F412717
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 336 | 195 | 336 | 172 |
Family's Representative Sequence
| Representative Sequence | 3300026067|Ga0207678_10249991|Ga0207678_102499911 |
| Length | 198 |
| Sequence | MPAVTLTAGPIARARNGVIGRDGGLPWRLKTDLANFRAVTMGKPVIMGRKTWESLPKKPLVGRTNIVLSRDGSFEPKGAVVCEDFAEAVAIAREQAAEDGAREVCVIGGASLFELALPKAGRVYLTDVESPTTARWRWCPAGTSTRRRDTPPRNSPPAAPCSWPTARGERGGMTQGAPAHIAGVSKIAYAPTTSRSLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 2 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 3 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 37 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 39 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 110 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 114 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 115 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 121 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 122 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 123 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 135 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 136 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 164 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 165 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 169 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 170 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 171 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 172 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 173 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 174 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 177 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 178 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 179 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 180 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 181 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 182 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 183 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 184 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 185 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 186 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 187 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 188 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 189 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 190 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 191 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 192 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 193 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 194 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 195 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.01 |
| Nodule | 0.3 |
| Rhizoplane | 5.06 |
| Rhizosphere | 77.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055531_10002236 | 3300003794 | Bacteria | 13108 |
| 2 | Ga0055543_1004653 | 3300004625 | Bacteria | 3680 |
| 3 | Ga0065165_1000413 | 3300005262 | Bacteria | 67911 |
| 4 | Ga0070658_10089227 | 3300005327 | Bacteria | 2539 |
| 5 | Ga0070658_10106627 | 3300005327 | Bacteria | 2318 |
| 6 | Ga0070658_10407239 | 3300005327 | Bacteria | 1169 |
| 7 | Ga0070670_100039654 | 3300005331 | Bacteria | 4050 |
| 8 | Ga0070670_100689836 | 3300005331 | Bacteria | 918 |
| 9 | Ga0070666_10586711 | 3300005335 | Bacteria | 813 |
| 10 | Ga0070680_100005224 | 3300005336 | Bacteria | 9825 |
| 11 | Ga0070661_100259260 | 3300005344 | Bacteria | 1344 |
| 12 | Ga0070668_100000108 | 3300005347 | Bacteria | 50828 |
| 13 | Ga0070668_100001042 | 3300005347 | Bacteria | 19474 |
| 14 | Ga0070668_100009534 | 3300005347 | Bacteria | 7204 |
| 15 | Ga0070669_100525948 | 3300005353 | Bacteria | 984 |
| 16 | Ga0070671_100001712 | 3300005355 | Bacteria | 16651 |
| 17 | Ga0070671_100108420 | 3300005355 | Bacteria | 2332 |
| 18 | Ga0070673_100012513 | 3300005364 | Bacteria | 5829 |
| 19 | Ga0070659_100002556 | 3300005366 | Bacteria | 12935 |
| 20 | Ga0070659_101125292 | 3300005366 | Bacteria | 693 |
| 21 | Ga0070667_100000163 | 3300005367 | Bacteria | 83059 |
| 22 | Ga0070667_100004064 | 3300005367 | Bacteria | 12375 |
| 23 | Ga0070667_100106981 | 3300005367 | Bacteria | 2421 |
| 24 | Ga0070667_101539401 | 3300005367 | Bacteria | 625 |
| 25 | Ga0070662_100176256 | 3300005457 | Bacteria | 1683 |
| 26 | Ga0070681_10001166 | 3300005458 | Bacteria | 22688 |
| 27 | Ga0070681_10090387 | 3300005458 | Bacteria | 3012 |
| 28 | Ga0070679_100016541 | 3300005530 | Bacteria | 7120 |
| 29 | Ga0070679_100558835 | 3300005530 | Bacteria | 1088 |
| 30 | Ga0070679_100584384 | 3300005530 | Bacteria | 1060 |
| 31 | Ga0068853_100337804 | 3300005539 | Bacteria | 1399 |
| 32 | Ga0070665_100000015 | 3300005548 | Bacteria | 462744 |
| 33 | Ga0070665_100001115 | 3300005548 | Bacteria | 33073 |
| 34 | Ga0070665_100033530 | 3300005548 | Bacteria | 5166 |
| 35 | Ga0070665_100043987 | 3300005548 | Bacteria | 4486 |
| 36 | Ga0070665_100442057 | 3300005548 | Bacteria | 1310 |
| 37 | Ga0068855_100157199 | 3300005563 | Bacteria | 2582 |
| 38 | Ga0068855_100162184 | 3300005563 | Bacteria | 2536 |
| 39 | Ga0070664_100601630 | 3300005564 | Bacteria | 1020 |
| 40 | Ga0068857_101041460 | 3300005577 | Bacteria | 789 |
| 41 | Ga0068854_101155844 | 3300005578 | Bacteria | 692 |
| 42 | Ga0068856_100144367 | 3300005614 | Bacteria | 2387 |
| 43 | Ga0068856_100749258 | 3300005614 | Bacteria | 997 |
| 44 | Ga0068852_100200384 | 3300005616 | Bacteria | 1889 |
| 45 | Ga0068859_100000671 | 3300005617 | Bacteria | 34266 |
| 46 | Ga0068859_100016961 | 3300005617 | Bacteria | 7310 |
| 47 | Ga0068859_100048343 | 3300005617 | Bacteria | 4274 |
| 48 | Ga0068859_100858072 | 3300005617 | Bacteria | 994 |
| 49 | Ga0068864_100000071 | 3300005618 | Bacteria | 111481 |
| 50 | Ga0068864_100000400 | 3300005618 | Bacteria | 37634 |
| 51 | Ga0068864_100015552 | 3300005618 | Bacteria | 6328 |
| 52 | Ga0068861_100039322 | 3300005719 | Bacteria | 3529 |
| 53 | Ga0068861_100288069 | 3300005719 | Bacteria | 1417 |
| 54 | Ga0068863_100000037 | 3300005841 | Bacteria | 162638 |
| 55 | Ga0068863_100000451 | 3300005841 | Bacteria | 41841 |
| 56 | Ga0068863_100010651 | 3300005841 | Bacteria | 8925 |
| 57 | Ga0068863_100064702 | 3300005841 | Bacteria | 3459 |
| 58 | Ga0068863_100110186 | 3300005841 | Bacteria | 2621 |
| 59 | Ga0068863_100303289 | 3300005841 | Bacteria | 1549 |
| 60 | Ga0068858_100000029 | 3300005842 | Bacteria | 144691 |
| 61 | Ga0068858_100002275 | 3300005842 | Bacteria | 19425 |
| 62 | Ga0068858_100006867 | 3300005842 | Bacteria | 11061 |
| 63 | Ga0068858_100500569 | 3300005842 | Bacteria | 1174 |
| 64 | Ga0068860_100000310 | 3300005843 | Bacteria | 67162 |
| 65 | Ga0068860_100001015 | 3300005843 | Bacteria | 31089 |
| 66 | Ga0068860_100038260 | 3300005843 | Bacteria | 4589 |
| 67 | Ga0068862_100001338 | 3300005844 | Bacteria | 22879 |
| 68 | Ga0068862_100001526 | 3300005844 | Bacteria | 21211 |
| 69 | Ga0068862_100009403 | 3300005844 | Bacteria | 8086 |
| 70 | Ga0068862_100012637 | 3300005844 | Bacteria | 6988 |
| 71 | Ga0068862_100045586 | 3300005844 | Bacteria | 3741 |
| 72 | Ga0068862_100210431 | 3300005844 | Bacteria | 1757 |
| 73 | Ga0075365_10155622 | 3300006038 | Bacteria | 1591 |
| 74 | Ga0075362_10182394 | 3300006177 | Bacteria | 1017 |
| 75 | Ga0075370_10174304 | 3300006353 | Bacteria | 1265 |
| 76 | Ga0075370_10197654 | 3300006353 | Bacteria | 1186 |
| 77 | Ga0068865_100002911 | 3300006881 | Bacteria | 10209 |
| 78 | Ga0068865_101112377 | 3300006881 | Bacteria | 696 |
| 79 | Ga0097620_100000671 | 3300006931 | Bacteria | 34266 |
| 80 | Ga0097620_100016961 | 3300006931 | Bacteria | 7310 |
| 81 | Ga0097620_100048344 | 3300006931 | Bacteria | 4274 |
| 82 | Ga0097620_100857939 | 3300006931 | Bacteria | 994 |
| 83 | Ga0079104_1022711 | 3300006946 | Bacteria | 1683 |
| 84 | Ga0105250_10084577 | 3300009092 | Bacteria | 1288 |
| 85 | Ga0105240_10007853 | 3300009093 | Bacteria | 15399 |
| 86 | Ga0105240_10097019 | 3300009093 | Bacteria | 3591 |
| 87 | Ga0105240_10810213 | 3300009093 | Bacteria | 1014 |
| 88 | Ga0105245_10704908 | 3300009098 | Bacteria | 1043 |
| 89 | Ga0105247_10259382 | 3300009101 | Bacteria | 1191 |
| 90 | Ga0105241_10048308 | 3300009174 | Bacteria | 3238 |
| 91 | Ga0105241_11741358 | 3300009174 | Bacteria | 607 |
| 92 | Ga0105242_10374491 | 3300009176 | Bacteria | 1322 |
| 93 | Ga0105248_10003631 | 3300009177 | Bacteria | 17121 |
| 94 | Ga0105248_10016560 | 3300009177 | Bacteria | 8118 |
| 95 | Ga0105248_10058394 | 3300009177 | Bacteria | 4333 |
| 96 | Ga0105248_10360572 | 3300009177 | Bacteria | 1636 |
| 97 | Ga0105248_10631706 | 3300009177 | Bacteria | 1208 |
| 98 | Ga0105248_11481675 | 3300009177 | Bacteria | 768 |
| 99 | Ga0105237_10346058 | 3300009545 | Bacteria | 1491 |
| 100 | Ga0105238_10069366 | 3300009551 | Bacteria | 3525 |
| 101 | Ga0105238_10131740 | 3300009551 | Bacteria | 2478 |
| 102 | Ga0105249_10000792 | 3300009553 | Bacteria | 28363 |
| 103 | Ga0105249_10355675 | 3300009553 | Bacteria | 1485 |
| 104 | Ga0105249_11160133 | 3300009553 | Bacteria | 843 |
| 105 | Ga0105239_10320980 | 3300010375 | Bacteria | 1746 |
| 106 | Ga0105239_10679984 | 3300010375 | Bacteria | 1176 |
| 107 | Ga0105239_11353239 | 3300010375 | Bacteria | 822 |
| 108 | Ga0157370_10200938 | 3300013104 | Bacteria | 1849 |
| 109 | Ga0157374_10261236 | 3300013296 | Bacteria | 1705 |
| 110 | Ga0163162_10272195 | 3300013306 | Bacteria | 1825 |
| 111 | Ga0163162_10351075 | 3300013306 | Bacteria | 1608 |
| 112 | Ga0157372_10891657 | 3300013307 | Bacteria | 1032 |
| 113 | Ga0157375_10025894 | 3300013308 | Bacteria | 5458 |
| 114 | Ga0163163_10002745 | 3300014325 | Bacteria | 14860 |
| 115 | Ga0163163_10043538 | 3300014325 | Bacteria | 4401 |
| 116 | Ga0163163_10200590 | 3300014325 | Bacteria | 2043 |
| 117 | Ga0163163_10204053 | 3300014325 | Bacteria | 2025 |
| 118 | Ga0163163_10363884 | 3300014325 | Bacteria | 1503 |
| 119 | Ga0163163_10481457 | 3300014325 | Bacteria | 1302 |
| 120 | Ga0163163_11166411 | 3300014325 | Bacteria | 833 |
| 121 | Ga0157380_10674857 | 3300014326 | Bacteria | 1034 |
| 122 | Ga0157379_10001228 | 3300014968 | Bacteria | 20819 |
| 123 | Ga0157379_10009298 | 3300014968 | Bacteria | 8559 |
| 124 | Ga0157379_10399042 | 3300014968 | Bacteria | 1264 |
| 125 | Ga0157376_10542260 | 3300014969 | Bacteria | 1150 |
| 126 | Ga0213872_10008474 | 3300021361 | Bacteria | 4975 |
| 127 | Ga0213876_10026457 | 3300021384 | Bacteria | 3059 |
| 128 | Ga0209026_1000630 | 3300025250 | Bacteria | 22154 |
| 129 | Ga0209148_1023844 | 3300025254 | Bacteria | 971 |
| 130 | Ga0209455_1033697 | 3300025272 | Bacteria | 840 |
| 131 | Ga0209758_1004816 | 3300025297 | Bacteria | 10893 |
| 132 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 133 | Ga0209257_1000152 | 3300025304 | Bacteria | 189432 |
| 134 | Ga0209257_1000660 | 3300025304 | Bacteria | 54233 |
| 135 | Ga0207697_10052370 | 3300025315 | Bacteria | 1689 |
| 136 | Ga0207696_1049243 | 3300025711 | Bacteria | 1209 |
| 137 | Ga0207680_10421066 | 3300025903 | Bacteria | 946 |
| 138 | Ga0207645_10131853 | 3300025907 | Bacteria | 1627 |
| 139 | Ga0207705_10001433 | 3300025909 | Bacteria | 19009 |
| 140 | Ga0207705_10073533 | 3300025909 | Bacteria | 2480 |
| 141 | Ga0207654_10075197 | 3300025911 | Bacteria | 2018 |
| 142 | Ga0207707_10013897 | 3300025912 | Bacteria | 7020 |
| 143 | Ga0207707_10199525 | 3300025912 | Bacteria | 1744 |
| 144 | Ga0207695_10012791 | 3300025913 | Bacteria | 10048 |
| 145 | Ga0207695_10012863 | 3300025913 | Bacteria | 10018 |
| 146 | Ga0207695_10017928 | 3300025913 | Bacteria | 8199 |
| 147 | Ga0207660_10012523 | 3300025917 | Bacteria | 5552 |
| 148 | Ga0207660_10318386 | 3300025917 | Bacteria | 1242 |
| 149 | Ga0207657_10004499 | 3300025919 | Bacteria | 14724 |
| 150 | Ga0207652_10006581 | 3300025921 | Bacteria | 9367 |
| 151 | Ga0207652_10280521 | 3300025921 | Bacteria | 1503 |
| 152 | Ga0207681_10012022 | 3300025923 | Bacteria | 5332 |
| 153 | Ga0207681_10378555 | 3300025923 | Bacteria | 1139 |
| 154 | Ga0207694_10087908 | 3300025924 | Bacteria | 2449 |
| 155 | Ga0207694_10141064 | 3300025924 | Bacteria | 1938 |
| 156 | Ga0207650_10000175 | 3300025925 | Bacteria | 75521 |
| 157 | Ga0207650_10027607 | 3300025925 | Bacteria | 4064 |
| 158 | Ga0207650_10090668 | 3300025925 | Bacteria | 2335 |
| 159 | Ga0207644_10045921 | 3300025931 | Bacteria | 3109 |
| 160 | Ga0207644_10244806 | 3300025931 | Bacteria | 1429 |
| 161 | Ga0207690_10000887 | 3300025932 | Bacteria | 19086 |
| 162 | Ga0207690_10009780 | 3300025932 | Bacteria | 5699 |
| 163 | Ga0207706_10059038 | 3300025933 | Bacteria | 3379 |
| 164 | Ga0207704_10002139 | 3300025938 | Bacteria | 8861 |
| 165 | Ga0207711_10000978 | 3300025941 | Bacteria | 27393 |
| 166 | Ga0207711_10001642 | 3300025941 | Bacteria | 20636 |
| 167 | Ga0207711_10003500 | 3300025941 | Bacteria | 13594 |
| 168 | Ga0207711_10020019 | 3300025941 | Bacteria | 5576 |
| 169 | Ga0207711_10096690 | 3300025941 | Bacteria | 2607 |
| 170 | Ga0207679_10216063 | 3300025945 | Bacteria | 1611 |
| 171 | Ga0207667_10006902 | 3300025949 | Bacteria | 13714 |
| 172 | Ga0207667_10605778 | 3300025949 | Bacteria | 1104 |
| 173 | Ga0207651_10081986 | 3300025960 | Bacteria | 2327 |
| 174 | Ga0207712_10000376 | 3300025961 | Bacteria | 39304 |
| 175 | Ga0207712_10257918 | 3300025961 | Bacteria | 1412 |
| 176 | Ga0207668_10000001 | 3300025972 | Bacteria | 266091 |
| 177 | Ga0207668_10000123 | 3300025972 | Bacteria | 54467 |
| 178 | Ga0207668_10001064 | 3300025972 | Bacteria | 16380 |
| 179 | Ga0207668_10005045 | 3300025972 | Bacteria | 7771 |
| 180 | Ga0207668_10017158 | 3300025972 | Bacteria | 4531 |
| 181 | Ga0207658_10000118 | 3300025986 | Bacteria | 87228 |
| 182 | Ga0207658_10006171 | 3300025986 | Bacteria | 8181 |
| 183 | Ga0207658_10009958 | 3300025986 | Bacteria | 6460 |
| 184 | Ga0207677_10165499 | 3300026023 | Bacteria | 1723 |
| 185 | Ga0207703_10000490 | 3300026035 | Bacteria | 41132 |
| 186 | Ga0207703_10002421 | 3300026035 | Bacteria | 16199 |
| 187 | Ga0207703_10002470 | 3300026035 | Bacteria | 16035 |
| 188 | Ga0207703_11347883 | 3300026035 | Bacteria | 686 |
| 189 | Ga0207639_10041879 | 3300026041 | Bacteria | 3430 |
| 190 | Ga0207639_10396143 | 3300026041 | Bacteria | 1243 |
| 191 | Ga0207678_10249991 | 3300026067 | Bacteria | 1518 |
| 192 | Ga0207702_10048360 | 3300026078 | Bacteria | 3587 |
| 193 | Ga0207702_10677177 | 3300026078 | Bacteria | 1016 |
| 194 | Ga0207641_10000034 | 3300026088 | Bacteria | 217752 |
| 195 | Ga0207641_10001419 | 3300026088 | Bacteria | 23630 |
| 196 | Ga0207641_10007520 | 3300026088 | Bacteria | 9066 |
| 197 | Ga0207641_10053054 | 3300026088 | Bacteria | 3435 |
| 198 | Ga0207641_10133694 | 3300026088 | Bacteria | 2230 |
| 199 | Ga0207641_10358047 | 3300026088 | Bacteria | 1392 |
| 200 | Ga0207676_10000387 | 3300026095 | Bacteria | 37459 |
| 201 | Ga0207676_10001782 | 3300026095 | Bacteria | 15788 |
| 202 | Ga0207676_10021308 | 3300026095 | Bacteria | 4754 |
| 203 | Ga0207674_10095688 | 3300026116 | Bacteria | 2955 |
| 204 | Ga0207675_100037302 | 3300026118 | Bacteria | 4534 |
| 205 | Ga0207675_100344140 | 3300026118 | Bacteria | 1460 |
| 206 | Ga0207683_10149982 | 3300026121 | Bacteria | 2104 |
| 207 | Ga0209981_1000550 | 3300027378 | Bacteria | 4780 |
| 208 | Ga0209999_1000403 | 3300027543 | Bacteria | 6671 |
| 209 | Ga0209813_10326708 | 3300027866 | Bacteria | 602 |
| 210 | Ga0209974_10052229 | 3300027876 | Bacteria | 1375 |
| 211 | Ga0268266_10000005 | 3300028379 | Bacteria | 1448194 |
| 212 | Ga0268266_10001669 | 3300028379 | Bacteria | 25581 |
| 213 | Ga0268266_10072971 | 3300028379 | Bacteria | 2977 |
| 214 | Ga0268266_10395345 | 3300028379 | Bacteria | 1306 |
| 215 | Ga0268265_10000901 | 3300028380 | Bacteria | 27588 |
| 216 | Ga0268265_10002744 | 3300028380 | Bacteria | 12993 |
| 217 | Ga0268265_10007451 | 3300028380 | Bacteria | 7391 |
| 218 | Ga0268265_10008301 | 3300028380 | Bacteria | 7015 |
| 219 | Ga0268265_10042495 | 3300028380 | Bacteria | 3374 |
| 220 | Ga0268265_10051981 | 3300028380 | Bacteria | 3096 |
| 221 | Ga0268264_10000055 | 3300028381 | Bacteria | 314947 |
| 222 | Ga0268264_10000481 | 3300028381 | Bacteria | 53088 |
| 223 | Ga0268264_10044625 | 3300028381 | Bacteria | 3677 |
| 224 | Ga0268264_10066058 | 3300028381 | Bacteria | 3050 |
| 225 | Ga0268264_11521039 | 3300028381 | Bacteria | 680 |
| 226 | Ga0268264_11803070 | 3300028381 | Bacteria | 622 |
| 227 | Ga0307517_10001099 | 3300028786 | Bacteria | 45677 |
| 228 | Ga0307517_10235237 | 3300028786 | Bacteria | 1094 |
| 229 | Ga0265324_10078086 | 3300029957 | Bacteria | 1126 |
| 230 | Ga0307511_10066907 | 3300030521 | Bacteria | 2672 |
| 231 | Ga0265327_10003115 | 3300031251 | Bacteria | 16344 |
| 232 | Ga0265327_10003293 | 3300031251 | Bacteria | 15644 |
| 233 | Ga0307513_10000348 | 3300031456 | Bacteria | 67217 |
| 234 | Ga0307513_10001617 | 3300031456 | Bacteria | 32329 |
| 235 | Ga0307509_10352971 | 3300031507 | Bacteria | 1193 |
| 236 | Ga0307508_10450029 | 3300031616 | Bacteria | 880 |
| 237 | Ga0265314_10013333 | 3300031711 | Bacteria | 6645 |
| 238 | Ga0307516_10000020 | 3300031730 | Bacteria | 195931 |
| 239 | Ga0307413_10450144 | 3300031824 | Bacteria | 1022 |
| 240 | Ga0307510_10028390 | 3300033180 | Bacteria | 6391 |
| 241 | Ga0307510_10256841 | 3300033180 | Bacteria | 1231 |
| 242 | Ga0373944_0050005 | 3300035089 | Bacteria | 1315 |
| 243 | Ga0373936_0027752 | 3300035113 | Bacteria | 2221 |
| 244 | Ga0373943_0019984 | 3300035170 | Bacteria | 3085 |
| 245 | Ga0373946_0021940 | 3300035171 | Bacteria | 2481 |
| 246 | Ga0373935_0042738 | 3300035692 | Bacteria | 2851 |
| 247 | Ga0373927_0000622 | 3300035695 | Bacteria | 26882 |
| 248 | Ga0373947_0119760 | 3300035725 | Bacteria | 1671 |
| 249 | Ga0373937_0307637 | 3300036401 | Bacteria | 1499 |
| 250 | Ga0373925_0000067 | 3300037068 | Bacteria | 110348 |
| 251 | Ga0373925_0107785 | 3300037068 | Bacteria | 2149 |
| 252 | Ga0395899_0000095 | 3300037312 | Bacteria | 152790 |
| 253 | Ga0395900_0000006 | 3300037418 | Bacteria | 495364 |
| 254 | Ga0395898_0006778 | 3300037466 | Bacteria | 12192 |
| 255 | Ga0395905_0003726 | 3300037471 | Bacteria | 16150 |
| 256 | Ga0395905_1109319 | 3300037471 | Bacteria | 694 |
| 257 | Ga0395905_1177580 | 3300037471 | Bacteria | 670 |
| 258 | Ga0395901_0000001 | 3300038443 | Bacteria | 800383 |
| 259 | Ga0436365_1393387 | 3300039437 | Bacteria | 883 |
| 260 | Ga0436365_1528438 | 3300039437 | Bacteria | 1450 |
| 261 | Ga0436361_0708487 | 3300039447 | Bacteria | 11844 |
| 262 | Ga0439431_0017174 | 3300041997 | Bacteria | 1699 |
| 263 | Ga0466961_0263889 | 3300044693 | Bacteria | 1056 |
| 264 | Ga0495629_0026029 | 3300046459 | Bacteria | 4158 |
| 265 | Ga0495584_0287935 | 3300046491 | Bacteria | 835 |
| 266 | Ga0495583_0113733 | 3300046506 | Bacteria | 1145 |
| 267 | Ga0495620_0055154 | 3300046515 | Bacteria | 1676 |
| 268 | Ga0495620_0057390 | 3300046515 | Bacteria | 1634 |
| 269 | Ga0495628_0793299 | 3300046516 | Bacteria | 663 |
| 270 | Ga0495642_0028021 | 3300046528 | Bacteria | 2242 |
| 271 | Ga0495642_0094931 | 3300046528 | Bacteria | 1265 |
| 272 | Ga0495654_0082507 | 3300046530 | Bacteria | 1504 |
| 273 | Ga0495609_0197037 | 3300046538 | Bacteria | 843 |
| 274 | Ga0495597_0011879 | 3300046542 | Bacteria | 4214 |
| 275 | Ga0495622_0011589 | 3300046557 | Bacteria | 4074 |
| 276 | Ga0495668_0053532 | 3300046616 | Bacteria | 2231 |
| 277 | Ga0495668_0181499 | 3300046616 | Bacteria | 1153 |
| 278 | Ga0495611_0026265 | 3300046648 | Bacteria | 2540 |
| 279 | Ga0495669_0000009 | 3300046684 | Bacteria | 165516 |
| 280 | Ga0495669_0000330 | 3300046684 | Bacteria | 25496 |
| 281 | Ga0495669_0035204 | 3300046684 | Bacteria | 2210 |
| 282 | Ga0495636_0150241 | 3300047318 | Bacteria | 1045 |
| 283 | Ga0495674_0338069 | 3300047319 | Bacteria | 1224 |
| 284 | Ga0495672_0031736 | 3300047320 | Bacteria | 3296 |
| 285 | Ga0495687_054529 | 3300047443 | Bacteria | 1677 |
| 286 | Ga0495677_0007749 | 3300047445 | Bacteria | 4003 |
| 287 | Ga0495681_0161935 | 3300047470 | Bacteria | 931 |
| 288 | Ga0495686_0010010 | 3300047472 | Bacteria | 6774 |
| 289 | Ga0495593_0067440 | 3300047673 | Bacteria | 1863 |
| 290 | Ga0496100_0640503 | 3300048903 | Bacteria | 827 |
| 291 | Ga0496100_0824692 | 3300048903 | Bacteria | 727 |
| 292 | Ga0496101_0470219 | 3300048904 | Bacteria | 992 |
| 293 | Ga0496101_1149677 | 3300048904 | Bacteria | 609 |
| 294 | Ga0496102_0085788 | 3300048905 | Bacteria | 2908 |
| 295 | Ga0496102_0162701 | 3300048905 | Bacteria | 2099 |
| 296 | Ga0496105_0951980 | 3300048908 | Bacteria | 645 |
| 297 | Ga0496106_0079112 | 3300048909 | Bacteria | 2524 |
| 298 | Ga0496106_0584623 | 3300048909 | Bacteria | 895 |
| 299 | Ga0496107_0616660 | 3300048910 | Bacteria | 801 |
| 300 | Ga0496109_0039953 | 3300048912 | Bacteria | 4248 |
| 301 | Ga0496112_0072726 | 3300048915 | Bacteria | 3399 |
| 302 | Ga0496112_0087743 | 3300048915 | Bacteria | 3078 |
| 303 | Ga0496113_0258062 | 3300048916 | Bacteria | 1392 |
| 304 | Ga0496115_0002816 | 3300048918 | Bacteria | 12500 |
| 305 | Ga0496115_0013492 | 3300048918 | Bacteria | 6182 |
| 306 | Ga0496115_0131937 | 3300048918 | Bacteria | 2059 |
| 307 | Ga0496116_0034606 | 3300048919 | Bacteria | 3562 |
| 308 | Ga0496117_0017711 | 3300048920 | Bacteria | 5941 |
| 309 | Ga0496118_0063826 | 3300048921 | Bacteria | 2707 |
| 310 | Ga0496119_0069079 | 3300048922 | Bacteria | 2077 |
| 311 | Ga0496121_0001066 | 3300048924 | Bacteria | 48544 |
| 312 | Ga0501047_0257481 | 3300049581 | Bacteria | 1593 |
| 313 | Ga0501048_0093475 | 3300049582 | Bacteria | 2121 |
| 314 | nmdc:mga03683_161570_c1 | 3300050489 | Bacteria | 1015 |
| 315 | Ga0500635_0000045 | 3300053080 | Bacteria | 87314 |
| 316 | Ga0500578_0350891 | 3300053086 | Bacteria | 862 |
| 317 | Ga0500643_029903 | 3300053087 | Bacteria | 1673 |
| 318 | Ga0500583_0253462 | 3300053092 | Bacteria | 868 |
| 319 | Ga0500651_0354424 | 3300053093 | Bacteria | 832 |
| 320 | Ga0500641_0058514 | 3300053096 | Bacteria | 1601 |
| 321 | Ga0500554_105414 | 3300053102 | Bacteria | 945 |
| 322 | Ga0500556_0002193 | 3300053104 | Bacteria | 6559 |
| 323 | Ga0500562_000461 | 3300053108 | Bacteria | 9854 |
| 324 | Ga0500562_003227 | 3300053108 | Bacteria | 4073 |
| 325 | Ga0500595_015123 | 3300053119 | Bacteria | 2901 |
| 326 | Ga0500595_028290 | 3300053119 | Bacteria | 1912 |
| 327 | Ga0500597_135115 | 3300053120 | Bacteria | 1064 |
| 328 | Ga0500608_007229 | 3300053122 | Bacteria | 4579 |
| 329 | Ga0500614_006968 | 3300053123 | Bacteria | 2376 |
| 330 | Ga0500642_0019404 | 3300053130 | Bacteria | 2651 |
| 331 | Ga0500642_0064671 | 3300053130 | Bacteria | 1651 |
| 332 | Ga0500559_0067623 | 3300053136 | Bacteria | 1604 |
| 333 | Ga0500590_126035 | 3300053148 | Bacteria | 1192 |
| 334 | Ga0500619_011121 | 3300053154 | Bacteria | 2302 |
| 335 | Ga0500638_188552 | 3300053162 | Bacteria | 883 |
| 336 | Ga0500596_014760 | 3300053735 | Bacteria | 1173 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005539 | Ga0068853_100337804 | Ga0068853_1003378043 | 170 |
| 2 | 3300009551 | Ga0105238_10069366 | Ga0105238_100693661 | 170 |
| 3 | 3300025924 | Ga0207694_10141064 | Ga0207694_101410643 | 170 |
| 4 | 3300026067 | Ga0207678_10249991 | Ga0207678_102499911 | 170 |
| 5 | 3300037312 | Ga0395899_0000095 | Ga0395899_0000095_84638_85150 | 170 |
| 6 | 3300037418 | Ga0395900_0000006 | Ga0395900_0000006_310122_310634 | 170 |
| 7 | 3300037466 | Ga0395898_0006778 | Ga0395898_0006778_7104_7616 | 170 |
| 8 | 3300037471 | Ga0395905_0003726 | Ga0395905_0003726_2238_2750 | 170 |
| 9 | 3300038443 | Ga0395901_0000001 | Ga0395901_0000001_353370_353882 | 170 |
| 10 | 3300046516 | Ga0495628_0793299 | Ga0495628_0793299_132_644 | 170 |
| 11 | 3300047319 | Ga0495674_0338069 | Ga0495674_0338069_394_906 | 170 |
| 12 | 3300005844 | Ga0068862_100210431 | Ga0068862_1002104312 | 171 |
| 13 | 3300006353 | Ga0075370_10197654 | Ga0075370_101976542 | 171 |
| 14 | 3300025250 | Ga0209026_1000630 | Ga0209026_100063010 | 171 |
| 15 | 3300028380 | Ga0268265_10042495 | Ga0268265_100424953 | 171 |
| 16 | 3300028381 | Ga0268264_11521039 | Ga0268264_115210391 | 171 |
| 17 | 3300031456 | Ga0307513_10000348 | Ga0307513_1000034842 | 171 |
| 18 | 3300031507 | Ga0307509_10352971 | Ga0307509_103529711 | 171 |
| 19 | 3300036401 | Ga0373937_0307637 | Ga0373937_0307637_753_1268 | 171 |
| 20 | 3300053108 | Ga0500562_000461 | Ga0500562_000461_2226_2741 | 171 |
| 21 | 3300003794 | Ga0055531_10002236 | Ga0055531_100022365 | 172 |
| 22 | 3300004625 | Ga0055543_1004653 | Ga0055543_10046532 | 172 |
| 23 | 3300005262 | Ga0065165_1000413 | Ga0065165_100041333 | 172 |
| 24 | 3300005327 | Ga0070658_10089227 | Ga0070658_100892272 | 172 |
| 25 | 3300005327 | Ga0070658_10106627 | Ga0070658_101066272 | 172 |
| 26 | 3300005327 | Ga0070658_10407239 | Ga0070658_104072392 | 172 |
| 27 | 3300005331 | Ga0070670_100039654 | Ga0070670_1000396542 | 172 |
| 28 | 3300005331 | Ga0070670_100689836 | Ga0070670_1006898362 | 172 |
| 29 | 3300005335 | Ga0070666_10586711 | Ga0070666_105867111 | 172 |
| 30 | 3300005336 | Ga0070680_100005224 | Ga0070680_1000052245 | 172 |
| 31 | 3300005344 | Ga0070661_100259260 | Ga0070661_1002592601 | 172 |
| 32 | 3300005347 | Ga0070668_100000108 | Ga0070668_10000010844 | 172 |
| 33 | 3300005347 | Ga0070668_100001042 | Ga0070668_10000104214 | 172 |
| 34 | 3300005347 | Ga0070668_100009534 | Ga0070668_1000095345 | 172 |
| 35 | 3300005353 | Ga0070669_100525948 | Ga0070669_1005259482 | 172 |
| 36 | 3300005355 | Ga0070671_100001712 | Ga0070671_10000171223 | 172 |
| 37 | 3300005355 | Ga0070671_100108420 | Ga0070671_1001084202 | 172 |
| 38 | 3300005364 | Ga0070673_100012513 | Ga0070673_1000125133 | 172 |
| 39 | 3300005366 | Ga0070659_100002556 | Ga0070659_10000255615 | 172 |
| 40 | 3300005366 | Ga0070659_101125292 | Ga0070659_1011252921 | 172 |
| 41 | 3300005367 | Ga0070667_100000163 | Ga0070667_10000016349 | 172 |
| 42 | 3300005367 | Ga0070667_100004064 | Ga0070667_1000040644 | 172 |
| 43 | 3300005367 | Ga0070667_100106981 | Ga0070667_1001069813 | 172 |
| 44 | 3300005367 | Ga0070667_101539401 | Ga0070667_1015394011 | 172 |
| 45 | 3300005457 | Ga0070662_100176256 | Ga0070662_1001762562 | 172 |
| 46 | 3300005458 | Ga0070681_10001166 | Ga0070681_100011669 | 172 |
| 47 | 3300005458 | Ga0070681_10090387 | Ga0070681_100903873 | 172 |
| 48 | 3300005530 | Ga0070679_100016541 | Ga0070679_1000165416 | 172 |
| 49 | 3300005530 | Ga0070679_100558835 | Ga0070679_1005588351 | 172 |
| 50 | 3300005530 | Ga0070679_100584384 | Ga0070679_1005843841 | 172 |
| 51 | 3300005548 | Ga0070665_100000015 | Ga0070665_100000015398 | 172 |
| 52 | 3300005548 | Ga0070665_100001115 | Ga0070665_10000111516 | 172 |
| 53 | 3300005548 | Ga0070665_100033530 | Ga0070665_1000335304 | 172 |
| 54 | 3300005548 | Ga0070665_100043987 | Ga0070665_1000439874 | 172 |
| 55 | 3300005548 | Ga0070665_100442057 | Ga0070665_1004420572 | 172 |
| 56 | 3300005563 | Ga0068855_100157199 | Ga0068855_1001571994 | 172 |
| 57 | 3300005563 | Ga0068855_100162184 | Ga0068855_1001621843 | 172 |
| 58 | 3300005564 | Ga0070664_100601630 | Ga0070664_1006016302 | 172 |
| 59 | 3300005577 | Ga0068857_101041460 | Ga0068857_1010414601 | 172 |
| 60 | 3300005578 | Ga0068854_101155844 | Ga0068854_1011558441 | 172 |
| 61 | 3300005614 | Ga0068856_100144367 | Ga0068856_1001443672 | 172 |
| 62 | 3300005614 | Ga0068856_100749258 | Ga0068856_1007492582 | 172 |
| 63 | 3300005616 | Ga0068852_100200384 | Ga0068852_1002003843 | 172 |
| 64 | 3300005617 | Ga0068859_100000671 | Ga0068859_10000067125 | 172 |
| 65 | 3300005617 | Ga0068859_100016961 | Ga0068859_1000169614 | 172 |
| 66 | 3300005617 | Ga0068859_100048343 | Ga0068859_1000483436 | 172 |
| 67 | 3300005617 | Ga0068859_100858072 | Ga0068859_1008580721 | 172 |
| 68 | 3300005618 | Ga0068864_100000071 | Ga0068864_10000007120 | 172 |
| 69 | 3300005618 | Ga0068864_100000400 | Ga0068864_1000004004 | 172 |
| 70 | 3300005618 | Ga0068864_100015552 | Ga0068864_1000155522 | 172 |
| 71 | 3300005719 | Ga0068861_100039322 | Ga0068861_1000393223 | 172 |
| 72 | 3300005719 | Ga0068861_100288069 | Ga0068861_1002880692 | 172 |
| 73 | 3300005841 | Ga0068863_100000037 | Ga0068863_10000003793 | 172 |
| 74 | 3300005841 | Ga0068863_100000451 | Ga0068863_10000045128 | 172 |
| 75 | 3300005841 | Ga0068863_100010651 | Ga0068863_1000106514 | 172 |
| 76 | 3300005841 | Ga0068863_100064702 | Ga0068863_1000647026 | 172 |
| 77 | 3300005841 | Ga0068863_100110186 | Ga0068863_1001101862 | 172 |
| 78 | 3300005841 | Ga0068863_100303289 | Ga0068863_1003032892 | 172 |
| 79 | 3300005842 | Ga0068858_100000029 | Ga0068858_10000002952 | 172 |
| 80 | 3300005842 | Ga0068858_100002275 | Ga0068858_1000022755 | 172 |
| 81 | 3300005842 | Ga0068858_100006867 | Ga0068858_10000686711 | 172 |
| 82 | 3300005842 | Ga0068858_100500569 | Ga0068858_1005005692 | 172 |
| 83 | 3300005843 | Ga0068860_100000310 | Ga0068860_10000031070 | 172 |
| 84 | 3300005843 | Ga0068860_100001015 | Ga0068860_10000101510 | 172 |
| 85 | 3300005843 | Ga0068860_100038260 | Ga0068860_1000382602 | 172 |
| 86 | 3300005844 | Ga0068862_100001338 | Ga0068862_10000133815 | 172 |
| 87 | 3300005844 | Ga0068862_100001526 | Ga0068862_10000152617 | 172 |
| 88 | 3300005844 | Ga0068862_100009403 | Ga0068862_1000094032 | 172 |
| 89 | 3300005844 | Ga0068862_100012637 | Ga0068862_1000126377 | 172 |
| 90 | 3300005844 | Ga0068862_100045586 | Ga0068862_1000455862 | 172 |
| 91 | 3300006038 | Ga0075365_10155622 | Ga0075365_101556222 | 172 |
| 92 | 3300006177 | Ga0075362_10182394 | Ga0075362_101823941 | 172 |
| 93 | 3300006353 | Ga0075370_10174304 | Ga0075370_101743042 | 172 |
| 94 | 3300006881 | Ga0068865_100002911 | Ga0068865_10000291110 | 172 |
| 95 | 3300006881 | Ga0068865_101112377 | Ga0068865_1011123771 | 172 |
| 96 | 3300006931 | Ga0097620_100000671 | Ga0097620_10000067125 | 172 |
| 97 | 3300006931 | Ga0097620_100016961 | Ga0097620_1000169614 | 172 |
| 98 | 3300006931 | Ga0097620_100048344 | Ga0097620_1000483446 | 172 |
| 99 | 3300006931 | Ga0097620_100857939 | Ga0097620_1008579391 | 172 |
| 100 | 3300006946 | Ga0079104_1022711 | Ga0079104_10227111 | 172 |
| 101 | 3300009092 | Ga0105250_10084577 | Ga0105250_100845772 | 172 |
| 102 | 3300009093 | Ga0105240_10007853 | Ga0105240_100078534 | 172 |
| 103 | 3300009093 | Ga0105240_10097019 | Ga0105240_100970194 | 172 |
| 104 | 3300009093 | Ga0105240_10810213 | Ga0105240_108102131 | 172 |
| 105 | 3300009098 | Ga0105245_10704908 | Ga0105245_107049081 | 172 |
| 106 | 3300009101 | Ga0105247_10259382 | Ga0105247_102593821 | 172 |
| 107 | 3300009174 | Ga0105241_10048308 | Ga0105241_100483086 | 172 |
| 108 | 3300009174 | Ga0105241_11741358 | Ga0105241_117413581 | 172 |
| 109 | 3300009176 | Ga0105242_10374491 | Ga0105242_103744912 | 172 |
| 110 | 3300009177 | Ga0105248_10003631 | Ga0105248_100036314 | 172 |
| 111 | 3300009177 | Ga0105248_10016560 | Ga0105248_100165608 | 172 |
| 112 | 3300009177 | Ga0105248_10058394 | Ga0105248_100583945 | 172 |
| 113 | 3300009177 | Ga0105248_10360572 | Ga0105248_103605722 | 172 |
| 114 | 3300009177 | Ga0105248_10631706 | Ga0105248_106317062 | 172 |
| 115 | 3300009177 | Ga0105248_11481675 | Ga0105248_114816752 | 172 |
| 116 | 3300009545 | Ga0105237_10346058 | Ga0105237_103460582 | 172 |
| 117 | 3300009551 | Ga0105238_10131740 | Ga0105238_101317401 | 172 |
| 118 | 3300009553 | Ga0105249_10000792 | Ga0105249_1000079213 | 172 |
| 119 | 3300009553 | Ga0105249_10355675 | Ga0105249_103556751 | 172 |
| 120 | 3300009553 | Ga0105249_11160133 | Ga0105249_111601332 | 172 |
| 121 | 3300010375 | Ga0105239_10320980 | Ga0105239_103209802 | 172 |
| 122 | 3300010375 | Ga0105239_10679984 | Ga0105239_106799842 | 172 |
| 123 | 3300010375 | Ga0105239_11353239 | Ga0105239_113532392 | 172 |
| 124 | 3300013104 | Ga0157370_10200938 | Ga0157370_102009382 | 172 |
| 125 | 3300013296 | Ga0157374_10261236 | Ga0157374_102612362 | 172 |
| 126 | 3300013306 | Ga0163162_10272195 | Ga0163162_102721952 | 172 |
| 127 | 3300013306 | Ga0163162_10351075 | Ga0163162_103510751 | 172 |
| 128 | 3300013307 | Ga0157372_10891657 | Ga0157372_108916572 | 172 |
| 129 | 3300013308 | Ga0157375_10025894 | Ga0157375_100258943 | 172 |
| 130 | 3300014325 | Ga0163163_10002745 | Ga0163163_1000274511 | 172 |
| 131 | 3300014325 | Ga0163163_10043538 | Ga0163163_100435386 | 172 |
| 132 | 3300014325 | Ga0163163_10200590 | Ga0163163_102005903 | 172 |
| 133 | 3300014325 | Ga0163163_10204053 | Ga0163163_102040532 | 172 |
| 134 | 3300014325 | Ga0163163_10363884 | Ga0163163_103638843 | 172 |
| 135 | 3300014325 | Ga0163163_10481457 | Ga0163163_104814572 | 172 |
| 136 | 3300014325 | Ga0163163_11166411 | Ga0163163_111664112 | 172 |
| 137 | 3300014326 | Ga0157380_10674857 | Ga0157380_106748572 | 172 |
| 138 | 3300014968 | Ga0157379_10001228 | Ga0157379_100012283 | 172 |
| 139 | 3300014968 | Ga0157379_10009298 | Ga0157379_100092986 | 172 |
| 140 | 3300014968 | Ga0157379_10399042 | Ga0157379_103990421 | 172 |
| 141 | 3300014969 | Ga0157376_10542260 | Ga0157376_105422602 | 172 |
| 142 | 3300021361 | Ga0213872_10008474 | Ga0213872_100084742 | 172 |
| 143 | 3300021384 | Ga0213876_10026457 | Ga0213876_100264575 | 172 |
| 144 | 3300025254 | Ga0209148_1023844 | Ga0209148_10238442 | 172 |
| 145 | 3300025272 | Ga0209455_1033697 | Ga0209455_10336972 | 172 |
| 146 | 3300025297 | Ga0209758_1004816 | Ga0209758_100481612 | 172 |
| 147 | 3300025298 | Ga0209050_1000029 | Ga0209050_1000029152 | 172 |
| 148 | 3300025304 | Ga0209257_1000152 | Ga0209257_1000152164 | 172 |
| 149 | 3300025304 | Ga0209257_1000660 | Ga0209257_100066033 | 172 |
| 150 | 3300025315 | Ga0207697_10052370 | Ga0207697_100523703 | 172 |
| 151 | 3300025711 | Ga0207696_1049243 | Ga0207696_10492432 | 172 |
| 152 | 3300025903 | Ga0207680_10421066 | Ga0207680_104210661 | 172 |
| 153 | 3300025907 | Ga0207645_10131853 | Ga0207645_101318532 | 172 |
| 154 | 3300025909 | Ga0207705_10001433 | Ga0207705_1000143310 | 172 |
| 155 | 3300025909 | Ga0207705_10073533 | Ga0207705_100735332 | 172 |
| 156 | 3300025911 | Ga0207654_10075197 | Ga0207654_100751972 | 172 |
| 157 | 3300025912 | Ga0207707_10013897 | Ga0207707_100138971 | 172 |
| 158 | 3300025912 | Ga0207707_10199525 | Ga0207707_101995252 | 172 |
| 159 | 3300025913 | Ga0207695_10012791 | Ga0207695_100127916 | 172 |
| 160 | 3300025913 | Ga0207695_10012863 | Ga0207695_100128638 | 172 |
| 161 | 3300025913 | Ga0207695_10017928 | Ga0207695_100179284 | 172 |
| 162 | 3300025917 | Ga0207660_10012523 | Ga0207660_100125234 | 172 |
| 163 | 3300025917 | Ga0207660_10318386 | Ga0207660_103183861 | 172 |
| 164 | 3300025919 | Ga0207657_10004499 | Ga0207657_100044996 | 172 |
| 165 | 3300025921 | Ga0207652_10006581 | Ga0207652_100065814 | 172 |
| 166 | 3300025921 | Ga0207652_10280521 | Ga0207652_102805212 | 172 |
| 167 | 3300025923 | Ga0207681_10012022 | Ga0207681_100120222 | 172 |
| 168 | 3300025923 | Ga0207681_10378555 | Ga0207681_103785552 | 172 |
| 169 | 3300025924 | Ga0207694_10087908 | Ga0207694_100879082 | 172 |
| 170 | 3300025925 | Ga0207650_10000175 | Ga0207650_1000017548 | 172 |
| 171 | 3300025925 | Ga0207650_10027607 | Ga0207650_100276075 | 172 |
| 172 | 3300025925 | Ga0207650_10090668 | Ga0207650_100906682 | 172 |
| 173 | 3300025931 | Ga0207644_10045921 | Ga0207644_100459214 | 172 |
| 174 | 3300025931 | Ga0207644_10244806 | Ga0207644_102448062 | 172 |
| 175 | 3300025932 | Ga0207690_10000887 | Ga0207690_1000088719 | 172 |
| 176 | 3300025932 | Ga0207690_10009780 | Ga0207690_100097802 | 172 |
| 177 | 3300025933 | Ga0207706_10059038 | Ga0207706_100590382 | 172 |
| 178 | 3300025938 | Ga0207704_10002139 | Ga0207704_100021396 | 172 |
| 179 | 3300025941 | Ga0207711_10000978 | Ga0207711_1000097812 | 172 |
| 180 | 3300025941 | Ga0207711_10001642 | Ga0207711_1000164218 | 172 |
| 181 | 3300025941 | Ga0207711_10003500 | Ga0207711_100035002 | 172 |
| 182 | 3300025941 | Ga0207711_10020019 | Ga0207711_100200197 | 172 |
| 183 | 3300025941 | Ga0207711_10096690 | Ga0207711_100966902 | 172 |
| 184 | 3300025945 | Ga0207679_10216063 | Ga0207679_102160632 | 172 |
| 185 | 3300025949 | Ga0207667_10006902 | Ga0207667_100069024 | 172 |
| 186 | 3300025949 | Ga0207667_10605778 | Ga0207667_106057781 | 172 |
| 187 | 3300025960 | Ga0207651_10081986 | Ga0207651_100819862 | 172 |
| 188 | 3300025961 | Ga0207712_10000376 | Ga0207712_1000037627 | 172 |
| 189 | 3300025961 | Ga0207712_10257918 | Ga0207712_102579183 | 172 |
| 190 | 3300025972 | Ga0207668_10000001 | Ga0207668_10000001215 | 172 |
| 191 | 3300025972 | Ga0207668_10000123 | Ga0207668_1000012334 | 172 |
| 192 | 3300025972 | Ga0207668_10001064 | Ga0207668_100010648 | 172 |
| 193 | 3300025972 | Ga0207668_10005045 | Ga0207668_100050455 | 172 |
| 194 | 3300025972 | Ga0207668_10017158 | Ga0207668_100171587 | 172 |
| 195 | 3300025986 | Ga0207658_10000118 | Ga0207658_1000011863 | 172 |
| 196 | 3300025986 | Ga0207658_10006171 | Ga0207658_100061714 | 172 |
| 197 | 3300025986 | Ga0207658_10009958 | Ga0207658_100099582 | 172 |
| 198 | 3300026023 | Ga0207677_10165499 | Ga0207677_101654992 | 172 |
| 199 | 3300026035 | Ga0207703_10000490 | Ga0207703_100004902 | 172 |
| 200 | 3300026035 | Ga0207703_10002421 | Ga0207703_100024219 | 172 |
| 201 | 3300026035 | Ga0207703_10002470 | Ga0207703_100024705 | 172 |
| 202 | 3300026035 | Ga0207703_11347883 | Ga0207703_113478831 | 172 |
| 203 | 3300026041 | Ga0207639_10041879 | Ga0207639_100418793 | 172 |
| 204 | 3300026041 | Ga0207639_10396143 | Ga0207639_103961431 | 172 |
| 205 | 3300026078 | Ga0207702_10048360 | Ga0207702_100483602 | 172 |
| 206 | 3300026078 | Ga0207702_10677177 | Ga0207702_106771772 | 172 |
| 207 | 3300026088 | Ga0207641_10000034 | Ga0207641_10000034107 | 172 |
| 208 | 3300026088 | Ga0207641_10001419 | Ga0207641_100014198 | 172 |
| 209 | 3300026088 | Ga0207641_10007520 | Ga0207641_100075204 | 172 |
| 210 | 3300026088 | Ga0207641_10053054 | Ga0207641_100530546 | 172 |
| 211 | 3300026088 | Ga0207641_10133694 | Ga0207641_101336942 | 172 |
| 212 | 3300026088 | Ga0207641_10358047 | Ga0207641_103580472 | 172 |
| 213 | 3300026095 | Ga0207676_10000387 | Ga0207676_100003874 | 172 |
| 214 | 3300026095 | Ga0207676_10001782 | Ga0207676_1000178219 | 172 |
| 215 | 3300026095 | Ga0207676_10021308 | Ga0207676_100213082 | 172 |
| 216 | 3300026116 | Ga0207674_10095688 | Ga0207674_100956883 | 172 |
| 217 | 3300026118 | Ga0207675_100037302 | Ga0207675_1000373023 | 172 |
| 218 | 3300026118 | Ga0207675_100344140 | Ga0207675_1003441402 | 172 |
| 219 | 3300026121 | Ga0207683_10149982 | Ga0207683_101499823 | 172 |
| 220 | 3300027378 | Ga0209981_1000550 | Ga0209981_10005502 | 172 |
| 221 | 3300027543 | Ga0209999_1000403 | Ga0209999_10004034 | 172 |
| 222 | 3300027866 | Ga0209813_10326708 | Ga0209813_103267081 | 172 |
| 223 | 3300027876 | Ga0209974_10052229 | Ga0209974_100522291 | 172 |
| 224 | 3300028379 | Ga0268266_10000005 | Ga0268266_10000005720 | 172 |
| 225 | 3300028379 | Ga0268266_10001669 | Ga0268266_100016698 | 172 |
| 226 | 3300028379 | Ga0268266_10072971 | Ga0268266_100729715 | 172 |
| 227 | 3300028379 | Ga0268266_10395345 | Ga0268266_103953452 | 172 |
| 228 | 3300028380 | Ga0268265_10000901 | Ga0268265_1000090111 | 172 |
| 229 | 3300028380 | Ga0268265_10002744 | Ga0268265_1000274410 | 172 |
| 230 | 3300028380 | Ga0268265_10007451 | Ga0268265_100074514 | 172 |
| 231 | 3300028380 | Ga0268265_10008301 | Ga0268265_100083017 | 172 |
| 232 | 3300028380 | Ga0268265_10051981 | Ga0268265_100519812 | 172 |
| 233 | 3300028381 | Ga0268264_10000055 | Ga0268264_1000005533 | 172 |
| 234 | 3300028381 | Ga0268264_10000481 | Ga0268264_1000048111 | 172 |
| 235 | 3300028381 | Ga0268264_10044625 | Ga0268264_100446254 | 172 |
| 236 | 3300028381 | Ga0268264_10066058 | Ga0268264_100660584 | 172 |
| 237 | 3300028381 | Ga0268264_11803070 | Ga0268264_118030701 | 172 |
| 238 | 3300028786 | Ga0307517_10001099 | Ga0307517_1000109943 | 172 |
| 239 | 3300028786 | Ga0307517_10235237 | Ga0307517_102352372 | 172 |
| 240 | 3300029957 | Ga0265324_10078086 | Ga0265324_100780862 | 172 |
| 241 | 3300030521 | Ga0307511_10066907 | Ga0307511_100669073 | 172 |
| 242 | 3300031251 | Ga0265327_10003115 | Ga0265327_1000311516 | 172 |
| 243 | 3300031251 | Ga0265327_10003293 | Ga0265327_100032938 | 172 |
| 244 | 3300031456 | Ga0307513_10001617 | Ga0307513_1000161719 | 172 |
| 245 | 3300031616 | Ga0307508_10450029 | Ga0307508_104500292 | 172 |
| 246 | 3300031711 | Ga0265314_10013333 | Ga0265314_100133338 | 172 |
| 247 | 3300031730 | Ga0307516_10000020 | Ga0307516_1000002098 | 172 |
| 248 | 3300031824 | Ga0307413_10450144 | Ga0307413_104501441 | 172 |
| 249 | 3300033180 | Ga0307510_10028390 | Ga0307510_100283904 | 172 |
| 250 | 3300033180 | Ga0307510_10256841 | Ga0307510_102568412 | 172 |
| 251 | 3300035089 | Ga0373944_0050005 | Ga0373944_0050005_352_870 | 172 |
| 252 | 3300035113 | Ga0373936_0027752 | Ga0373936_0027752_1608_2126 | 172 |
| 253 | 3300035170 | Ga0373943_0019984 | Ga0373943_0019984_2091_2609 | 172 |
| 254 | 3300035171 | Ga0373946_0021940 | Ga0373946_0021940_97_615 | 172 |
| 255 | 3300035692 | Ga0373935_0042738 | Ga0373935_0042738_2222_2740 | 172 |
| 256 | 3300035695 | Ga0373927_0000622 | Ga0373927_0000622_11490_12008 | 172 |
| 257 | 3300035725 | Ga0373947_0119760 | Ga0373947_0119760_497_1015 | 172 |
| 258 | 3300037068 | Ga0373925_0000067 | Ga0373925_0000067_27327_27845 | 172 |
| 259 | 3300037068 | Ga0373925_0107785 | Ga0373925_0107785_602_1120 | 172 |
| 260 | 3300037471 | Ga0395905_1109319 | Ga0395905_1109319_40_558 | 172 |
| 261 | 3300037471 | Ga0395905_1177580 | Ga0395905_1177580_128_646 | 172 |
| 262 | 3300039437 | Ga0436365_1393387 | Ga0436365_1393387_337_855 | 172 |
| 263 | 3300039437 | Ga0436365_1528438 | Ga0436365_1528438_391_909 | 172 |
| 264 | 3300039447 | Ga0436361_0708487 | Ga0436361_0708487_5919_6440 | 172 |
| 265 | 3300041997 | Ga0439431_0017174 | Ga0439431_0017174_226_744 | 172 |
| 266 | 3300044693 | Ga0466961_0263889 | Ga0466961_0263889_165_683 | 172 |
| 267 | 3300046459 | Ga0495629_0026029 | Ga0495629_0026029_887_1405 | 172 |
| 268 | 3300046491 | Ga0495584_0287935 | Ga0495584_0287935_249_767 | 172 |
| 269 | 3300046506 | Ga0495583_0113733 | Ga0495583_0113733_259_777 | 172 |
| 270 | 3300046515 | Ga0495620_0055154 | Ga0495620_0055154_613_1131 | 172 |
| 271 | 3300046515 | Ga0495620_0057390 | Ga0495620_0057390_720_1238 | 172 |
| 272 | 3300046528 | Ga0495642_0028021 | Ga0495642_0028021_703_1221 | 172 |
| 273 | 3300046528 | Ga0495642_0094931 | Ga0495642_0094931_85_603 | 172 |
| 274 | 3300046530 | Ga0495654_0082507 | Ga0495654_0082507_91_609 | 172 |
| 275 | 3300046538 | Ga0495609_0197037 | Ga0495609_0197037_53_571 | 172 |
| 276 | 3300046542 | Ga0495597_0011879 | Ga0495597_0011879_1790_2308 | 172 |
| 277 | 3300046557 | Ga0495622_0011589 | Ga0495622_0011589_157_675 | 172 |
| 278 | 3300046616 | Ga0495668_0053532 | Ga0495668_0053532_899_1417 | 172 |
| 279 | 3300046616 | Ga0495668_0181499 | Ga0495668_0181499_167_685 | 172 |
| 280 | 3300046648 | Ga0495611_0026265 | Ga0495611_0026265_55_573 | 172 |
| 281 | 3300046684 | Ga0495669_0000009 | Ga0495669_0000009_17873_18391 | 172 |
| 282 | 3300046684 | Ga0495669_0000330 | Ga0495669_0000330_21451_21990 | 172 |
| 283 | 3300046684 | Ga0495669_0035204 | Ga0495669_0035204_1073_1591 | 172 |
| 284 | 3300047318 | Ga0495636_0150241 | Ga0495636_0150241_372_890 | 172 |
| 285 | 3300047320 | Ga0495672_0031736 | Ga0495672_0031736_2172_2690 | 172 |
| 286 | 3300047443 | Ga0495687_054529 | Ga0495687_054529_615_1133 | 172 |
| 287 | 3300047445 | Ga0495677_0007749 | Ga0495677_0007749_1203_1721 | 172 |
| 288 | 3300047470 | Ga0495681_0161935 | Ga0495681_0161935_257_775 | 172 |
| 289 | 3300047472 | Ga0495686_0010010 | Ga0495686_0010010_3420_3938 | 172 |
| 290 | 3300047673 | Ga0495593_0067440 | Ga0495593_0067440_412_930 | 172 |
| 291 | 3300048903 | Ga0496100_0640503 | Ga0496100_0640503_97_615 | 172 |
| 292 | 3300048903 | Ga0496100_0824692 | Ga0496100_0824692_100_618 | 172 |
| 293 | 3300048904 | Ga0496101_0470219 | Ga0496101_0470219_187_705 | 172 |
| 294 | 3300048904 | Ga0496101_1149677 | Ga0496101_1149677_69_587 | 172 |
| 295 | 3300048905 | Ga0496102_0085788 | Ga0496102_0085788_564_1082 | 172 |
| 296 | 3300048905 | Ga0496102_0162701 | Ga0496102_0162701_1270_1788 | 172 |
| 297 | 3300048908 | Ga0496105_0951980 | Ga0496105_0951980_67_585 | 172 |
| 298 | 3300048909 | Ga0496106_0079112 | Ga0496106_0079112_546_1064 | 172 |
| 299 | 3300048909 | Ga0496106_0584623 | Ga0496106_0584623_276_794 | 172 |
| 300 | 3300048910 | Ga0496107_0616660 | Ga0496107_0616660_101_619 | 172 |
| 301 | 3300048912 | Ga0496109_0039953 | Ga0496109_0039953_3385_3903 | 172 |
| 302 | 3300048915 | Ga0496112_0072726 | Ga0496112_0072726_1252_1770 | 172 |
| 303 | 3300048915 | Ga0496112_0087743 | Ga0496112_0087743_1258_1776 | 172 |
| 304 | 3300048916 | Ga0496113_0258062 | Ga0496113_0258062_555_1073 | 172 |
| 305 | 3300048918 | Ga0496115_0002816 | Ga0496115_0002816_1991_2509 | 172 |
| 306 | 3300048918 | Ga0496115_0013492 | Ga0496115_0013492_2782_3303 | 172 |
| 307 | 3300048918 | Ga0496115_0131937 | Ga0496115_0131937_147_665 | 172 |
| 308 | 3300048919 | Ga0496116_0034606 | Ga0496116_0034606_423_941 | 172 |
| 309 | 3300048920 | Ga0496117_0017711 | Ga0496117_0017711_1538_2056 | 172 |
| 310 | 3300048921 | Ga0496118_0063826 | Ga0496118_0063826_1816_2334 | 172 |
| 311 | 3300048922 | Ga0496119_0069079 | Ga0496119_0069079_324_842 | 172 |
| 312 | 3300048924 | Ga0496121_0001066 | Ga0496121_0001066_264_782 | 172 |
| 313 | 3300049581 | Ga0501047_0257481 | Ga0501047_0257481_361_879 | 172 |
| 314 | 3300049582 | Ga0501048_0093475 | Ga0501048_0093475_166_684 | 172 |
| 315 | 3300050489 | nmdc:mga03683_161570_c1 | nmdc:mga03683_161570_c1_387_908 | 172 |
| 316 | 3300053080 | Ga0500635_0000045 | Ga0500635_0000045_84919_85437 | 172 |
| 317 | 3300053086 | Ga0500578_0350891 | Ga0500578_0350891_68_586 | 172 |
| 318 | 3300053087 | Ga0500643_029903 | Ga0500643_029903_429_959 | 172 |
| 319 | 3300053092 | Ga0500583_0253462 | Ga0500583_0253462_127_645 | 172 |
| 320 | 3300053093 | Ga0500651_0354424 | Ga0500651_0354424_43_561 | 172 |
| 321 | 3300053096 | Ga0500641_0058514 | Ga0500641_0058514_522_1040 | 172 |
| 322 | 3300053102 | Ga0500554_105414 | Ga0500554_105414_50_568 | 172 |
| 323 | 3300053104 | Ga0500556_0002193 | Ga0500556_0002193_6008_6526 | 172 |
| 324 | 3300053108 | Ga0500562_003227 | Ga0500562_003227_2298_2816 | 172 |
| 325 | 3300053119 | Ga0500595_015123 | Ga0500595_015123_1787_2305 | 172 |
| 326 | 3300053119 | Ga0500595_028290 | Ga0500595_028290_940_1458 | 172 |
| 327 | 3300053120 | Ga0500597_135115 | Ga0500597_135115_58_576 | 172 |
| 328 | 3300053122 | Ga0500608_007229 | Ga0500608_007229_1785_2303 | 172 |
| 329 | 3300053123 | Ga0500614_006968 | Ga0500614_006968_1766_2284 | 172 |
| 330 | 3300053130 | Ga0500642_0019404 | Ga0500642_0019404_732_1250 | 172 |
| 331 | 3300053130 | Ga0500642_0064671 | Ga0500642_0064671_908_1426 | 172 |
| 332 | 3300053136 | Ga0500559_0067623 | Ga0500559_0067623_925_1443 | 172 |
| 333 | 3300053148 | Ga0500590_126035 | Ga0500590_126035_507_1025 | 172 |
| 334 | 3300053154 | Ga0500619_011121 | Ga0500619_011121_1743_2261 | 172 |
| 335 | 3300053162 | Ga0500638_188552 | Ga0500638_188552_141_659 | 172 |
| 336 | 3300053735 | Ga0500596_014760 | Ga0500596_014760_642_1160 | 172 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xg4-assembly1.cif.gz_A | x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim | 0.843 | 5 | 172 |
| 6xg4-assembly1.cif.gz_A | x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim | 0.838 | 5 | 172 |
| 4p66-assembly1.cif.gz_A | electrostatics of active site microenvironments of e. coli dhfr | 0.8357 | 5 | 172 |
| 3fl8-assembly8.cif.gz_H | crystal structure of b. anthracis dihydrofolate reductase (dhfr) with rab1, a tmp-dihydrophthalazine derivative | 0.8331 | 5 | 172 |
| 4p66-assembly1.cif.gz_A | electrostatics of active site microenvironments of e. coli dhfr | 0.8306 | 5 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4or7A00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8309 | 5 | 172 | 3.40.430.10 |
| 4fghA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8151 | 5 | 172 | 3.40.430.10 |
| 3fl9F00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.81 | 5 | 172 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8036 | 4 | 171 | 3.40.430.10 |
| 4m7vA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8026 | 3 | 171 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3TM16-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.965 | 81 | 172 |
GO:0004146
GO:0005829 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A4Q3TM16-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.955 | 81 | 172 |
GO:0004146
GO:0005829 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A2D7P4P2-F1-model_v4 | deleted | 0.8863 | 69 | 171 |
|
| AF-A0A328AU70-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.8622 | 1 | 172 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A6L8A8Z1-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.8614 | 5 | 172 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar