F412717

General Info

Members Datasets Scaffolds Average Seq Length
336 195 336 172

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10249991|Ga0207678_102499911
Length 198
Sequence MPAVTLTAGPIARARNGVIGRDGGLPWRLKTDLANFRAVTMGKPVIMGRKTWESLPKKPLVGRTNIVLSRDGSFEPKGAVVCEDFAEAVAIAREQAAEDGAREVCVIGGASLFELALPKAGRVYLTDVESPTTARWRWCPAGTSTRRRDTPPRNSPPAAPCSWPTARGERGGMTQGAPAHIAGVSKIAYAPTTSRSLD

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
172 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
177 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
178 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
179 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
190 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
191 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
192 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
193 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
194 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
195 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.01
Nodule 0.3
Rhizoplane 5.06
Rhizosphere 77.98
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10002236 3300003794 Bacteria 13108
2 Ga0055543_1004653 3300004625 Bacteria 3680
3 Ga0065165_1000413 3300005262 Bacteria 67911
4 Ga0070658_10089227 3300005327 Bacteria 2539
5 Ga0070658_10106627 3300005327 Bacteria 2318
6 Ga0070658_10407239 3300005327 Bacteria 1169
7 Ga0070670_100039654 3300005331 Bacteria 4050
8 Ga0070670_100689836 3300005331 Bacteria 918
9 Ga0070666_10586711 3300005335 Bacteria 813
10 Ga0070680_100005224 3300005336 Bacteria 9825
11 Ga0070661_100259260 3300005344 Bacteria 1344
12 Ga0070668_100000108 3300005347 Bacteria 50828
13 Ga0070668_100001042 3300005347 Bacteria 19474
14 Ga0070668_100009534 3300005347 Bacteria 7204
15 Ga0070669_100525948 3300005353 Bacteria 984
16 Ga0070671_100001712 3300005355 Bacteria 16651
17 Ga0070671_100108420 3300005355 Bacteria 2332
18 Ga0070673_100012513 3300005364 Bacteria 5829
19 Ga0070659_100002556 3300005366 Bacteria 12935
20 Ga0070659_101125292 3300005366 Bacteria 693
21 Ga0070667_100000163 3300005367 Bacteria 83059
22 Ga0070667_100004064 3300005367 Bacteria 12375
23 Ga0070667_100106981 3300005367 Bacteria 2421
24 Ga0070667_101539401 3300005367 Bacteria 625
25 Ga0070662_100176256 3300005457 Bacteria 1683
26 Ga0070681_10001166 3300005458 Bacteria 22688
27 Ga0070681_10090387 3300005458 Bacteria 3012
28 Ga0070679_100016541 3300005530 Bacteria 7120
29 Ga0070679_100558835 3300005530 Bacteria 1088
30 Ga0070679_100584384 3300005530 Bacteria 1060
31 Ga0068853_100337804 3300005539 Bacteria 1399
32 Ga0070665_100000015 3300005548 Bacteria 462744
33 Ga0070665_100001115 3300005548 Bacteria 33073
34 Ga0070665_100033530 3300005548 Bacteria 5166
35 Ga0070665_100043987 3300005548 Bacteria 4486
36 Ga0070665_100442057 3300005548 Bacteria 1310
37 Ga0068855_100157199 3300005563 Bacteria 2582
38 Ga0068855_100162184 3300005563 Bacteria 2536
39 Ga0070664_100601630 3300005564 Bacteria 1020
40 Ga0068857_101041460 3300005577 Bacteria 789
41 Ga0068854_101155844 3300005578 Bacteria 692
42 Ga0068856_100144367 3300005614 Bacteria 2387
43 Ga0068856_100749258 3300005614 Bacteria 997
44 Ga0068852_100200384 3300005616 Bacteria 1889
45 Ga0068859_100000671 3300005617 Bacteria 34266
46 Ga0068859_100016961 3300005617 Bacteria 7310
47 Ga0068859_100048343 3300005617 Bacteria 4274
48 Ga0068859_100858072 3300005617 Bacteria 994
49 Ga0068864_100000071 3300005618 Bacteria 111481
50 Ga0068864_100000400 3300005618 Bacteria 37634
51 Ga0068864_100015552 3300005618 Bacteria 6328
52 Ga0068861_100039322 3300005719 Bacteria 3529
53 Ga0068861_100288069 3300005719 Bacteria 1417
54 Ga0068863_100000037 3300005841 Bacteria 162638
55 Ga0068863_100000451 3300005841 Bacteria 41841
56 Ga0068863_100010651 3300005841 Bacteria 8925
57 Ga0068863_100064702 3300005841 Bacteria 3459
58 Ga0068863_100110186 3300005841 Bacteria 2621
59 Ga0068863_100303289 3300005841 Bacteria 1549
60 Ga0068858_100000029 3300005842 Bacteria 144691
61 Ga0068858_100002275 3300005842 Bacteria 19425
62 Ga0068858_100006867 3300005842 Bacteria 11061
63 Ga0068858_100500569 3300005842 Bacteria 1174
64 Ga0068860_100000310 3300005843 Bacteria 67162
65 Ga0068860_100001015 3300005843 Bacteria 31089
66 Ga0068860_100038260 3300005843 Bacteria 4589
67 Ga0068862_100001338 3300005844 Bacteria 22879
68 Ga0068862_100001526 3300005844 Bacteria 21211
69 Ga0068862_100009403 3300005844 Bacteria 8086
70 Ga0068862_100012637 3300005844 Bacteria 6988
71 Ga0068862_100045586 3300005844 Bacteria 3741
72 Ga0068862_100210431 3300005844 Bacteria 1757
73 Ga0075365_10155622 3300006038 Bacteria 1591
74 Ga0075362_10182394 3300006177 Bacteria 1017
75 Ga0075370_10174304 3300006353 Bacteria 1265
76 Ga0075370_10197654 3300006353 Bacteria 1186
77 Ga0068865_100002911 3300006881 Bacteria 10209
78 Ga0068865_101112377 3300006881 Bacteria 696
79 Ga0097620_100000671 3300006931 Bacteria 34266
80 Ga0097620_100016961 3300006931 Bacteria 7310
81 Ga0097620_100048344 3300006931 Bacteria 4274
82 Ga0097620_100857939 3300006931 Bacteria 994
83 Ga0079104_1022711 3300006946 Bacteria 1683
84 Ga0105250_10084577 3300009092 Bacteria 1288
85 Ga0105240_10007853 3300009093 Bacteria 15399
86 Ga0105240_10097019 3300009093 Bacteria 3591
87 Ga0105240_10810213 3300009093 Bacteria 1014
88 Ga0105245_10704908 3300009098 Bacteria 1043
89 Ga0105247_10259382 3300009101 Bacteria 1191
90 Ga0105241_10048308 3300009174 Bacteria 3238
91 Ga0105241_11741358 3300009174 Bacteria 607
92 Ga0105242_10374491 3300009176 Bacteria 1322
93 Ga0105248_10003631 3300009177 Bacteria 17121
94 Ga0105248_10016560 3300009177 Bacteria 8118
95 Ga0105248_10058394 3300009177 Bacteria 4333
96 Ga0105248_10360572 3300009177 Bacteria 1636
97 Ga0105248_10631706 3300009177 Bacteria 1208
98 Ga0105248_11481675 3300009177 Bacteria 768
99 Ga0105237_10346058 3300009545 Bacteria 1491
100 Ga0105238_10069366 3300009551 Bacteria 3525
101 Ga0105238_10131740 3300009551 Bacteria 2478
102 Ga0105249_10000792 3300009553 Bacteria 28363
103 Ga0105249_10355675 3300009553 Bacteria 1485
104 Ga0105249_11160133 3300009553 Bacteria 843
105 Ga0105239_10320980 3300010375 Bacteria 1746
106 Ga0105239_10679984 3300010375 Bacteria 1176
107 Ga0105239_11353239 3300010375 Bacteria 822
108 Ga0157370_10200938 3300013104 Bacteria 1849
109 Ga0157374_10261236 3300013296 Bacteria 1705
110 Ga0163162_10272195 3300013306 Bacteria 1825
111 Ga0163162_10351075 3300013306 Bacteria 1608
112 Ga0157372_10891657 3300013307 Bacteria 1032
113 Ga0157375_10025894 3300013308 Bacteria 5458
114 Ga0163163_10002745 3300014325 Bacteria 14860
115 Ga0163163_10043538 3300014325 Bacteria 4401
116 Ga0163163_10200590 3300014325 Bacteria 2043
117 Ga0163163_10204053 3300014325 Bacteria 2025
118 Ga0163163_10363884 3300014325 Bacteria 1503
119 Ga0163163_10481457 3300014325 Bacteria 1302
120 Ga0163163_11166411 3300014325 Bacteria 833
121 Ga0157380_10674857 3300014326 Bacteria 1034
122 Ga0157379_10001228 3300014968 Bacteria 20819
123 Ga0157379_10009298 3300014968 Bacteria 8559
124 Ga0157379_10399042 3300014968 Bacteria 1264
125 Ga0157376_10542260 3300014969 Bacteria 1150
126 Ga0213872_10008474 3300021361 Bacteria 4975
127 Ga0213876_10026457 3300021384 Bacteria 3059
128 Ga0209026_1000630 3300025250 Bacteria 22154
129 Ga0209148_1023844 3300025254 Bacteria 971
130 Ga0209455_1033697 3300025272 Bacteria 840
131 Ga0209758_1004816 3300025297 Bacteria 10893
132 Ga0209050_1000029 3300025298 Bacteria 465801
133 Ga0209257_1000152 3300025304 Bacteria 189432
134 Ga0209257_1000660 3300025304 Bacteria 54233
135 Ga0207697_10052370 3300025315 Bacteria 1689
136 Ga0207696_1049243 3300025711 Bacteria 1209
137 Ga0207680_10421066 3300025903 Bacteria 946
138 Ga0207645_10131853 3300025907 Bacteria 1627
139 Ga0207705_10001433 3300025909 Bacteria 19009
140 Ga0207705_10073533 3300025909 Bacteria 2480
141 Ga0207654_10075197 3300025911 Bacteria 2018
142 Ga0207707_10013897 3300025912 Bacteria 7020
143 Ga0207707_10199525 3300025912 Bacteria 1744
144 Ga0207695_10012791 3300025913 Bacteria 10048
145 Ga0207695_10012863 3300025913 Bacteria 10018
146 Ga0207695_10017928 3300025913 Bacteria 8199
147 Ga0207660_10012523 3300025917 Bacteria 5552
148 Ga0207660_10318386 3300025917 Bacteria 1242
149 Ga0207657_10004499 3300025919 Bacteria 14724
150 Ga0207652_10006581 3300025921 Bacteria 9367
151 Ga0207652_10280521 3300025921 Bacteria 1503
152 Ga0207681_10012022 3300025923 Bacteria 5332
153 Ga0207681_10378555 3300025923 Bacteria 1139
154 Ga0207694_10087908 3300025924 Bacteria 2449
155 Ga0207694_10141064 3300025924 Bacteria 1938
156 Ga0207650_10000175 3300025925 Bacteria 75521
157 Ga0207650_10027607 3300025925 Bacteria 4064
158 Ga0207650_10090668 3300025925 Bacteria 2335
159 Ga0207644_10045921 3300025931 Bacteria 3109
160 Ga0207644_10244806 3300025931 Bacteria 1429
161 Ga0207690_10000887 3300025932 Bacteria 19086
162 Ga0207690_10009780 3300025932 Bacteria 5699
163 Ga0207706_10059038 3300025933 Bacteria 3379
164 Ga0207704_10002139 3300025938 Bacteria 8861
165 Ga0207711_10000978 3300025941 Bacteria 27393
166 Ga0207711_10001642 3300025941 Bacteria 20636
167 Ga0207711_10003500 3300025941 Bacteria 13594
168 Ga0207711_10020019 3300025941 Bacteria 5576
169 Ga0207711_10096690 3300025941 Bacteria 2607
170 Ga0207679_10216063 3300025945 Bacteria 1611
171 Ga0207667_10006902 3300025949 Bacteria 13714
172 Ga0207667_10605778 3300025949 Bacteria 1104
173 Ga0207651_10081986 3300025960 Bacteria 2327
174 Ga0207712_10000376 3300025961 Bacteria 39304
175 Ga0207712_10257918 3300025961 Bacteria 1412
176 Ga0207668_10000001 3300025972 Bacteria 266091
177 Ga0207668_10000123 3300025972 Bacteria 54467
178 Ga0207668_10001064 3300025972 Bacteria 16380
179 Ga0207668_10005045 3300025972 Bacteria 7771
180 Ga0207668_10017158 3300025972 Bacteria 4531
181 Ga0207658_10000118 3300025986 Bacteria 87228
182 Ga0207658_10006171 3300025986 Bacteria 8181
183 Ga0207658_10009958 3300025986 Bacteria 6460
184 Ga0207677_10165499 3300026023 Bacteria 1723
185 Ga0207703_10000490 3300026035 Bacteria 41132
186 Ga0207703_10002421 3300026035 Bacteria 16199
187 Ga0207703_10002470 3300026035 Bacteria 16035
188 Ga0207703_11347883 3300026035 Bacteria 686
189 Ga0207639_10041879 3300026041 Bacteria 3430
190 Ga0207639_10396143 3300026041 Bacteria 1243
191 Ga0207678_10249991 3300026067 Bacteria 1518
192 Ga0207702_10048360 3300026078 Bacteria 3587
193 Ga0207702_10677177 3300026078 Bacteria 1016
194 Ga0207641_10000034 3300026088 Bacteria 217752
195 Ga0207641_10001419 3300026088 Bacteria 23630
196 Ga0207641_10007520 3300026088 Bacteria 9066
197 Ga0207641_10053054 3300026088 Bacteria 3435
198 Ga0207641_10133694 3300026088 Bacteria 2230
199 Ga0207641_10358047 3300026088 Bacteria 1392
200 Ga0207676_10000387 3300026095 Bacteria 37459
201 Ga0207676_10001782 3300026095 Bacteria 15788
202 Ga0207676_10021308 3300026095 Bacteria 4754
203 Ga0207674_10095688 3300026116 Bacteria 2955
204 Ga0207675_100037302 3300026118 Bacteria 4534
205 Ga0207675_100344140 3300026118 Bacteria 1460
206 Ga0207683_10149982 3300026121 Bacteria 2104
207 Ga0209981_1000550 3300027378 Bacteria 4780
208 Ga0209999_1000403 3300027543 Bacteria 6671
209 Ga0209813_10326708 3300027866 Bacteria 602
210 Ga0209974_10052229 3300027876 Bacteria 1375
211 Ga0268266_10000005 3300028379 Bacteria 1448194
212 Ga0268266_10001669 3300028379 Bacteria 25581
213 Ga0268266_10072971 3300028379 Bacteria 2977
214 Ga0268266_10395345 3300028379 Bacteria 1306
215 Ga0268265_10000901 3300028380 Bacteria 27588
216 Ga0268265_10002744 3300028380 Bacteria 12993
217 Ga0268265_10007451 3300028380 Bacteria 7391
218 Ga0268265_10008301 3300028380 Bacteria 7015
219 Ga0268265_10042495 3300028380 Bacteria 3374
220 Ga0268265_10051981 3300028380 Bacteria 3096
221 Ga0268264_10000055 3300028381 Bacteria 314947
222 Ga0268264_10000481 3300028381 Bacteria 53088
223 Ga0268264_10044625 3300028381 Bacteria 3677
224 Ga0268264_10066058 3300028381 Bacteria 3050
225 Ga0268264_11521039 3300028381 Bacteria 680
226 Ga0268264_11803070 3300028381 Bacteria 622
227 Ga0307517_10001099 3300028786 Bacteria 45677
228 Ga0307517_10235237 3300028786 Bacteria 1094
229 Ga0265324_10078086 3300029957 Bacteria 1126
230 Ga0307511_10066907 3300030521 Bacteria 2672
231 Ga0265327_10003115 3300031251 Bacteria 16344
232 Ga0265327_10003293 3300031251 Bacteria 15644
233 Ga0307513_10000348 3300031456 Bacteria 67217
234 Ga0307513_10001617 3300031456 Bacteria 32329
235 Ga0307509_10352971 3300031507 Bacteria 1193
236 Ga0307508_10450029 3300031616 Bacteria 880
237 Ga0265314_10013333 3300031711 Bacteria 6645
238 Ga0307516_10000020 3300031730 Bacteria 195931
239 Ga0307413_10450144 3300031824 Bacteria 1022
240 Ga0307510_10028390 3300033180 Bacteria 6391
241 Ga0307510_10256841 3300033180 Bacteria 1231
242 Ga0373944_0050005 3300035089 Bacteria 1315
243 Ga0373936_0027752 3300035113 Bacteria 2221
244 Ga0373943_0019984 3300035170 Bacteria 3085
245 Ga0373946_0021940 3300035171 Bacteria 2481
246 Ga0373935_0042738 3300035692 Bacteria 2851
247 Ga0373927_0000622 3300035695 Bacteria 26882
248 Ga0373947_0119760 3300035725 Bacteria 1671
249 Ga0373937_0307637 3300036401 Bacteria 1499
250 Ga0373925_0000067 3300037068 Bacteria 110348
251 Ga0373925_0107785 3300037068 Bacteria 2149
252 Ga0395899_0000095 3300037312 Bacteria 152790
253 Ga0395900_0000006 3300037418 Bacteria 495364
254 Ga0395898_0006778 3300037466 Bacteria 12192
255 Ga0395905_0003726 3300037471 Bacteria 16150
256 Ga0395905_1109319 3300037471 Bacteria 694
257 Ga0395905_1177580 3300037471 Bacteria 670
258 Ga0395901_0000001 3300038443 Bacteria 800383
259 Ga0436365_1393387 3300039437 Bacteria 883
260 Ga0436365_1528438 3300039437 Bacteria 1450
261 Ga0436361_0708487 3300039447 Bacteria 11844
262 Ga0439431_0017174 3300041997 Bacteria 1699
263 Ga0466961_0263889 3300044693 Bacteria 1056
264 Ga0495629_0026029 3300046459 Bacteria 4158
265 Ga0495584_0287935 3300046491 Bacteria 835
266 Ga0495583_0113733 3300046506 Bacteria 1145
267 Ga0495620_0055154 3300046515 Bacteria 1676
268 Ga0495620_0057390 3300046515 Bacteria 1634
269 Ga0495628_0793299 3300046516 Bacteria 663
270 Ga0495642_0028021 3300046528 Bacteria 2242
271 Ga0495642_0094931 3300046528 Bacteria 1265
272 Ga0495654_0082507 3300046530 Bacteria 1504
273 Ga0495609_0197037 3300046538 Bacteria 843
274 Ga0495597_0011879 3300046542 Bacteria 4214
275 Ga0495622_0011589 3300046557 Bacteria 4074
276 Ga0495668_0053532 3300046616 Bacteria 2231
277 Ga0495668_0181499 3300046616 Bacteria 1153
278 Ga0495611_0026265 3300046648 Bacteria 2540
279 Ga0495669_0000009 3300046684 Bacteria 165516
280 Ga0495669_0000330 3300046684 Bacteria 25496
281 Ga0495669_0035204 3300046684 Bacteria 2210
282 Ga0495636_0150241 3300047318 Bacteria 1045
283 Ga0495674_0338069 3300047319 Bacteria 1224
284 Ga0495672_0031736 3300047320 Bacteria 3296
285 Ga0495687_054529 3300047443 Bacteria 1677
286 Ga0495677_0007749 3300047445 Bacteria 4003
287 Ga0495681_0161935 3300047470 Bacteria 931
288 Ga0495686_0010010 3300047472 Bacteria 6774
289 Ga0495593_0067440 3300047673 Bacteria 1863
290 Ga0496100_0640503 3300048903 Bacteria 827
291 Ga0496100_0824692 3300048903 Bacteria 727
292 Ga0496101_0470219 3300048904 Bacteria 992
293 Ga0496101_1149677 3300048904 Bacteria 609
294 Ga0496102_0085788 3300048905 Bacteria 2908
295 Ga0496102_0162701 3300048905 Bacteria 2099
296 Ga0496105_0951980 3300048908 Bacteria 645
297 Ga0496106_0079112 3300048909 Bacteria 2524
298 Ga0496106_0584623 3300048909 Bacteria 895
299 Ga0496107_0616660 3300048910 Bacteria 801
300 Ga0496109_0039953 3300048912 Bacteria 4248
301 Ga0496112_0072726 3300048915 Bacteria 3399
302 Ga0496112_0087743 3300048915 Bacteria 3078
303 Ga0496113_0258062 3300048916 Bacteria 1392
304 Ga0496115_0002816 3300048918 Bacteria 12500
305 Ga0496115_0013492 3300048918 Bacteria 6182
306 Ga0496115_0131937 3300048918 Bacteria 2059
307 Ga0496116_0034606 3300048919 Bacteria 3562
308 Ga0496117_0017711 3300048920 Bacteria 5941
309 Ga0496118_0063826 3300048921 Bacteria 2707
310 Ga0496119_0069079 3300048922 Bacteria 2077
311 Ga0496121_0001066 3300048924 Bacteria 48544
312 Ga0501047_0257481 3300049581 Bacteria 1593
313 Ga0501048_0093475 3300049582 Bacteria 2121
314 nmdc:mga03683_161570_c1 3300050489 Bacteria 1015
315 Ga0500635_0000045 3300053080 Bacteria 87314
316 Ga0500578_0350891 3300053086 Bacteria 862
317 Ga0500643_029903 3300053087 Bacteria 1673
318 Ga0500583_0253462 3300053092 Bacteria 868
319 Ga0500651_0354424 3300053093 Bacteria 832
320 Ga0500641_0058514 3300053096 Bacteria 1601
321 Ga0500554_105414 3300053102 Bacteria 945
322 Ga0500556_0002193 3300053104 Bacteria 6559
323 Ga0500562_000461 3300053108 Bacteria 9854
324 Ga0500562_003227 3300053108 Bacteria 4073
325 Ga0500595_015123 3300053119 Bacteria 2901
326 Ga0500595_028290 3300053119 Bacteria 1912
327 Ga0500597_135115 3300053120 Bacteria 1064
328 Ga0500608_007229 3300053122 Bacteria 4579
329 Ga0500614_006968 3300053123 Bacteria 2376
330 Ga0500642_0019404 3300053130 Bacteria 2651
331 Ga0500642_0064671 3300053130 Bacteria 1651
332 Ga0500559_0067623 3300053136 Bacteria 1604
333 Ga0500590_126035 3300053148 Bacteria 1192
334 Ga0500619_011121 3300053154 Bacteria 2302
335 Ga0500638_188552 3300053162 Bacteria 883
336 Ga0500596_014760 3300053735 Bacteria 1173

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100337804 Ga0068853_1003378043 170
2 3300009551 Ga0105238_10069366 Ga0105238_100693661 170
3 3300025924 Ga0207694_10141064 Ga0207694_101410643 170
4 3300026067 Ga0207678_10249991 Ga0207678_102499911 170
5 3300037312 Ga0395899_0000095 Ga0395899_0000095_84638_85150 170
6 3300037418 Ga0395900_0000006 Ga0395900_0000006_310122_310634 170
7 3300037466 Ga0395898_0006778 Ga0395898_0006778_7104_7616 170
8 3300037471 Ga0395905_0003726 Ga0395905_0003726_2238_2750 170
9 3300038443 Ga0395901_0000001 Ga0395901_0000001_353370_353882 170
10 3300046516 Ga0495628_0793299 Ga0495628_0793299_132_644 170
11 3300047319 Ga0495674_0338069 Ga0495674_0338069_394_906 170
12 3300005844 Ga0068862_100210431 Ga0068862_1002104312 171
13 3300006353 Ga0075370_10197654 Ga0075370_101976542 171
14 3300025250 Ga0209026_1000630 Ga0209026_100063010 171
15 3300028380 Ga0268265_10042495 Ga0268265_100424953 171
16 3300028381 Ga0268264_11521039 Ga0268264_115210391 171
17 3300031456 Ga0307513_10000348 Ga0307513_1000034842 171
18 3300031507 Ga0307509_10352971 Ga0307509_103529711 171
19 3300036401 Ga0373937_0307637 Ga0373937_0307637_753_1268 171
20 3300053108 Ga0500562_000461 Ga0500562_000461_2226_2741 171
21 3300003794 Ga0055531_10002236 Ga0055531_100022365 172
22 3300004625 Ga0055543_1004653 Ga0055543_10046532 172
23 3300005262 Ga0065165_1000413 Ga0065165_100041333 172
24 3300005327 Ga0070658_10089227 Ga0070658_100892272 172
25 3300005327 Ga0070658_10106627 Ga0070658_101066272 172
26 3300005327 Ga0070658_10407239 Ga0070658_104072392 172
27 3300005331 Ga0070670_100039654 Ga0070670_1000396542 172
28 3300005331 Ga0070670_100689836 Ga0070670_1006898362 172
29 3300005335 Ga0070666_10586711 Ga0070666_105867111 172
30 3300005336 Ga0070680_100005224 Ga0070680_1000052245 172
31 3300005344 Ga0070661_100259260 Ga0070661_1002592601 172
32 3300005347 Ga0070668_100000108 Ga0070668_10000010844 172
33 3300005347 Ga0070668_100001042 Ga0070668_10000104214 172
34 3300005347 Ga0070668_100009534 Ga0070668_1000095345 172
35 3300005353 Ga0070669_100525948 Ga0070669_1005259482 172
36 3300005355 Ga0070671_100001712 Ga0070671_10000171223 172
37 3300005355 Ga0070671_100108420 Ga0070671_1001084202 172
38 3300005364 Ga0070673_100012513 Ga0070673_1000125133 172
39 3300005366 Ga0070659_100002556 Ga0070659_10000255615 172
40 3300005366 Ga0070659_101125292 Ga0070659_1011252921 172
41 3300005367 Ga0070667_100000163 Ga0070667_10000016349 172
42 3300005367 Ga0070667_100004064 Ga0070667_1000040644 172
43 3300005367 Ga0070667_100106981 Ga0070667_1001069813 172
44 3300005367 Ga0070667_101539401 Ga0070667_1015394011 172
45 3300005457 Ga0070662_100176256 Ga0070662_1001762562 172
46 3300005458 Ga0070681_10001166 Ga0070681_100011669 172
47 3300005458 Ga0070681_10090387 Ga0070681_100903873 172
48 3300005530 Ga0070679_100016541 Ga0070679_1000165416 172
49 3300005530 Ga0070679_100558835 Ga0070679_1005588351 172
50 3300005530 Ga0070679_100584384 Ga0070679_1005843841 172
51 3300005548 Ga0070665_100000015 Ga0070665_100000015398 172
52 3300005548 Ga0070665_100001115 Ga0070665_10000111516 172
53 3300005548 Ga0070665_100033530 Ga0070665_1000335304 172
54 3300005548 Ga0070665_100043987 Ga0070665_1000439874 172
55 3300005548 Ga0070665_100442057 Ga0070665_1004420572 172
56 3300005563 Ga0068855_100157199 Ga0068855_1001571994 172
57 3300005563 Ga0068855_100162184 Ga0068855_1001621843 172
58 3300005564 Ga0070664_100601630 Ga0070664_1006016302 172
59 3300005577 Ga0068857_101041460 Ga0068857_1010414601 172
60 3300005578 Ga0068854_101155844 Ga0068854_1011558441 172
61 3300005614 Ga0068856_100144367 Ga0068856_1001443672 172
62 3300005614 Ga0068856_100749258 Ga0068856_1007492582 172
63 3300005616 Ga0068852_100200384 Ga0068852_1002003843 172
64 3300005617 Ga0068859_100000671 Ga0068859_10000067125 172
65 3300005617 Ga0068859_100016961 Ga0068859_1000169614 172
66 3300005617 Ga0068859_100048343 Ga0068859_1000483436 172
67 3300005617 Ga0068859_100858072 Ga0068859_1008580721 172
68 3300005618 Ga0068864_100000071 Ga0068864_10000007120 172
69 3300005618 Ga0068864_100000400 Ga0068864_1000004004 172
70 3300005618 Ga0068864_100015552 Ga0068864_1000155522 172
71 3300005719 Ga0068861_100039322 Ga0068861_1000393223 172
72 3300005719 Ga0068861_100288069 Ga0068861_1002880692 172
73 3300005841 Ga0068863_100000037 Ga0068863_10000003793 172
74 3300005841 Ga0068863_100000451 Ga0068863_10000045128 172
75 3300005841 Ga0068863_100010651 Ga0068863_1000106514 172
76 3300005841 Ga0068863_100064702 Ga0068863_1000647026 172
77 3300005841 Ga0068863_100110186 Ga0068863_1001101862 172
78 3300005841 Ga0068863_100303289 Ga0068863_1003032892 172
79 3300005842 Ga0068858_100000029 Ga0068858_10000002952 172
80 3300005842 Ga0068858_100002275 Ga0068858_1000022755 172
81 3300005842 Ga0068858_100006867 Ga0068858_10000686711 172
82 3300005842 Ga0068858_100500569 Ga0068858_1005005692 172
83 3300005843 Ga0068860_100000310 Ga0068860_10000031070 172
84 3300005843 Ga0068860_100001015 Ga0068860_10000101510 172
85 3300005843 Ga0068860_100038260 Ga0068860_1000382602 172
86 3300005844 Ga0068862_100001338 Ga0068862_10000133815 172
87 3300005844 Ga0068862_100001526 Ga0068862_10000152617 172
88 3300005844 Ga0068862_100009403 Ga0068862_1000094032 172
89 3300005844 Ga0068862_100012637 Ga0068862_1000126377 172
90 3300005844 Ga0068862_100045586 Ga0068862_1000455862 172
91 3300006038 Ga0075365_10155622 Ga0075365_101556222 172
92 3300006177 Ga0075362_10182394 Ga0075362_101823941 172
93 3300006353 Ga0075370_10174304 Ga0075370_101743042 172
94 3300006881 Ga0068865_100002911 Ga0068865_10000291110 172
95 3300006881 Ga0068865_101112377 Ga0068865_1011123771 172
96 3300006931 Ga0097620_100000671 Ga0097620_10000067125 172
97 3300006931 Ga0097620_100016961 Ga0097620_1000169614 172
98 3300006931 Ga0097620_100048344 Ga0097620_1000483446 172
99 3300006931 Ga0097620_100857939 Ga0097620_1008579391 172
100 3300006946 Ga0079104_1022711 Ga0079104_10227111 172
101 3300009092 Ga0105250_10084577 Ga0105250_100845772 172
102 3300009093 Ga0105240_10007853 Ga0105240_100078534 172
103 3300009093 Ga0105240_10097019 Ga0105240_100970194 172
104 3300009093 Ga0105240_10810213 Ga0105240_108102131 172
105 3300009098 Ga0105245_10704908 Ga0105245_107049081 172
106 3300009101 Ga0105247_10259382 Ga0105247_102593821 172
107 3300009174 Ga0105241_10048308 Ga0105241_100483086 172
108 3300009174 Ga0105241_11741358 Ga0105241_117413581 172
109 3300009176 Ga0105242_10374491 Ga0105242_103744912 172
110 3300009177 Ga0105248_10003631 Ga0105248_100036314 172
111 3300009177 Ga0105248_10016560 Ga0105248_100165608 172
112 3300009177 Ga0105248_10058394 Ga0105248_100583945 172
113 3300009177 Ga0105248_10360572 Ga0105248_103605722 172
114 3300009177 Ga0105248_10631706 Ga0105248_106317062 172
115 3300009177 Ga0105248_11481675 Ga0105248_114816752 172
116 3300009545 Ga0105237_10346058 Ga0105237_103460582 172
117 3300009551 Ga0105238_10131740 Ga0105238_101317401 172
118 3300009553 Ga0105249_10000792 Ga0105249_1000079213 172
119 3300009553 Ga0105249_10355675 Ga0105249_103556751 172
120 3300009553 Ga0105249_11160133 Ga0105249_111601332 172
121 3300010375 Ga0105239_10320980 Ga0105239_103209802 172
122 3300010375 Ga0105239_10679984 Ga0105239_106799842 172
123 3300010375 Ga0105239_11353239 Ga0105239_113532392 172
124 3300013104 Ga0157370_10200938 Ga0157370_102009382 172
125 3300013296 Ga0157374_10261236 Ga0157374_102612362 172
126 3300013306 Ga0163162_10272195 Ga0163162_102721952 172
127 3300013306 Ga0163162_10351075 Ga0163162_103510751 172
128 3300013307 Ga0157372_10891657 Ga0157372_108916572 172
129 3300013308 Ga0157375_10025894 Ga0157375_100258943 172
130 3300014325 Ga0163163_10002745 Ga0163163_1000274511 172
131 3300014325 Ga0163163_10043538 Ga0163163_100435386 172
132 3300014325 Ga0163163_10200590 Ga0163163_102005903 172
133 3300014325 Ga0163163_10204053 Ga0163163_102040532 172
134 3300014325 Ga0163163_10363884 Ga0163163_103638843 172
135 3300014325 Ga0163163_10481457 Ga0163163_104814572 172
136 3300014325 Ga0163163_11166411 Ga0163163_111664112 172
137 3300014326 Ga0157380_10674857 Ga0157380_106748572 172
138 3300014968 Ga0157379_10001228 Ga0157379_100012283 172
139 3300014968 Ga0157379_10009298 Ga0157379_100092986 172
140 3300014968 Ga0157379_10399042 Ga0157379_103990421 172
141 3300014969 Ga0157376_10542260 Ga0157376_105422602 172
142 3300021361 Ga0213872_10008474 Ga0213872_100084742 172
143 3300021384 Ga0213876_10026457 Ga0213876_100264575 172
144 3300025254 Ga0209148_1023844 Ga0209148_10238442 172
145 3300025272 Ga0209455_1033697 Ga0209455_10336972 172
146 3300025297 Ga0209758_1004816 Ga0209758_100481612 172
147 3300025298 Ga0209050_1000029 Ga0209050_1000029152 172
148 3300025304 Ga0209257_1000152 Ga0209257_1000152164 172
149 3300025304 Ga0209257_1000660 Ga0209257_100066033 172
150 3300025315 Ga0207697_10052370 Ga0207697_100523703 172
151 3300025711 Ga0207696_1049243 Ga0207696_10492432 172
152 3300025903 Ga0207680_10421066 Ga0207680_104210661 172
153 3300025907 Ga0207645_10131853 Ga0207645_101318532 172
154 3300025909 Ga0207705_10001433 Ga0207705_1000143310 172
155 3300025909 Ga0207705_10073533 Ga0207705_100735332 172
156 3300025911 Ga0207654_10075197 Ga0207654_100751972 172
157 3300025912 Ga0207707_10013897 Ga0207707_100138971 172
158 3300025912 Ga0207707_10199525 Ga0207707_101995252 172
159 3300025913 Ga0207695_10012791 Ga0207695_100127916 172
160 3300025913 Ga0207695_10012863 Ga0207695_100128638 172
161 3300025913 Ga0207695_10017928 Ga0207695_100179284 172
162 3300025917 Ga0207660_10012523 Ga0207660_100125234 172
163 3300025917 Ga0207660_10318386 Ga0207660_103183861 172
164 3300025919 Ga0207657_10004499 Ga0207657_100044996 172
165 3300025921 Ga0207652_10006581 Ga0207652_100065814 172
166 3300025921 Ga0207652_10280521 Ga0207652_102805212 172
167 3300025923 Ga0207681_10012022 Ga0207681_100120222 172
168 3300025923 Ga0207681_10378555 Ga0207681_103785552 172
169 3300025924 Ga0207694_10087908 Ga0207694_100879082 172
170 3300025925 Ga0207650_10000175 Ga0207650_1000017548 172
171 3300025925 Ga0207650_10027607 Ga0207650_100276075 172
172 3300025925 Ga0207650_10090668 Ga0207650_100906682 172
173 3300025931 Ga0207644_10045921 Ga0207644_100459214 172
174 3300025931 Ga0207644_10244806 Ga0207644_102448062 172
175 3300025932 Ga0207690_10000887 Ga0207690_1000088719 172
176 3300025932 Ga0207690_10009780 Ga0207690_100097802 172
177 3300025933 Ga0207706_10059038 Ga0207706_100590382 172
178 3300025938 Ga0207704_10002139 Ga0207704_100021396 172
179 3300025941 Ga0207711_10000978 Ga0207711_1000097812 172
180 3300025941 Ga0207711_10001642 Ga0207711_1000164218 172
181 3300025941 Ga0207711_10003500 Ga0207711_100035002 172
182 3300025941 Ga0207711_10020019 Ga0207711_100200197 172
183 3300025941 Ga0207711_10096690 Ga0207711_100966902 172
184 3300025945 Ga0207679_10216063 Ga0207679_102160632 172
185 3300025949 Ga0207667_10006902 Ga0207667_100069024 172
186 3300025949 Ga0207667_10605778 Ga0207667_106057781 172
187 3300025960 Ga0207651_10081986 Ga0207651_100819862 172
188 3300025961 Ga0207712_10000376 Ga0207712_1000037627 172
189 3300025961 Ga0207712_10257918 Ga0207712_102579183 172
190 3300025972 Ga0207668_10000001 Ga0207668_10000001215 172
191 3300025972 Ga0207668_10000123 Ga0207668_1000012334 172
192 3300025972 Ga0207668_10001064 Ga0207668_100010648 172
193 3300025972 Ga0207668_10005045 Ga0207668_100050455 172
194 3300025972 Ga0207668_10017158 Ga0207668_100171587 172
195 3300025986 Ga0207658_10000118 Ga0207658_1000011863 172
196 3300025986 Ga0207658_10006171 Ga0207658_100061714 172
197 3300025986 Ga0207658_10009958 Ga0207658_100099582 172
198 3300026023 Ga0207677_10165499 Ga0207677_101654992 172
199 3300026035 Ga0207703_10000490 Ga0207703_100004902 172
200 3300026035 Ga0207703_10002421 Ga0207703_100024219 172
201 3300026035 Ga0207703_10002470 Ga0207703_100024705 172
202 3300026035 Ga0207703_11347883 Ga0207703_113478831 172
203 3300026041 Ga0207639_10041879 Ga0207639_100418793 172
204 3300026041 Ga0207639_10396143 Ga0207639_103961431 172
205 3300026078 Ga0207702_10048360 Ga0207702_100483602 172
206 3300026078 Ga0207702_10677177 Ga0207702_106771772 172
207 3300026088 Ga0207641_10000034 Ga0207641_10000034107 172
208 3300026088 Ga0207641_10001419 Ga0207641_100014198 172
209 3300026088 Ga0207641_10007520 Ga0207641_100075204 172
210 3300026088 Ga0207641_10053054 Ga0207641_100530546 172
211 3300026088 Ga0207641_10133694 Ga0207641_101336942 172
212 3300026088 Ga0207641_10358047 Ga0207641_103580472 172
213 3300026095 Ga0207676_10000387 Ga0207676_100003874 172
214 3300026095 Ga0207676_10001782 Ga0207676_1000178219 172
215 3300026095 Ga0207676_10021308 Ga0207676_100213082 172
216 3300026116 Ga0207674_10095688 Ga0207674_100956883 172
217 3300026118 Ga0207675_100037302 Ga0207675_1000373023 172
218 3300026118 Ga0207675_100344140 Ga0207675_1003441402 172
219 3300026121 Ga0207683_10149982 Ga0207683_101499823 172
220 3300027378 Ga0209981_1000550 Ga0209981_10005502 172
221 3300027543 Ga0209999_1000403 Ga0209999_10004034 172
222 3300027866 Ga0209813_10326708 Ga0209813_103267081 172
223 3300027876 Ga0209974_10052229 Ga0209974_100522291 172
224 3300028379 Ga0268266_10000005 Ga0268266_10000005720 172
225 3300028379 Ga0268266_10001669 Ga0268266_100016698 172
226 3300028379 Ga0268266_10072971 Ga0268266_100729715 172
227 3300028379 Ga0268266_10395345 Ga0268266_103953452 172
228 3300028380 Ga0268265_10000901 Ga0268265_1000090111 172
229 3300028380 Ga0268265_10002744 Ga0268265_1000274410 172
230 3300028380 Ga0268265_10007451 Ga0268265_100074514 172
231 3300028380 Ga0268265_10008301 Ga0268265_100083017 172
232 3300028380 Ga0268265_10051981 Ga0268265_100519812 172
233 3300028381 Ga0268264_10000055 Ga0268264_1000005533 172
234 3300028381 Ga0268264_10000481 Ga0268264_1000048111 172
235 3300028381 Ga0268264_10044625 Ga0268264_100446254 172
236 3300028381 Ga0268264_10066058 Ga0268264_100660584 172
237 3300028381 Ga0268264_11803070 Ga0268264_118030701 172
238 3300028786 Ga0307517_10001099 Ga0307517_1000109943 172
239 3300028786 Ga0307517_10235237 Ga0307517_102352372 172
240 3300029957 Ga0265324_10078086 Ga0265324_100780862 172
241 3300030521 Ga0307511_10066907 Ga0307511_100669073 172
242 3300031251 Ga0265327_10003115 Ga0265327_1000311516 172
243 3300031251 Ga0265327_10003293 Ga0265327_100032938 172
244 3300031456 Ga0307513_10001617 Ga0307513_1000161719 172
245 3300031616 Ga0307508_10450029 Ga0307508_104500292 172
246 3300031711 Ga0265314_10013333 Ga0265314_100133338 172
247 3300031730 Ga0307516_10000020 Ga0307516_1000002098 172
248 3300031824 Ga0307413_10450144 Ga0307413_104501441 172
249 3300033180 Ga0307510_10028390 Ga0307510_100283904 172
250 3300033180 Ga0307510_10256841 Ga0307510_102568412 172
251 3300035089 Ga0373944_0050005 Ga0373944_0050005_352_870 172
252 3300035113 Ga0373936_0027752 Ga0373936_0027752_1608_2126 172
253 3300035170 Ga0373943_0019984 Ga0373943_0019984_2091_2609 172
254 3300035171 Ga0373946_0021940 Ga0373946_0021940_97_615 172
255 3300035692 Ga0373935_0042738 Ga0373935_0042738_2222_2740 172
256 3300035695 Ga0373927_0000622 Ga0373927_0000622_11490_12008 172
257 3300035725 Ga0373947_0119760 Ga0373947_0119760_497_1015 172
258 3300037068 Ga0373925_0000067 Ga0373925_0000067_27327_27845 172
259 3300037068 Ga0373925_0107785 Ga0373925_0107785_602_1120 172
260 3300037471 Ga0395905_1109319 Ga0395905_1109319_40_558 172
261 3300037471 Ga0395905_1177580 Ga0395905_1177580_128_646 172
262 3300039437 Ga0436365_1393387 Ga0436365_1393387_337_855 172
263 3300039437 Ga0436365_1528438 Ga0436365_1528438_391_909 172
264 3300039447 Ga0436361_0708487 Ga0436361_0708487_5919_6440 172
265 3300041997 Ga0439431_0017174 Ga0439431_0017174_226_744 172
266 3300044693 Ga0466961_0263889 Ga0466961_0263889_165_683 172
267 3300046459 Ga0495629_0026029 Ga0495629_0026029_887_1405 172
268 3300046491 Ga0495584_0287935 Ga0495584_0287935_249_767 172
269 3300046506 Ga0495583_0113733 Ga0495583_0113733_259_777 172
270 3300046515 Ga0495620_0055154 Ga0495620_0055154_613_1131 172
271 3300046515 Ga0495620_0057390 Ga0495620_0057390_720_1238 172
272 3300046528 Ga0495642_0028021 Ga0495642_0028021_703_1221 172
273 3300046528 Ga0495642_0094931 Ga0495642_0094931_85_603 172
274 3300046530 Ga0495654_0082507 Ga0495654_0082507_91_609 172
275 3300046538 Ga0495609_0197037 Ga0495609_0197037_53_571 172
276 3300046542 Ga0495597_0011879 Ga0495597_0011879_1790_2308 172
277 3300046557 Ga0495622_0011589 Ga0495622_0011589_157_675 172
278 3300046616 Ga0495668_0053532 Ga0495668_0053532_899_1417 172
279 3300046616 Ga0495668_0181499 Ga0495668_0181499_167_685 172
280 3300046648 Ga0495611_0026265 Ga0495611_0026265_55_573 172
281 3300046684 Ga0495669_0000009 Ga0495669_0000009_17873_18391 172
282 3300046684 Ga0495669_0000330 Ga0495669_0000330_21451_21990 172
283 3300046684 Ga0495669_0035204 Ga0495669_0035204_1073_1591 172
284 3300047318 Ga0495636_0150241 Ga0495636_0150241_372_890 172
285 3300047320 Ga0495672_0031736 Ga0495672_0031736_2172_2690 172
286 3300047443 Ga0495687_054529 Ga0495687_054529_615_1133 172
287 3300047445 Ga0495677_0007749 Ga0495677_0007749_1203_1721 172
288 3300047470 Ga0495681_0161935 Ga0495681_0161935_257_775 172
289 3300047472 Ga0495686_0010010 Ga0495686_0010010_3420_3938 172
290 3300047673 Ga0495593_0067440 Ga0495593_0067440_412_930 172
291 3300048903 Ga0496100_0640503 Ga0496100_0640503_97_615 172
292 3300048903 Ga0496100_0824692 Ga0496100_0824692_100_618 172
293 3300048904 Ga0496101_0470219 Ga0496101_0470219_187_705 172
294 3300048904 Ga0496101_1149677 Ga0496101_1149677_69_587 172
295 3300048905 Ga0496102_0085788 Ga0496102_0085788_564_1082 172
296 3300048905 Ga0496102_0162701 Ga0496102_0162701_1270_1788 172
297 3300048908 Ga0496105_0951980 Ga0496105_0951980_67_585 172
298 3300048909 Ga0496106_0079112 Ga0496106_0079112_546_1064 172
299 3300048909 Ga0496106_0584623 Ga0496106_0584623_276_794 172
300 3300048910 Ga0496107_0616660 Ga0496107_0616660_101_619 172
301 3300048912 Ga0496109_0039953 Ga0496109_0039953_3385_3903 172
302 3300048915 Ga0496112_0072726 Ga0496112_0072726_1252_1770 172
303 3300048915 Ga0496112_0087743 Ga0496112_0087743_1258_1776 172
304 3300048916 Ga0496113_0258062 Ga0496113_0258062_555_1073 172
305 3300048918 Ga0496115_0002816 Ga0496115_0002816_1991_2509 172
306 3300048918 Ga0496115_0013492 Ga0496115_0013492_2782_3303 172
307 3300048918 Ga0496115_0131937 Ga0496115_0131937_147_665 172
308 3300048919 Ga0496116_0034606 Ga0496116_0034606_423_941 172
309 3300048920 Ga0496117_0017711 Ga0496117_0017711_1538_2056 172
310 3300048921 Ga0496118_0063826 Ga0496118_0063826_1816_2334 172
311 3300048922 Ga0496119_0069079 Ga0496119_0069079_324_842 172
312 3300048924 Ga0496121_0001066 Ga0496121_0001066_264_782 172
313 3300049581 Ga0501047_0257481 Ga0501047_0257481_361_879 172
314 3300049582 Ga0501048_0093475 Ga0501048_0093475_166_684 172
315 3300050489 nmdc:mga03683_161570_c1 nmdc:mga03683_161570_c1_387_908 172
316 3300053080 Ga0500635_0000045 Ga0500635_0000045_84919_85437 172
317 3300053086 Ga0500578_0350891 Ga0500578_0350891_68_586 172
318 3300053087 Ga0500643_029903 Ga0500643_029903_429_959 172
319 3300053092 Ga0500583_0253462 Ga0500583_0253462_127_645 172
320 3300053093 Ga0500651_0354424 Ga0500651_0354424_43_561 172
321 3300053096 Ga0500641_0058514 Ga0500641_0058514_522_1040 172
322 3300053102 Ga0500554_105414 Ga0500554_105414_50_568 172
323 3300053104 Ga0500556_0002193 Ga0500556_0002193_6008_6526 172
324 3300053108 Ga0500562_003227 Ga0500562_003227_2298_2816 172
325 3300053119 Ga0500595_015123 Ga0500595_015123_1787_2305 172
326 3300053119 Ga0500595_028290 Ga0500595_028290_940_1458 172
327 3300053120 Ga0500597_135115 Ga0500597_135115_58_576 172
328 3300053122 Ga0500608_007229 Ga0500608_007229_1785_2303 172
329 3300053123 Ga0500614_006968 Ga0500614_006968_1766_2284 172
330 3300053130 Ga0500642_0019404 Ga0500642_0019404_732_1250 172
331 3300053130 Ga0500642_0064671 Ga0500642_0064671_908_1426 172
332 3300053136 Ga0500559_0067623 Ga0500559_0067623_925_1443 172
333 3300053148 Ga0500590_126035 Ga0500590_126035_507_1025 172
334 3300053154 Ga0500619_011121 Ga0500619_011121_1743_2261 172
335 3300053162 Ga0500638_188552 Ga0500638_188552_141_659 172
336 3300053735 Ga0500596_014760 Ga0500596_014760_642_1160 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

10

141

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg4-assembly1.cif.gz_A x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim 0.843 5 172
6xg4-assembly1.cif.gz_A x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim 0.838 5 172
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.8357 5 172
3fl8-assembly8.cif.gz_H crystal structure of b. anthracis dihydrofolate reductase (dhfr) with rab1, a tmp-dihydrophthalazine derivative 0.8331 5 172
4p66-assembly1.cif.gz_A electrostatics of active site microenvironments of e. coli dhfr 0.8306 5 172
ID Description Score Start End Superfamily
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8309 5 172 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8151 5 172 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.81 5 172 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8036 4 171 3.40.430.10
4m7vA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8026 3 171 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4Q3TM16-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.965 81 172 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A4Q3TM16-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.955 81 172 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A2D7P4P2-F1-model_v4 deleted 0.8863 69 171
AF-A0A328AU70-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.8622 1 172 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A6L8A8Z1-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.8614 5 172 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Feature Viewer

pLDDT pTM Quality
89.92 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map