131 Ga0207661_10106280 3300025944 Bacteria 2366
132 Ga0207661_10273427 3300025944 Bacteria 1508
133 Ga0207661_11069781 3300025944 Bacteria 743
134 Ga0207667_10382639 3300025949 Bacteria 1434
135 Ga0207712_10014911 3300025961 Bacteria 5004
136 Ga0207708_10146339 3300026075 Bacteria 1857
137 Ga0207708_10426810 3300026075 Bacteria 1100
138 Ga0207708_10480746 3300026075 Bacteria 1038
139 Ga0207708_10842998 3300026075 Unclassified 791
140 Ga0207702_10153689 3300026078 Bacteria 2096
141 Ga0207641_10006417 3300026088 Bacteria 9912
142 Ga0207641_10303345 3300026088 Bacteria 1509
143 Ga0207676_10007770 3300026095 Bacteria 7626
144 Ga0207674_10143667 3300026116 Bacteria 2345
145 Ga0207674_10347180 3300026116 Bacteria 1435
146 Ga0207675_100044591 3300026118 Bacteria 4144
147 Ga0207675_100222833 3300026118 Bacteria 1817
148 Ga0207683_10003161 3300026121 Bacteria 14375
149 Ga0268266_10003911 3300028379 Bacteria 14476
150 Ga0265326_10053375 3300028558 Bacteria 1144
151 Ga0265319_1035274 3300028563 Bacteria 1716
152 Ga0265334_10001212 3300028573 Bacteria 12603
153 Ga0265334_10014950 3300028573 Bacteria 3230
154 Ga0265334_10257401 3300028573 Bacteria 600
155 Ga0265336_10047634 3300028666 Bacteria 1301
156 Ga0307515_10011891 3300028794 Bacteria 16446
157 Ga0265338_10004773 3300028800 Bacteria 18118
158 Ga0265338_10055788 3300028800 Bacteria 3511
159 Ga0265338_10135959 3300028800 Bacteria 1932
160 Ga0265338_10216299 3300028800 Bacteria 1434
161 Ga0265330_10004573 3300031235 Bacteria 7002
162 Ga0265332_10004144 3300031238 Bacteria 6867
163 Ga0265332_10027696 3300031238 Bacteria 2481
164 Ga0265332_10071188 3300031238 Bacteria 1481
165 Ga0265328_10000391 3300031239 Bacteria 20501
166 Ga0265328_10001007 3300031239 Bacteria 12941
167 Ga0265320_10007641 3300031240 Bacteria 6690
168 Ga0265320_10013858 3300031240 Bacteria 4619
169 Ga0265320_10036556 3300031240 Bacteria 2480
170 Ga0265329_10000875 3300031242 Bacteria 15219
171 Ga0265329_10053137 3300031242 Bacteria 1288
172 Ga0265329_10120649 3300031242 Bacteria 841
173 Ga0265340_10361431 3300031247 Bacteria 641
174 Ga0265339_10049846 3300031249 Bacteria 2291
175 Ga0265339_10053291 3300031249 Bacteria 2200
176 Ga0265331_10000515 3300031250 Bacteria 36222
177 Ga0265316_10000643 3300031344 Bacteria 38832
178 Ga0265316_10762661 3300031344 Bacteria 680
179 Ga0307513_10003508 3300031456 Bacteria 21231
180 Ga0307513_10048237 3300031456 Bacteria 4624
181 Ga0307509_10000029 3300031507 Bacteria 215555
182 Ga0307509_10012894 3300031507 Bacteria 9937
183 Ga0307509_10027610 3300031507 Bacteria 6315
184 Ga0307509_10054604 3300031507 Bacteria 4252
185 Ga0265313_10036900 3300031595 Bacteria 2450
186 Ga0265313_10213021 3300031595 Bacteria 800
187 Ga0307508_10147769 3300031616 Bacteria 1954
188 Ga0307508_10477688 3300031616 Bacteria 840
189 Ga0316575_10001024 3300031665 Bacteria 8664
190 Ga0265314_10002518 3300031711 Bacteria 18681
191 Ga0265314_10011229 3300031711 Bacteria 7412
192 Ga0265314_10027543 3300031711 Bacteria 4254
193 Ga0265342_10000197 3300031712 Bacteria 67291
194 Ga0265342_10002761 3300031712 Bacteria 14910
195 Ga0265342_10005395 3300031712 Bacteria 9762
196 Ga0316576_10048754 3300031727 Bacteria 3074
197 Ga0316576_10110451 3300031727 Bacteria 2061
198 Ga0307516_10126019 3300031730 Bacteria 2346
199 Ga0307516_10211776 3300031730 Bacteria 1652
200 Ga0307406_10045315 3300031901 Bacteria 2760
201 Ga0307415_100038533 3300032126 Bacteria 3151
202 Ga0307507_10104798 3300033179 Bacteria 2345
203 Ga0373949_0000014 3300035090 Bacteria 62272
204 Ga0373923_0252355 3300035111 Bacteria 826
205 Ga0373936_0000001 3300035113 Bacteria 456155
206 Ga0373941_0016821 3300035115 Bacteria 1994
207 Ga0373941_0115648 3300035115 Bacteria 951
208 Ga0373953_0087896 3300035117 Bacteria 1298
209 Ga0373954_0243608 3300035118 Bacteria 885
210 Ga0373956_0007027 3300035119 Bacteria 4526
211 Ga0373956_0011369 3300035119 Bacteria 3666
212 Ga0373956_0391314 3300035119 Bacteria 663
213 Ga0373957_0185477 3300035120 Bacteria 863
214 Ga0373955_0020930 3300035172 Bacteria 3294
215 Ga0373961_0000001 3300035241 Bacteria 199721
216 Ga0373961_0297865 3300035241 Bacteria 596
217 Ga0373924_0093482 3300035410 Bacteria 1288
218 Ga0373927_0347375 3300035695 Unclassified 978
219 Ga0373933_0809826 3300035724 Bacteria 616
220 Ga0373937_0119122 3300036401 Bacteria 2459
221 Ga0395899_0037038 3300037312 Bacteria 3657
222 Ga0395899_0229023 3300037312 Bacteria 1284
223 Ga0395900_0047439 3300037418 Bacteria 4423
224 Ga0395900_0086758 3300037418 Bacteria 3216
225 Ga0395898_0150382 3300037466 Bacteria 2228
226 Ga0395905_0154826 3300037471 Bacteria 2156
227 Ga0395905_0568192 3300037471 Bacteria 1035
228 Ga0395901_0026110 3300038443 Bacteria 5997
229 Ga0395901_1098173 3300038443 Bacteria 766
230 Ga0436365_0806096 3300039437 Bacteria 1686
231 Ga0436363_1029020 3300039450 Bacteria 2492
232 Ga0451793_1469338 3300041452 Bacteria 824
233 Ga0451797_0132515 3300041453 Bacteria 505
234 Ga0451800_1542642 3300041459 Eukaryota 619
235 Ga0451802_0748223 3300041460 Bacteria 507
236 Ga0451833_0312632 3300041491 Bacteria 736
237 Ga0451835_0644452 3300041492 Bacteria 726
238 Ga0451837_1157979 3300041494 Bacteria 568
239 Ga0451847_0895578 3300041503 Bacteria 548
240 Ga0451849_1350053 3300041505 Bacteria 564
241 Ga0451849_1407826 3300041505 Bacteria 691
242 Ga0495641_0202488 3300046461 Bacteria 890
243 Ga0495650_0015601 3300046471 Bacteria 3889
244 Ga0495643_0529805 3300046522 Bacteria 504
245 Ga0495586_0480369 3300046535 Bacteria 717
246 Ga0495657_0062021 3300046675 Bacteria 2472
247 Ga0495669_0258496 3300046684 Bacteria 837
248 Ga0495624_0687550 3300046690 Bacteria 608
249 Ga0495649_0298723 3300046694 Bacteria 820
250 Ga0495686_0023597 3300047472 Bacteria 4056
251 Ga0495686_0044447 3300047472 Bacteria 2812
252 Ga0496112_0838811 3300048915 Bacteria 843
253 Ga0496114_0904361 3300048917 Bacteria 764
254 Ga0501291_034923 3300049514 Unclassified 863
255 Ga0501298_011370 3300049521 Bacteria 1545
256 Ga0501299_040043 3300049522 Unclassified 937
257 Ga0501033_0073588 3300049570 Bacteria 2509
258 Ga0501034_0282581 3300049571 Bacteria 1599
259 Ga0501034_0629512 3300049571 Bacteria 976
260 Ga0501037_0151409 3300049573 Bacteria 1658
261 Ga0501047_0325667 3300049581 Bacteria 1376
262 Ga0501067_0164635 3300049583 Bacteria 1235
263 Ga0501068_0083011 3300049584 Bacteria 1969
264 Ga0501069_0084034 3300049585 Bacteria 1795
265 Ga0501070_0017221 3300049586 Bacteria 6067
266 Ga0501070_0048543 3300049586 Bacteria 3525
267 Ga0501070_0335439 3300049586 Bacteria 1228
268 Ga0501071_0113838 3300049587 Bacteria 2001
269 Ga0501073_0177571 3300049589 Bacteria 1474
270 Ga0501074_0116226 3300049590 Bacteria 1914
271 Ga0501208_010987 3300049655 Bacteria 1295
272 Ga0501210_010173 3300049657 Unclassified 752
273 Ga0501211_022819 3300049658 Unclassified 666
274 Ga0501216_001533 3300049660 Bacteria 3131
275 Ga0501217_024236 3300049661 Unclassified 1450
276 Ga0501224_064798 3300049664 Bacteria 573
277 Ga0501227_002183 3300049665 Bacteria 4326
278 Ga0501227_105379 3300049665 Bacteria 752
279 Ga0501230_002945 3300049667 Unclassified 2216
280 Ga0501230_064624 3300049667 Bacteria 745
281 Ga0501233_002542 3300049668 Bacteria 3224
282 Ga0501233_098431 3300049668 Bacteria 771
283 Ga0501235_066218 3300049669 Unclassified 851
284 Ga0501236_023601 3300049670 Unclassified 927
285 Ga0501260_015988 3300049689 Bacteria 787
286 Ga0501225_0009449 3300049705 Bacteria 2776
287 Ga0501080_0574695 3300049742 Bacteria 1002
288 Ga0501080_0730854 3300049742 Bacteria 872
289 Ga0501083_0039753 3300049744 Bacteria 3194
290 Ga0501267_031733 3300049764 Bacteria 625
291 Ga0501035_0719093 3300049822 Bacteria 804
292 Ga0501044_0088081 3300049823 Bacteria 3134
293 Ga0501212_033297 3300049851 Unclassified 836
294 nmdc:mga05p37_609923_c1 3300050507 Bacteria 1230
295 nmdc:mga09592_38558_c1 3300050508 Bacteria 4011
296 nmdc:mga09592_51523_c1 3300050508 Bacteria 3473
297 nmdc:mga09592_56881_c1 3300050508 Bacteria 3305
298 nmdc:mga09592_7102_c1 3300050508 Bacteria 7679
299 nmdc:mga0qj67_358849_c1 3300050509 Bacteria 1178
300 nmdc:mga0qj67_722655_c1 3300050509 Bacteria 791
301 nmdc:mga06r32_280806_c1 3300050510 Bacteria 1652
302 nmdc:mga08y16_1783345_c1 3300050511 Bacteria 569
303 nmdc:mga08y16_215502_c1 3300050511 Bacteria 1988
304 nmdc:mga08y16_271094_c1 3300050511 Bacteria 1752
305 nmdc:mga0rr50_546902_c1 3300050513 Bacteria 986
306 Ga0500635_0272703 3300053080 Bacteria 665
307 Ga0495595_0193152 3300053084 Bacteria 1012
308 Ga0495619_0948130 3300053085 Bacteria 577
309 Ga0500578_0105262 3300053086 Bacteria 1782
310 Ga0500646_0004785 3300053090 Bacteria 3427
311 Ga0500647_0148323 3300053091 Bacteria 1096
312 Ga0500583_0224522 3300053092 Bacteria 931
313 Ga0500566_0057456 3300053094 Bacteria 2210
314 Ga0500566_0105231 3300053094 Bacteria 1541
315 Ga0500640_000034 3300053095 Bacteria 20779
316 Ga0500650_0171293 3300053098 Bacteria 998
317 Ga0500553_249425 3300053101 Bacteria 542
318 Ga0500554_000229 3300053102 Bacteria 12022
319 Ga0500562_019025 3300053108 Bacteria 1775
320 Ga0500594_0145648 3300053118 Bacteria 758
321 Ga0500595_000105 3300053119 Bacteria 57146
322 Ga0500597_003770 3300053120 Bacteria 4553
323 Ga0500607_264977 3300053121 Bacteria 669
324 Ga0500608_308626 3300053122 Bacteria 582
325 Ga0500614_001012 3300053123 Bacteria 6963
326 Ga0500617_126588 3300053124 Bacteria 1046
327 Ga0500642_0017224 3300053130 Bacteria 2765
328 Ga0500658_0050954 3300053134 Bacteria 1691
329 Ga0500568_0049159 3300053139 Bacteria 1665
330 Ga0500568_0073370 3300053139 Bacteria 1307
331 Ga0500585_008184 3300053144 Bacteria 2911
332 Ga0500603_001548 3300053150 Bacteria 5227
333 Ga0500619_136950 3300053154 Bacteria 834
334 Ga0500622_0037649 3300053156 Bacteria 2526
335 Ga0500638_139763 3300053162 Bacteria 1089
336 Ga0500601_018414 3300053737 Bacteria 802
337 Ga0501084_1057159 3300054114 Bacteria 682
338 Ga0451576_0481814
339 Ga0070658_10231026
340 Ga0070683_100250184
341 Ga0070683_100382277
342 Ga0070683_100398990
343 Ga0070690_100014861
344 Ga0068869_100117910
345 Ga0068869_100180051
346 Ga0068869_100705573
347 Ga0070680_100654654
348 Ga0070682_100188117
349 Ga0070660_101471036
350 Ga0070689_100000003
351 Ga0070689_100050748
352 Ga0070689_100300567
353 Ga0070689_100372746
354 Ga0070687_100069815
355 Ga0070692_10623384
356 Ga0070668_101202527
357 Ga0070669_100267448
358 Ga0070669_101066216
359 Ga0070675_100062254
360 Ga0070674_100327106
361 Ga0070688_100441109
362 Ga0070703_10049228
363 Ga0070709_10111077
364 Ga0070714_100215265
365 Ga0070713_100310614
366 Ga0070701_10055864
367 Ga0070705_100210829
368 Ga0070678_100221923
369 Ga0070681_10411678
370 Ga0070706_100016740
371 Ga0070707_100229192
372 Ga0070707_101051529
373 Ga0070698_100014602
374 Ga0070699_100677218
375 Ga0070679_100011254
376 Ga0070679_100379209
377 Ga0070679_100462048
378 Ga0070684_100024889
379 Ga0070684_100661557
380 Ga0070684_100734790
381 Ga0070686_100551330
382 Ga0070665_100013149
383 Ga0068855_100049018
384 Ga0068855_100192717
385 Ga0068857_100714780
386 Ga0070702_100028212
387 Ga0070702_100488223
388 Ga0068859_100194581
389 Ga0068864_100008639
390 Ga0068861_100111633
391 Ga0068870_10131559
392 Ga0068863_100153099
393 Ga0068863_100348815
394 Ga0068860_100267473
395 Ga0070717_10043032
396 Ga0070717_10068172
397 Ga0070717_10154112
398 Ga0068871_100172668
399 Ga0068871_100685758
400 Ga0068871_100737119
401 Ga0075428_100906744
402 Ga0075430_100065834
403 Ga0075431_100252870
404 Ga0075431_100690459
405 Ga0075434_101880303
406 Ga0075429_100061595
407 Ga0075429_100083907
408 Ga0075429_100201264
409 Ga0068865_100692910
410 Ga0097620_100194571
411 Ga0075435_100980290
412 Ga0111539_10056880
413 Ga0111539_10110142
414 Ga0111539_11875527
415 Ga0105245_10000686
416 Ga0105245_10218285
417 Ga0114129_10649346
418 Ga0114129_12316552
419 Ga0105243_10315359
420 Ga0105243_10678076
421 Ga0105241_11873376
422 Ga0105242_10422856
423 Ga0105248_10895566
424 Ga0105237_11094677
425 Ga0105238_10549756
426 Ga0105238_11533904
427 Ga0105238_11644400
428 Ga0105249_10055550
429 Ga0105239_10127905
430 Ga0105246_10286985
431 Ga0105246_10503758
432 Ga0157374_10042628
433 Ga0157374_10216205
434 Ga0157374_10381308
435 Ga0157374_11528396
436 Ga0157377_10493413
437 Ga0157377_10599328
438 Ga0157377_11028363
439 Ga0157376_10183653
440 Ga0157376_11121775
441 Ga0213876_10129987
442 Ga0207642_10717955
443 Ga0207699_10187961
444 Ga0207643_10049255
445 Ga0207705_10247215
446 Ga0207684_10021027
447 Ga0207684_10896149
448 Ga0207707_10399646
449 Ga0207707_10527465
450 Ga0207660_10424892
451 Ga0207662_10122505
452 Ga0207662_10146426
453 Ga0207662_10234222
454 Ga0207652_10626063
455 Ga0207646_10370064
456 Ga0207681_10333279
457 Ga0207681_10854805
458 Ga0207659_10193067
459 Ga0207687_10000876
460 Ga0207664_10383467
461 Ga0207686_10301292
462 Ga0207670_10000006
463 Ga0207670_10445766
464 Ga0207669_10117423
465 Ga0207704_10627800
466 Ga0207689_10034770
467 Ga0207689_10163425
468 Ga0207661_10106280
469 Ga0207661_10273427
470 Ga0207661_11069781
471 Ga0207667_10382639
472 Ga0207712_10014911
473 Ga0207708_10146339
474 Ga0207708_10426810
475 Ga0207708_10480746
476 Ga0207708_10842998
477 Ga0207702_10153689
478 Ga0207641_10006417
479 Ga0207641_10303345
480 Ga0207676_10007770
481 Ga0207674_10143667
482 Ga0207674_10347180
483 Ga0207675_100044591
484 Ga0207675_100222833
485 Ga0207683_10003161
486 Ga0268266_10003911
487 Ga0265326_10053375
488 Ga0265319_1035274
489 Ga0265334_10001212
490 Ga0265334_10014950
491 Ga0265334_10257401
492 Ga0265336_10047634
493 Ga0307515_10011891
494 Ga0265338_10004773
495 Ga0265338_10055788
496 Ga0265338_10135959
497 Ga0265338_10216299
498 Ga0265330_10004573
499 Ga0265332_10004144
500 Ga0265332_10027696
501 Ga0265332_10071188
502 Ga0265328_10000391
503 Ga0265328_10001007
504 Ga0265320_10007641
505 Ga0265320_10013858
506 Ga0265320_10036556
507 Ga0265329_10000875
508 Ga0265329_10053137
509 Ga0265329_10120649
510 Ga0265340_10361431
511 Ga0265339_10049846
512 Ga0265339_10053291
513 Ga0265331_10000515
514 Ga0265316_10000643
515 Ga0265316_10762661
516 Ga0307513_10003508
517 Ga0307513_10048237
518 Ga0307509_10000029
519 Ga0307509_10012894
520 Ga0307509_10027610
521 Ga0307509_10054604
522 Ga0265313_10036900
523 Ga0265313_10213021
524 Ga0307508_10147769
525 Ga0307508_10477688
526 Ga0316575_10001024
527 Ga0265314_10002518
528 Ga0265314_10011229
529 Ga0265314_10027543
530 Ga0265342_10000197
531 Ga0265342_10002761
532 Ga0265342_10005395
533 Ga0316576_10048754
534 Ga0316576_10110451
535 Ga0307516_10126019
536 Ga0307516_10211776
537 Ga0307406_10045315
538 Ga0307415_100038533
539 Ga0307507_10104798
540 Ga0373949_0000014
541 Ga0373923_0252355
542 Ga0373936_0000001
543 Ga0373941_0016821
544 Ga0373941_0115648
545 Ga0373953_0087896
546 Ga0373954_0243608
547 Ga0373956_0007027
548 Ga0373956_0011369
549 Ga0373956_0391314
550 Ga0373957_0185477
551 Ga0373955_0020930
552 Ga0373961_0000001
553 Ga0373961_0297865
554 Ga0373924_0093482
555 Ga0373927_0347375
556 Ga0373933_0809826
557 Ga0373937_0119122
558 Ga0395899_0037038
559 Ga0395899_0229023
560 Ga0395900_0047439
561 Ga0395900_0086758
562 Ga0395898_0150382
563 Ga0395905_0154826
564 Ga0395905_0568192
565 Ga0395901_0026110
566 Ga0395901_1098173
567 Ga0436365_0806096
568 Ga0436363_1029020
569 Ga0451793_1469338
570 Ga0451797_0132515
571 Ga0451800_1542642
572 Ga0451802_0748223
573 Ga0451833_0312632
574 Ga0451835_0644452
575 Ga0451837_1157979
576 Ga0451847_0895578
577 Ga0451849_1350053
578 Ga0451849_1407826
579 Ga0495641_0202488
580 Ga0495650_0015601
581 Ga0495643_0529805
582 Ga0495586_0480369
583 Ga0495657_0062021
584 Ga0495669_0258496
585 Ga0495624_0687550
586 Ga0495649_0298723
587 Ga0495686_0023597
588 Ga0495686_0044447
589 Ga0496112_0838811
590 Ga0496114_0904361
591 Ga0501291_034923
592 Ga0501298_011370
593 Ga0501299_040043
594 Ga0501033_0073588
595 Ga0501034_0282581
596 Ga0501034_0629512
597 Ga0501037_0151409
598 Ga0501047_0325667
599 Ga0501067_0164635
600 Ga0501068_0083011
601 Ga0501069_0084034
602 Ga0501070_0017221
603 Ga0501070_0048543
604 Ga0501070_0335439
605 Ga0501071_0113838
606 Ga0501073_0177571
607 Ga0501074_0116226
608 Ga0501208_010987
609 Ga0501210_010173
610 Ga0501211_022819
611 Ga0501216_001533
612 Ga0501217_024236
613 Ga0501224_064798
614 Ga0501227_002183
615 Ga0501227_105379
616 Ga0501230_002945
617 Ga0501230_064624
618 Ga0501233_002542
619 Ga0501233_098431
620 Ga0501235_066218
621 Ga0501236_023601
622 Ga0501260_015988
623 Ga0501225_0009449
624 Ga0501080_0574695
625 Ga0501080_0730854
626 Ga0501083_0039753
627 Ga0501267_031733
628 Ga0501035_0719093
629 Ga0501044_0088081
630 Ga0501212_033297
631 nmdc:mga05p37_609923_c1
632 nmdc:mga09592_38558_c1
633 nmdc:mga09592_51523_c1
634 nmdc:mga09592_56881_c1
635 nmdc:mga09592_7102_c1
636 nmdc:mga0qj67_358849_c1
637 nmdc:mga0qj67_722655_c1
638 nmdc:mga06r32_280806_c1
639 nmdc:mga08y16_1783345_c1
640 nmdc:mga08y16_215502_c1
641 nmdc:mga08y16_271094_c1
642 nmdc:mga0rr50_546902_c1
643 Ga0500635_0272703
644 Ga0495595_0193152
645 Ga0495619_0948130
646 Ga0500578_0105262
647 Ga0500646_0004785
648 Ga0500647_0148323
649 Ga0500583_0224522
650 Ga0500566_0057456
651 Ga0500566_0105231
652 Ga0500640_000034
653 Ga0500650_0171293
654 Ga0500553_249425
655 Ga0500554_000229
656 Ga0500562_019025
657 Ga0500594_0145648
658 Ga0500595_000105
659 Ga0500597_003770
660 Ga0500607_264977
661 Ga0500608_308626
662 Ga0500614_001012
663 Ga0500617_126588
664 Ga0500642_0017224
665 Ga0500658_0050954
666 Ga0500568_0049159
667 Ga0500568_0073370
668 Ga0500585_008184
669 Ga0500603_001548
670 Ga0500619_136950
671 Ga0500622_0037649
672 Ga0500638_139763
673 Ga0500601_018414
674 Ga0501084_1057159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00383

dCMP_cyt_deam_1

Cytidine and deoxycytidylate deaminase zinc-binding region

22

135

0.97

PF14437

MafB19-deam

MafB19-like deaminase

22

155

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hvv-assembly1.cif.gz_A crystal structure of dcmp deaminase from streptococcus mutans 0.8605 9 150
2hvv-assembly1.cif.gz_A crystal structure of dcmp deaminase from streptococcus mutans 0.8493 9 150
4p9e-assembly1.cif.gz_A crystal structure of dcmp deaminase from the cyanophage s-tim5 in apo form 0.8491 1 143
4p9e-assembly1.cif.gz_A crystal structure of dcmp deaminase from the cyanophage s-tim5 in apo form 0.8427 1 143
4v94-assembly2.cif.gz_i molecular architecture of the eukaryotic chaperonin tric/cct derived by a combination of chemical crosslinking and mass-spectrometry, xl-ms 0.8414 105 142
ID Description Score Start End Superfamily
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8605 9 150 3.40.140.10
af_A0A0N7KN40_103_244_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8603 33 49 2.60.40.1820
af_Q5U3U4_64_164_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8535 33 120 3.40.140.10
2hvvA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8493 9 150 3.40.140.10
4p9eA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8491 1 143 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A150T579-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.9379 8 141 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972
AF-A0A7X9IVJ9-F1-model_v4 dCMP deaminase family protein 0.9376 8 142 GO:0004132
GO:0005737
GO:0009972
AF-A0A7X7I2N4-F1-model_v4 dCMP deaminase family protein 0.9368 8 145 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972
AF-A0A836VMX2-F1-model_v4 Deaminase 0.9364 8 142 GO:0004132
GO:0005737
GO:0006220
GO:0008270
GO:0009972
AF-A0A6C0B4U7-F1-model_v4 CMP/dCMP-type deaminase domain-containing protein 0.9356 6 143 GO:0004132
GO:0005737
GO:0008270
GO:0009972

Map