F412990

General Info

Members Datasets Scaffolds Average Seq Length
337 205 674 124

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100567371|Ga0070665_1005673712
Length 130
Sequence MKFLVVDDSATMRRILVNSLQRIGFGECVEAEDGLQALEKFDASIGFVITDWNMPKMSGIDFARALRAHDGGKTVPILMVTTRSVREDIVAAVEAGVNNYIVKPFTPQVLKEKIDQVLSGASAGAAASGQ

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
166 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
198 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
199 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 0.89
Rhizosphere 96.74
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100567371 3300005548 Bacteria 1148
2 Ga0065715_10074341 3300005293 Unclassified 590
3 Ga0070658_10012168 3300005327 Bacteria 6907
4 Ga0070658_10125352 3300005327 Bacteria 2137
5 Ga0070658_10558266 3300005327 Bacteria 991
6 Ga0070676_10112427 3300005328 Bacteria 1698
7 Ga0070683_100064103 3300005329 Bacteria 3420
8 Ga0070683_100190847 3300005329 Bacteria 1945
9 Ga0070683_100545110 3300005329 Bacteria 1109
10 Ga0070683_100677868 3300005329 Bacteria 987
11 Ga0070690_100008066 3300005330 Bacteria 6048
12 Ga0070677_10110291 3300005333 Bacteria 1227
13 Ga0068869_100037672 3300005334 Bacteria 3440
14 Ga0068869_100153082 3300005334 Bacteria 1790
15 Ga0070666_10040674 3300005335 Unclassified 3103
16 Ga0070666_10246720 3300005335 Bacteria 1264
17 Ga0070680_100104583 3300005336 Bacteria 2353
18 Ga0070682_100930588 3300005337 Bacteria 716
19 Ga0068868_100382861 3300005338 Bacteria 1211
20 Ga0070660_100028231 3300005339 Bacteria 4196
21 Ga0070660_100046705 3300005339 Bacteria 3320
22 Ga0070660_100049779 3300005339 Bacteria 3222
23 Ga0070689_100029140 3300005340 Bacteria 4175
24 Ga0070691_10252580 3300005341 Bacteria 946
25 Ga0070687_100019306 3300005343 Unclassified 3169
26 Ga0070661_100003922 3300005344 Bacteria 10237
27 Ga0070661_100154623 3300005344 Bacteria 1735
28 Ga0070661_100317016 3300005344 Bacteria 1217
29 Ga0070692_10164404 3300005345 Bacteria 1274
30 Ga0070692_10424753 3300005345 Bacteria 845
31 Ga0070668_100025640 3300005347 Bacteria 4471
32 Ga0070669_100495806 3300005353 Bacteria 1012
33 Ga0070675_100007626 3300005354 Bacteria 8372
34 Ga0070675_100286585 3300005354 Bacteria 1449
35 Ga0070671_100397397 3300005355 Bacteria 1179
36 Ga0070674_101017454 3300005356 Bacteria 728
37 Ga0070673_100004871 3300005364 Bacteria 8547
38 Ga0070688_100047431 3300005365 Bacteria 2665
39 Ga0070659_100017732 3300005366 Bacteria 5362
40 Ga0070659_100874609 3300005366 Unclassified 784
41 Ga0070667_100037844 3300005367 Bacteria 4045
42 Ga0070667_100176766 3300005367 Bacteria 1887
43 Ga0070714_100002760 3300005435 Bacteria 12942
44 Ga0070713_100854191 3300005436 Bacteria 874
45 Ga0070701_10204809 3300005438 Bacteria 1168
46 Ga0070694_101086458 3300005444 Bacteria 667
47 Ga0070663_100001279 3300005455 Bacteria 13783
48 Ga0070663_100635258 3300005455 Unclassified 901
49 Ga0070663_100848807 3300005455 Bacteria 786
50 Ga0070663_101191077 3300005455 Bacteria 669
51 Ga0070662_100423099 3300005457 Bacteria 1102
52 Ga0070681_10206172 3300005458 Bacteria 1883
53 Ga0070681_10228291 3300005458 Bacteria 1776
54 Ga0070685_10174122 3300005466 Bacteria 1381
55 Ga0070699_100318810 3300005518 Bacteria 1397
56 Ga0070679_100011765 3300005530 Bacteria 8342
57 Ga0070679_100022311 3300005530 Bacteria 6187
58 Ga0070679_100092580 3300005530 Bacteria 3010
59 Ga0070679_100675098 3300005530 Bacteria 976
60 Ga0070679_100985350 3300005530 Bacteria 787
61 Ga0070684_100025021 3300005535 Bacteria 5013
62 Ga0070684_101104577 3300005535 Unclassified 745
63 Ga0068853_100207904 3300005539 Bacteria 1783
64 Ga0070672_100084042 3300005543 Bacteria 2556
65 Ga0070686_100140801 3300005544 Bacteria 1679
66 Ga0070665_100051550 3300005548 Unclassified 4127
67 Ga0070665_100280631 3300005548 Bacteria 1668
68 Ga0070704_100923404 3300005549 Bacteria 786
69 Ga0068855_100032599 3300005563 Bacteria 6219
70 Ga0068855_100255619 3300005563 Bacteria 1953
71 Ga0068855_101473018 3300005563 Bacteria 700
72 Ga0070664_100793612 3300005564 Bacteria 885
73 Ga0070664_102019477 3300005564 Bacteria 547
74 Ga0068854_100019568 3300005578 Unclassified 4566
75 Ga0068856_100727003 3300005614 Bacteria 1013
76 Ga0068856_101273491 3300005614 Bacteria 751
77 Ga0068852_100004144 3300005616 Bacteria 10212
78 Ga0068852_100048744 3300005616 Bacteria 3621
79 Ga0068859_100057752 3300005617 Bacteria 3908
80 Ga0068859_100329606 3300005617 Bacteria 1621
81 Ga0068864_100179085 3300005618 Bacteria 1937
82 Ga0068866_10028060 3300005718 Bacteria 2679
83 Ga0068851_10846184 3300005834 Bacteria 570
84 Ga0068863_100130344 3300005841 Bacteria 2401
85 Ga0068858_100502344 3300005842 Bacteria 1172
86 Ga0068858_101047115 3300005842 Bacteria 800
87 Ga0068860_100280529 3300005843 Bacteria 1628
88 Ga0068862_100379308 3300005844 Bacteria 1318
89 Ga0068862_100397671 3300005844 Bacteria 1288
90 Ga0081539_10216852 3300005985 Bacteria 873
91 Ga0097621_100385505 3300006237 Bacteria 1252
92 Ga0068871_100696297 3300006358 Bacteria 931
93 Ga0075431_101712634 3300006847 Bacteria 585
94 Ga0075434_100045909 3300006871 Bacteria 4335
95 Ga0075434_100710760 3300006871 Bacteria 1022
96 Ga0075429_100769432 3300006880 Unclassified 843
97 Ga0097620_100057755 3300006931 Bacteria 3908
98 Ga0097620_100329609 3300006931 Bacteria 1621
99 Ga0105240_10030676 3300009093 Bacteria 6984
100 Ga0105240_10117558 3300009093 Bacteria 3205
101 Ga0105245_10069288 3300009098 Bacteria 3198
102 Ga0105245_10148461 3300009098 Bacteria 2214
103 Ga0105245_10396308 3300009098 Bacteria 1378
104 Ga0105247_10393102 3300009101 Bacteria 986
105 Ga0114129_10186221 3300009147 Unclassified 2821
106 Ga0114129_11139919 3300009147 Bacteria 974
107 Ga0105243_10099964 3300009148 Bacteria 2406
108 Ga0105241_10000118 3300009174 Bacteria 57242
109 Ga0105241_10750133 3300009174 Bacteria 895
110 Ga0105242_10390396 3300009176 Bacteria 1296
111 Ga0105242_10433129 3300009176 Bacteria 1235
112 Ga0105248_10021570 3300009177 Bacteria 7135
113 Ga0105238_10023593 3300009551 Bacteria 6268
114 Ga0105239_10793240 3300010375 Bacteria 1085
115 Ga0105239_10923881 3300010375 Unclassified 1002
116 Ga0157371_10019301 3300013102 Bacteria 5029
117 Ga0157371_10078274 3300013102 Bacteria 2342
118 Ga0157370_10025082 3300013104 Bacteria 5902
119 Ga0157370_10456283 3300013104 Bacteria 1175
120 Ga0157369_10053667 3300013105 Bacteria 4355
121 Ga0157374_10094673 3300013296 Bacteria 2855
122 Ga0157378_10249090 3300013297 Bacteria 1700
123 Ga0163162_11199770 3300013306 Bacteria 861
124 Ga0157372_10084716 3300013307 Bacteria 3593
125 Ga0157372_10112570 3300013307 Bacteria 3118
126 Ga0157372_11013654 3300013307 Bacteria 961
127 Ga0157375_10082876 3300013308 Bacteria 3250
128 Ga0163163_10769629 3300014325 Bacteria 1026
129 Ga0157380_10164244 3300014326 Bacteria 1933
130 Ga0157380_10394147 3300014326 Bacteria 1311
131 Ga0157377_10100902 3300014745 Bacteria 1720
132 Ga0157376_10718050 3300014969 Bacteria 1006
133 Ga0182007_10027079 3300015262 Bacteria 1980
134 Ga0163161_10426744 3300017792 Bacteria 1068
135 Ga0206353_11665855 3300020082 Bacteria 1784
136 Ga0213876_10003611 3300021384 Bacteria 8798
137 Ga0213875_10014715 3300021388 Bacteria 3815
138 Ga0207682_10076624 3300025893 Bacteria 1426
139 Ga0207642_10022966 3300025899 Bacteria 2484
140 Ga0207680_10038402 3300025903 Unclassified 2771
141 Ga0207680_10245536 3300025903 Bacteria 1235
142 Ga0207645_10091363 3300025907 Bacteria 1958
143 Ga0207645_10760129 3300025907 Bacteria 659
144 Ga0207705_10009550 3300025909 Bacteria 7058
145 Ga0207705_10017878 3300025909 Bacteria 5071
146 Ga0207705_10533307 3300025909 Bacteria 912
147 Ga0207654_10000366 3300025911 Bacteria 26595
148 Ga0207707_10447914 3300025912 Bacteria 1105
149 Ga0207695_10000700 3300025913 Bacteria 65746
150 Ga0207695_10045574 3300025913 Bacteria 4654
151 Ga0207671_10119877 3300025914 Bacteria 2010
152 Ga0207660_10051716 3300025917 Bacteria 2922
153 Ga0207662_10014953 3300025918 Bacteria 4359
154 Ga0207657_10003780 3300025919 Bacteria 16092
155 Ga0207657_10022842 3300025919 Bacteria 5838
156 Ga0207657_10077696 3300025919 Bacteria 2797
157 Ga0207649_10026543 3300025920 Bacteria 3389
158 Ga0207649_10254783 3300025920 Bacteria 1266
159 Ga0207649_10272248 3300025920 Bacteria 1228
160 Ga0207652_10090847 3300025921 Bacteria 2684
161 Ga0207652_10098799 3300025921 Bacteria 2575
162 Ga0207652_10362099 3300025921 Bacteria 1309
163 Ga0207652_10673934 3300025921 Bacteria 924
164 Ga0207681_10798421 3300025923 Unclassified 788
165 Ga0207694_10199715 3300025924 Unclassified 1627
166 Ga0207650_11490207 3300025925 Bacteria 575
167 Ga0207659_10022996 3300025926 Bacteria 4156
168 Ga0207659_10066432 3300025926 Bacteria 2617
169 Ga0207687_10152834 3300025927 Bacteria 1763
170 Ga0207687_10261751 3300025927 Bacteria 1379
171 Ga0207700_10761490 3300025928 Bacteria 865
172 Ga0207664_10007781 3300025929 Bacteria 7443
173 Ga0207690_10094374 3300025932 Bacteria 2122
174 Ga0207690_10418300 3300025932 Bacteria 1072
175 Ga0207706_10632372 3300025933 Bacteria 918
176 Ga0207686_10630656 3300025934 Bacteria 846
177 Ga0207709_10186401 3300025935 Bacteria 1470
178 Ga0207670_10316271 3300025936 Bacteria 1227
179 Ga0207669_10214534 3300025937 Bacteria 1408
180 Ga0207691_10063632 3300025940 Bacteria 3345
181 Ga0207711_10224099 3300025941 Bacteria 1720
182 Ga0207689_10053509 3300025942 Bacteria 3326
183 Ga0207661_10037926 3300025944 Bacteria 3774
184 Ga0207661_10064404 3300025944 Bacteria 2971
185 Ga0207661_10147755 3300025944 Unclassified 2029
186 Ga0207661_10370592 3300025944 Bacteria 1295
187 Ga0207679_11189070 3300025945 Bacteria 700
188 Ga0207667_10001010 3300025949 Bacteria 35814
189 Ga0207667_10059284 3300025949 Bacteria 4009
190 Ga0207667_10352495 3300025949 Bacteria 1501
191 Ga0207651_10053083 3300025960 Unclassified 2768
192 Ga0207712_10318355 3300025961 Bacteria 1283
193 Ga0207640_10001254 3300025981 Bacteria 13807
194 Ga0207640_10298518 3300025981 Bacteria 1273
195 Ga0207658_10158572 3300025986 Bacteria 1852
196 Ga0207703_10129324 3300026035 Unclassified 2179
197 Ga0207678_10000097 3300026067 Bacteria 71689
198 Ga0207678_10510269 3300026067 Unclassified 1049
199 Ga0207708_10223092 3300026075 Bacteria 1511
200 Ga0207702_10696299 3300026078 Bacteria 1001
201 Ga0207702_10748608 3300026078 Bacteria 965
202 Ga0207702_11179809 3300026078 Bacteria 760
203 Ga0207702_11225402 3300026078 Unclassified 745
204 Ga0207641_10340566 3300026088 Bacteria 1427
205 Ga0207648_10086007 3300026089 Bacteria 2743
206 Ga0207674_10392605 3300026116 Bacteria 1341
207 Ga0207675_101232664 3300026118 Unclassified 768
208 Ga0207683_10449552 3300026121 Bacteria 1188
209 Ga0207698_10036461 3300026142 Bacteria 3610
210 Ga0207698_10059365 3300026142 Bacteria 2970
211 Ga0268266_10084893 3300028379 Bacteria 2766
212 Ga0268266_10233856 3300028379 Bacteria 1693
213 Ga0268266_10467060 3300028379 Bacteria 1201
214 Ga0268265_10004294 3300028380 Bacteria 9944
215 Ga0268265_10357371 3300028380 Bacteria 1336
216 Ga0268264_10393480 3300028381 Bacteria 1330
217 Ga0268264_11081630 3300028381 Bacteria 810
218 Ga0265332_10001664 3300031238 Bacteria 12147
219 Ga0265332_10040389 3300031238 Bacteria 2020
220 Ga0265329_10272178 3300031242 Bacteria 568
221 Ga0265340_10108955 3300031247 Bacteria 1281
222 Ga0265327_10034742 3300031251 Bacteria 2794
223 Ga0265327_10469085 3300031251 Bacteria 543
224 Ga0265316_11029221 3300031344 Bacteria 572
225 Ga0307408_100704105 3300031548 Bacteria 908
226 Ga0307408_101161625 3300031548 Bacteria 719
227 Ga0265314_10005278 3300031711 Bacteria 11696
228 Ga0265314_10038910 3300031711 Bacteria 3431
229 Ga0265342_10071962 3300031712 Bacteria 2013
230 Ga0307405_10169213 3300031731 Bacteria 1557
231 Ga0307405_10758778 3300031731 Bacteria 809
232 Ga0307405_10944716 3300031731 Bacteria 732
233 Ga0307413_10034150 3300031824 Bacteria 2904
234 Ga0307413_11135686 3300031824 Bacteria 676
235 Ga0307410_10121962 3300031852 Bacteria 1902
236 Ga0307406_10439229 3300031901 Bacteria 1044
237 Ga0307406_10604891 3300031901 Bacteria 904
238 Ga0307406_12043901 3300031901 Bacteria 513
239 Ga0307407_10379961 3300031903 Bacteria 1008
240 Ga0307407_10566422 3300031903 Bacteria 842
241 Ga0307407_11285893 3300031903 Bacteria 574
242 Ga0307412_10105268 3300031911 Bacteria 2004
243 Ga0307412_10259004 3300031911 Bacteria 1355
244 Ga0307412_12026490 3300031911 Bacteria 533
245 Ga0307409_100247295 3300031995 Bacteria 1628
246 Ga0307409_100379245 3300031995 Bacteria 1344
247 Ga0307409_100536211 3300031995 Bacteria 1146
248 Ga0307409_100611813 3300031995 Bacteria 1078
249 Ga0307416_101586768 3300032002 Bacteria 760
250 Ga0307416_102399144 3300032002 Bacteria 627
251 Ga0307414_10339538 3300032004 Bacteria 1285
252 Ga0307411_10974050 3300032005 Bacteria 758
253 Ga0307415_100591451 3300032126 Bacteria 986
254 Ga0307415_100932829 3300032126 Bacteria 802
255 Ga0307415_101472418 3300032126 Bacteria 650
256 Ga0316593_10001696 3300032168 Bacteria 4970
257 Ga0316593_10009146 3300032168 Bacteria 2788
258 Ga0395899_0015584 3300037312 Bacteria 5796
259 Ga0395900_0471785 3300037418 Bacteria 1208
260 Ga0395905_0148059 3300037471 Bacteria 2209
261 Ga0395905_0196127 3300037471 Bacteria 1893
262 Ga0395905_0315683 3300037471 Bacteria 1452
263 Ga0436364_1339265 3300037853 Bacteria 10176
264 Ga0395901_0019869 3300038443 Bacteria 6872
265 Ga0400488_09071 3300038741 Unclassified 1277
266 Ga0400486_17951 3300038742 Unclassified 1214
267 Ga0436365_0087199 3300039437 Bacteria 930
268 Ga0436365_1071656 3300039437 Bacteria 13077
269 Ga0451577_0000001 3300042876 Bacteria 2461803
270 Ga0451577_0259747 3300042876 Bacteria 1573
271 Ga0451577_0265326 3300042876 Bacteria 1554
272 Ga0451577_1968476 3300042876 Unclassified 511
273 Ga0451577_1971349 3300042876 Bacteria 511
274 Ga0453683_0446664 3300044673 Bacteria 836
275 Ga0466966_0006721 3300044684 Bacteria 7617
276 Ga0466966_0031529 3300044684 Bacteria 3437
277 Ga0466961_0045554 3300044693 Bacteria 2807
278 Ga0453684_0084185 3300044712 Bacteria 3956
279 Ga0453684_0114523 3300044712 Bacteria 3269
280 Ga0453684_2150091 3300044712 Bacteria 558
281 Ga0466957_1424266 3300044842 Bacteria 505
282 Ga0466959_0010149 3300045049 Bacteria 6720
283 Ga0466959_0060845 3300045049 Bacteria 2747
284 Ga0451576_0141778 3300045051 Bacteria 2506
285 Ga0451576_0276578 3300045051 Bacteria 1755
286 Ga0451576_2580769 3300045051 Bacteria 518
287 Ga0466958_0948040 3300045836 Bacteria 561
288 Ga0466967_1142112 3300045976 Bacteria 776
289 Ga0495587_0633885 3300046536 Unclassified 588
290 Ga0495636_0056818 3300047318 Bacteria 1648
291 Ga0496104_0581022 3300048907 Bacteria 1031
292 Ga0496112_0811465 3300048915 Bacteria 860
293 Ga0496114_0218700 3300048917 Bacteria 1672
294 Ga0501031_0130388 3300049568 Bacteria 1643
295 Ga0501031_0421413 3300049568 Bacteria 863
296 Ga0501032_0210627 3300049569 Bacteria 1267
297 Ga0501032_0211795 3300049569 Bacteria 1263
298 Ga0501033_0053493 3300049570 Bacteria 2990
299 Ga0501033_0070997 3300049570 Bacteria 2558
300 Ga0501033_0169683 3300049570 Unclassified 1567
301 Ga0501034_0066493 3300049571 Bacteria 3618
302 Ga0501034_0102392 3300049571 Bacteria 2857
303 Ga0501034_0175587 3300049571 Bacteria 2108
304 Ga0501036_0076318 3300049572 Bacteria 2835
305 Ga0501036_0315936 3300049572 Bacteria 1306
306 Ga0501036_0325716 3300049572 Bacteria 1284
307 Ga0501037_0027927 3300049573 Bacteria 4170
308 Ga0501037_0343831 3300049573 Bacteria 1030
309 Ga0501038_0063827 3300049574 Bacteria 3143
310 Ga0501038_0200067 3300049574 Bacteria 1604
311 Ga0501038_0308689 3300049574 Bacteria 1240
312 Ga0501039_0529530 3300049575 Bacteria 925
313 Ga0501039_0604388 3300049575 Bacteria 860
314 Ga0501043_0022532 3300049579 Bacteria 4939
315 Ga0501043_0058962 3300049579 Bacteria 3012
316 Ga0501043_0260298 3300049579 Bacteria 1334
317 Ga0501046_0375653 3300049580 Bacteria 1029
318 Ga0501047_0002817 3300049581 Bacteria 16510
319 Ga0501047_0089133 3300049581 Bacteria 2962
320 Ga0501047_0090202 3300049581 Bacteria 2942
321 Ga0501048_1173009 3300049582 Bacteria 552
322 Ga0501070_0208436 3300049586 Bacteria 1605
323 Ga0501070_0715555 3300049586 Bacteria 791
324 Ga0501073_0179037 3300049589 Bacteria 1467
325 Ga0501216_096664 3300049660 Bacteria 646
326 Ga0501219_004947 3300049703 Bacteria 949
327 Ga0501266_095513 3300049763 Bacteria 521
328 Ga0501035_0001262 3300049822 Bacteria 26253
329 Ga0501035_0039189 3300049822 Bacteria 4289
330 Ga0501035_0059216 3300049822 Bacteria 3410
331 Ga0501044_0001144 3300049823 Bacteria 31423
332 Ga0501044_0003721 3300049823 Bacteria 17139
333 Ga0501044_0019923 3300049823 Bacteria 7165
334 Ga0501284_06836 3300050005 Bacteria 666
335 nmdc:mga09592_64785_c1 3300050508 Bacteria 3094
336 nmdc:mga0n895_43157_c1 3300050512 Bacteria 4393
337 Ga0500596_023061 3300053735 Bacteria 943
338 Ga0070665_100567371
339 Ga0065715_10074341
340 Ga0070658_10012168
341 Ga0070658_10125352
342 Ga0070658_10558266
343 Ga0070676_10112427
344 Ga0070683_100064103
345 Ga0070683_100190847
346 Ga0070683_100545110
347 Ga0070683_100677868
348 Ga0070690_100008066
349 Ga0070677_10110291
350 Ga0068869_100037672
351 Ga0068869_100153082
352 Ga0070666_10040674
353 Ga0070666_10246720
354 Ga0070680_100104583
355 Ga0070682_100930588
356 Ga0068868_100382861
357 Ga0070660_100028231
358 Ga0070660_100046705
359 Ga0070660_100049779
360 Ga0070689_100029140
361 Ga0070691_10252580
362 Ga0070687_100019306
363 Ga0070661_100003922
364 Ga0070661_100154623
365 Ga0070661_100317016
366 Ga0070692_10164404
367 Ga0070692_10424753
368 Ga0070668_100025640
369 Ga0070669_100495806
370 Ga0070675_100007626
371 Ga0070675_100286585
372 Ga0070671_100397397
373 Ga0070674_101017454
374 Ga0070673_100004871
375 Ga0070688_100047431
376 Ga0070659_100017732
377 Ga0070659_100874609
378 Ga0070667_100037844
379 Ga0070667_100176766
380 Ga0070714_100002760
381 Ga0070713_100854191
382 Ga0070701_10204809
383 Ga0070694_101086458
384 Ga0070663_100001279
385 Ga0070663_100635258
386 Ga0070663_100848807
387 Ga0070663_101191077
388 Ga0070662_100423099
389 Ga0070681_10206172
390 Ga0070681_10228291
391 Ga0070685_10174122
392 Ga0070699_100318810
393 Ga0070679_100011765
394 Ga0070679_100022311
395 Ga0070679_100092580
396 Ga0070679_100675098
397 Ga0070679_100985350
398 Ga0070684_100025021
399 Ga0070684_101104577
400 Ga0068853_100207904
401 Ga0070672_100084042
402 Ga0070686_100140801
403 Ga0070665_100051550
404 Ga0070665_100280631
405 Ga0070704_100923404
406 Ga0068855_100032599
407 Ga0068855_100255619
408 Ga0068855_101473018
409 Ga0070664_100793612
410 Ga0070664_102019477
411 Ga0068854_100019568
412 Ga0068856_100727003
413 Ga0068856_101273491
414 Ga0068852_100004144
415 Ga0068852_100048744
416 Ga0068859_100057752
417 Ga0068859_100329606
418 Ga0068864_100179085
419 Ga0068866_10028060
420 Ga0068851_10846184
421 Ga0068863_100130344
422 Ga0068858_100502344
423 Ga0068858_101047115
424 Ga0068860_100280529
425 Ga0068862_100379308
426 Ga0068862_100397671
427 Ga0081539_10216852
428 Ga0097621_100385505
429 Ga0068871_100696297
430 Ga0075431_101712634
431 Ga0075434_100045909
432 Ga0075434_100710760
433 Ga0075429_100769432
434 Ga0097620_100057755
435 Ga0097620_100329609
436 Ga0105240_10030676
437 Ga0105240_10117558
438 Ga0105245_10069288
439 Ga0105245_10148461
440 Ga0105245_10396308
441 Ga0105247_10393102
442 Ga0114129_10186221
443 Ga0114129_11139919
444 Ga0105243_10099964
445 Ga0105241_10000118
446 Ga0105241_10750133
447 Ga0105242_10390396
448 Ga0105242_10433129
449 Ga0105248_10021570
450 Ga0105238_10023593
451 Ga0105239_10793240
452 Ga0105239_10923881
453 Ga0157371_10019301
454 Ga0157371_10078274
455 Ga0157370_10025082
456 Ga0157370_10456283
457 Ga0157369_10053667
458 Ga0157374_10094673
459 Ga0157378_10249090
460 Ga0163162_11199770
461 Ga0157372_10084716
462 Ga0157372_10112570
463 Ga0157372_11013654
464 Ga0157375_10082876
465 Ga0163163_10769629
466 Ga0157380_10164244
467 Ga0157380_10394147
468 Ga0157377_10100902
469 Ga0157376_10718050
470 Ga0182007_10027079
471 Ga0163161_10426744
472 Ga0206353_11665855
473 Ga0213876_10003611
474 Ga0213875_10014715
475 Ga0207682_10076624
476 Ga0207642_10022966
477 Ga0207680_10038402
478 Ga0207680_10245536
479 Ga0207645_10091363
480 Ga0207645_10760129
481 Ga0207705_10009550
482 Ga0207705_10017878
483 Ga0207705_10533307
484 Ga0207654_10000366
485 Ga0207707_10447914
486 Ga0207695_10000700
487 Ga0207695_10045574
488 Ga0207671_10119877
489 Ga0207660_10051716
490 Ga0207662_10014953
491 Ga0207657_10003780
492 Ga0207657_10022842
493 Ga0207657_10077696
494 Ga0207649_10026543
495 Ga0207649_10254783
496 Ga0207649_10272248
497 Ga0207652_10090847
498 Ga0207652_10098799
499 Ga0207652_10362099
500 Ga0207652_10673934
501 Ga0207681_10798421
502 Ga0207694_10199715
503 Ga0207650_11490207
504 Ga0207659_10022996
505 Ga0207659_10066432
506 Ga0207687_10152834
507 Ga0207687_10261751
508 Ga0207700_10761490
509 Ga0207664_10007781
510 Ga0207690_10094374
511 Ga0207690_10418300
512 Ga0207706_10632372
513 Ga0207686_10630656
514 Ga0207709_10186401
515 Ga0207670_10316271
516 Ga0207669_10214534
517 Ga0207691_10063632
518 Ga0207711_10224099
519 Ga0207689_10053509
520 Ga0207661_10037926
521 Ga0207661_10064404
522 Ga0207661_10147755
523 Ga0207661_10370592
524 Ga0207679_11189070
525 Ga0207667_10001010
526 Ga0207667_10059284
527 Ga0207667_10352495
528 Ga0207651_10053083
529 Ga0207712_10318355
530 Ga0207640_10001254
531 Ga0207640_10298518
532 Ga0207658_10158572
533 Ga0207703_10129324
534 Ga0207678_10000097
535 Ga0207678_10510269
536 Ga0207708_10223092
537 Ga0207702_10696299
538 Ga0207702_10748608
539 Ga0207702_11179809
540 Ga0207702_11225402
541 Ga0207641_10340566
542 Ga0207648_10086007
543 Ga0207674_10392605
544 Ga0207675_101232664
545 Ga0207683_10449552
546 Ga0207698_10036461
547 Ga0207698_10059365
548 Ga0268266_10084893
549 Ga0268266_10233856
550 Ga0268266_10467060
551 Ga0268265_10004294
552 Ga0268265_10357371
553 Ga0268264_10393480
554 Ga0268264_11081630
555 Ga0265332_10001664
556 Ga0265332_10040389
557 Ga0265329_10272178
558 Ga0265340_10108955
559 Ga0265327_10034742
560 Ga0265327_10469085
561 Ga0265316_11029221
562 Ga0307408_100704105
563 Ga0307408_101161625
564 Ga0265314_10005278
565 Ga0265314_10038910
566 Ga0265342_10071962
567 Ga0307405_10169213
568 Ga0307405_10758778
569 Ga0307405_10944716
570 Ga0307413_10034150
571 Ga0307413_11135686
572 Ga0307410_10121962
573 Ga0307406_10439229
574 Ga0307406_10604891
575 Ga0307406_12043901
576 Ga0307407_10379961
577 Ga0307407_10566422
578 Ga0307407_11285893
579 Ga0307412_10105268
580 Ga0307412_10259004
581 Ga0307412_12026490
582 Ga0307409_100247295
583 Ga0307409_100379245
584 Ga0307409_100536211
585 Ga0307409_100611813
586 Ga0307416_101586768
587 Ga0307416_102399144
588 Ga0307414_10339538
589 Ga0307411_10974050
590 Ga0307415_100591451
591 Ga0307415_100932829
592 Ga0307415_101472418
593 Ga0316593_10001696
594 Ga0316593_10009146
595 Ga0395899_0015584
596 Ga0395900_0471785
597 Ga0395905_0148059
598 Ga0395905_0196127
599 Ga0395905_0315683
600 Ga0436364_1339265
601 Ga0395901_0019869
602 Ga0400488_09071
603 Ga0400486_17951
604 Ga0436365_0087199
605 Ga0436365_1071656
606 Ga0451577_0000001
607 Ga0451577_0259747
608 Ga0451577_0265326
609 Ga0451577_1968476
610 Ga0451577_1971349
611 Ga0453683_0446664
612 Ga0466966_0006721
613 Ga0466966_0031529
614 Ga0466961_0045554
615 Ga0453684_0084185
616 Ga0453684_0114523
617 Ga0453684_2150091
618 Ga0466957_1424266
619 Ga0466959_0010149
620 Ga0466959_0060845
621 Ga0451576_0141778
622 Ga0451576_0276578
623 Ga0451576_2580769
624 Ga0466958_0948040
625 Ga0466967_1142112
626 Ga0495587_0633885
627 Ga0495636_0056818
628 Ga0496104_0581022
629 Ga0496112_0811465
630 Ga0496114_0218700
631 Ga0501031_0130388
632 Ga0501031_0421413
633 Ga0501032_0210627
634 Ga0501032_0211795
635 Ga0501033_0053493
636 Ga0501033_0070997
637 Ga0501033_0169683
638 Ga0501034_0066493
639 Ga0501034_0102392
640 Ga0501034_0175587
641 Ga0501036_0076318
642 Ga0501036_0315936
643 Ga0501036_0325716
644 Ga0501037_0027927
645 Ga0501037_0343831
646 Ga0501038_0063827
647 Ga0501038_0200067
648 Ga0501038_0308689
649 Ga0501039_0529530
650 Ga0501039_0604388
651 Ga0501043_0022532
652 Ga0501043_0058962
653 Ga0501043_0260298
654 Ga0501046_0375653
655 Ga0501047_0002817
656 Ga0501047_0089133
657 Ga0501047_0090202
658 Ga0501048_1173009
659 Ga0501070_0208436
660 Ga0501070_0715555
661 Ga0501073_0179037
662 Ga0501216_096664
663 Ga0501219_004947
664 Ga0501266_095513
665 Ga0501035_0001262
666 Ga0501035_0039189
667 Ga0501035_0059216
668 Ga0501044_0001144
669 Ga0501044_0003721
670 Ga0501044_0019923
671 Ga0501284_06836
672 nmdc:mga09592_64785_c1
673 nmdc:mga0n895_43157_c1
674 Ga0500596_023061

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

3

115

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5chy-assembly1.cif.gz_A structure of chemotaxis protein chey 0.9791 1 122
3rvo-assembly1.cif.gz_A structure of chey-mn2+ complex with substitutions at 59 and 89: n59d e89y 0.978 1 122
1e6m-assembly1.cif.gz_A two-component signal transduction system d57a mutant of chey 0.9775 2 122
1ehc-assembly1.cif.gz_A structure of signal transduction protein chey 0.9753 1 122
1d4z-assembly1.cif.gz_A crystal structure of chey-95iv, a hyperactive chey mutant 0.9727 1 122
ID Description Score Start End Superfamily
4jp1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9676 1 118 3.40.50.2300
af_P0AE88_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9416 1 85 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9337 2 81 3.40.50.2300
2iynC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9332 1 119 3.40.50.2300
4tmyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9302 2 117 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A6I7QSQ1-F1-model_v4 Response regulator 0.9758 1 120 GO:0000160
AF-A0A5Q4DDE0-F1-model_v4 Response regulator 0.9675 1 125 GO:0000160
AF-A0A651H6E0-F1-model_v4 Response regulator 0.9672 1 125 GO:0000160
AF-A0A1F7T8H6-F1-model_v4 Response regulatory domain-containing protein 0.9623 2 121 GO:0000160
AF-A0A538PT90-F1-model_v4 Response regulator 0.961 2 117 GO:0000160

Map