F412502
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 336 | 209 | 313 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300002067|JGI24735J21928_10010955|JGI24735J21928_100109553 |
| Length | 142 |
| Sequence | MSIFGAMNTSGTGMSTMRSWLDVLANNIANVNTVRPTSQNAFQASYVEVSEIKGDSSAAPGDAAGHGVEITTLRQGSAEGRLTYQPDNPLADKKGYVRLPDVDLGEQMGNLIMAQRGFQANAAVIDRARTVYEAAINIGKNH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 2 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 3 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 4 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 5 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 6 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 7 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 8 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 9 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 10 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 11 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 12 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 13 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 14 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 15 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 16 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 17 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 18 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 19 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 20 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 21 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 22 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 23 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 24 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 25 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 98 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 100 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 103 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 104 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 124 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 130 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 131 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 132 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 133 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 138 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 139 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 140 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 141 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 142 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 146 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 147 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 148 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 149 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 177 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 178 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 179 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 184 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 185 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 191 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 203 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 206 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 207 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 208 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.07 |
| Metatranscriptomes | 2.08 |
| Isolates | 6.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.6 |
| Bulb | 0 |
| Endosphere | 2.08 |
| Nodule | 0 |
| Rhizoplane | 9.52 |
| Rhizosphere | 74.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10010955 | 3300002067 | Bacteria | 2881 |
| 2 | JGI25406J46586_10001287 | 3300003203 | Bacteria | 11799 |
| 3 | rootH2_10187235 | 3300003320 | Bacteria | 4914 |
| 4 | Ga0070658_10000157 | 3300005327 | Bacteria | 60238 |
| 5 | Ga0070658_10005852 | 3300005327 | Bacteria | 9970 |
| 6 | Ga0070658_10099740 | 3300005327 | Bacteria | 2400 |
| 7 | Ga0070658_10318537 | 3300005327 | Bacteria | 1328 |
| 8 | Ga0070658_10511259 | 3300005327 | Bacteria | 1038 |
| 9 | Ga0070658_10828287 | 3300005327 | Unclassified | 804 |
| 10 | Ga0070658_10965774 | 3300005327 | Bacteria | 741 |
| 11 | Ga0070683_100018404 | 3300005329 | Bacteria | 6187 |
| 12 | Ga0070683_100657940 | 3300005329 | Bacteria | 1003 |
| 13 | Ga0070680_100000038 | 3300005336 | Bacteria | 66468 |
| 14 | Ga0070680_100181911 | 3300005336 | Bacteria | 1770 |
| 15 | Ga0070680_100698287 | 3300005336 | Bacteria | 873 |
| 16 | Ga0070682_100061465 | 3300005337 | Bacteria | 2377 |
| 17 | Ga0070682_100436139 | 3300005337 | Bacteria | 1000 |
| 18 | Ga0068868_100438469 | 3300005338 | Bacteria | 1134 |
| 19 | Ga0070659_100646178 | 3300005366 | Bacteria | 912 |
| 20 | Ga0070667_100455687 | 3300005367 | Bacteria | 1169 |
| 21 | Ga0070714_100000116 | 3300005435 | Bacteria | 64800 |
| 22 | Ga0070714_100002504 | 3300005435 | Bacteria | 13550 |
| 23 | Ga0070714_100441702 | 3300005435 | Bacteria | 1235 |
| 24 | Ga0070711_100759469 | 3300005439 | Bacteria | 820 |
| 25 | Ga0070663_100302412 | 3300005455 | Bacteria | 1281 |
| 26 | Ga0070663_101562338 | 3300005455 | Bacteria | 588 |
| 27 | Ga0070662_100665005 | 3300005457 | Bacteria | 879 |
| 28 | Ga0070681_10000106 | 3300005458 | Bacteria | 62398 |
| 29 | Ga0070681_10304195 | 3300005458 | Bacteria | 1504 |
| 30 | Ga0070681_11749666 | 3300005458 | Bacteria | 548 |
| 31 | Ga0070685_10201729 | 3300005466 | Bacteria | 1293 |
| 32 | Ga0070679_100000026 | 3300005530 | Bacteria | 115669 |
| 33 | Ga0070679_100147226 | 3300005530 | Bacteria | 2332 |
| 34 | Ga0070679_100651790 | 3300005530 | Bacteria | 996 |
| 35 | Ga0070684_100201079 | 3300005535 | Bacteria | 1815 |
| 36 | Ga0070684_100424702 | 3300005535 | Bacteria | 1227 |
| 37 | Ga0068855_100092706 | 3300005563 | Bacteria | 3483 |
| 38 | Ga0068855_101399768 | 3300005563 | Bacteria | 721 |
| 39 | Ga0068855_101932388 | 3300005563 | Bacteria | 597 |
| 40 | Ga0070664_101421256 | 3300005564 | Bacteria | 656 |
| 41 | Ga0068857_102528355 | 3300005577 | Bacteria | 504 |
| 42 | Ga0068854_100124726 | 3300005578 | Bacteria | 1960 |
| 43 | Ga0068856_100041209 | 3300005614 | Bacteria | 4537 |
| 44 | Ga0068856_100229956 | 3300005614 | Bacteria | 1870 |
| 45 | Ga0068856_100681977 | 3300005614 | Bacteria | 1048 |
| 46 | Ga0068852_100348227 | 3300005616 | Bacteria | 1446 |
| 47 | Ga0068852_100474110 | 3300005616 | Bacteria | 1243 |
| 48 | Ga0068852_100947171 | 3300005616 | Bacteria | 879 |
| 49 | Ga0068859_100030443 | 3300005617 | Bacteria | 5416 |
| 50 | Ga0068864_100426957 | 3300005618 | Bacteria | 1264 |
| 51 | Ga0068863_100067348 | 3300005841 | Bacteria | 3387 |
| 52 | Ga0081540_1007049 | 3300005983 | Bacteria | 8081 |
| 53 | Ga0081539_10048172 | 3300005985 | Bacteria | 2427 |
| 54 | Ga0081539_10104127 | 3300005985 | Bacteria | 1441 |
| 55 | Ga0070717_10324099 | 3300006028 | Bacteria | 1373 |
| 56 | Ga0075365_10277438 | 3300006038 | Bacteria | 1179 |
| 57 | Ga0075367_10074499 | 3300006178 | Bacteria | 2047 |
| 58 | Ga0075428_102321746 | 3300006844 | Unclassified | 552 |
| 59 | Ga0097620_100030443 | 3300006931 | Bacteria | 5416 |
| 60 | Ga0105240_10695434 | 3300009093 | Bacteria | 1110 |
| 61 | Ga0111539_11481957 | 3300009094 | Bacteria | 787 |
| 62 | Ga0105247_10003370 | 3300009101 | Bacteria | 10454 |
| 63 | Ga0114129_10716548 | 3300009147 | Bacteria | 1284 |
| 64 | Ga0105242_11544703 | 3300009176 | Bacteria | 696 |
| 65 | Ga0105237_10020837 | 3300009545 | Bacteria | 6751 |
| 66 | Ga0105237_10583496 | 3300009545 | Bacteria | 1125 |
| 67 | Ga0105238_10121863 | 3300009551 | Bacteria | 2587 |
| 68 | Ga0105238_10126091 | 3300009551 | Bacteria | 2538 |
| 69 | Ga0105238_11111412 | 3300009551 | Bacteria | 813 |
| 70 | Ga0105239_10028455 | 3300010375 | Bacteria | 6147 |
| 71 | Ga0105239_13131649 | 3300010375 | Bacteria | 539 |
| 72 | Ga0157371_10001726 | 3300013102 | Bacteria | 22181 |
| 73 | Ga0157371_10133178 | 3300013102 | Bacteria | 1769 |
| 74 | Ga0157371_10152439 | 3300013102 | Bacteria | 1649 |
| 75 | Ga0157370_10863627 | 3300013104 | Bacteria | 822 |
| 76 | Ga0157369_10265286 | 3300013105 | Bacteria | 1790 |
| 77 | Ga0157369_10357388 | 3300013105 | Bacteria | 1517 |
| 78 | Ga0157369_10836809 | 3300013105 | Bacteria | 945 |
| 79 | Ga0163162_12502191 | 3300013306 | Unclassified | 594 |
| 80 | Ga0157372_10000023 | 3300013307 | Bacteria | 198536 |
| 81 | Ga0157372_10098689 | 3300013307 | Bacteria | 3332 |
| 82 | Ga0157372_11603066 | 3300013307 | Bacteria | 749 |
| 83 | Ga0163163_10897654 | 3300014325 | Bacteria | 950 |
| 84 | Ga0182008_10340943 | 3300014497 | Bacteria | 793 |
| 85 | Ga0182008_10737637 | 3300014497 | Bacteria | 566 |
| 86 | Ga0157377_11133310 | 3300014745 | Bacteria | 601 |
| 87 | Ga0206354_10353655 | 3300020081 | Bacteria | 1043 |
| 88 | Ga0206354_10914441 | 3300020081 | Bacteria | 649 |
| 89 | Ga0206353_10445773 | 3300020082 | Bacteria | 2297 |
| 90 | Ga0206353_11266225 | 3300020082 | Bacteria | 3277 |
| 91 | Ga0206353_11289145 | 3300020082 | Bacteria | 938 |
| 92 | Ga0206353_11538786 | 3300020082 | Bacteria | 2510 |
| 93 | Ga0206353_11790157 | 3300020082 | Bacteria | 570 |
| 94 | Ga0207656_10304171 | 3300025321 | Bacteria | 790 |
| 95 | Ga0207710_10012016 | 3300025900 | Bacteria | 3640 |
| 96 | Ga0207647_10044329 | 3300025904 | Bacteria | 2780 |
| 97 | Ga0207705_10002261 | 3300025909 | Bacteria | 14896 |
| 98 | Ga0207705_10033205 | 3300025909 | Bacteria | 3687 |
| 99 | Ga0207705_10195142 | 3300025909 | Bacteria | 1532 |
| 100 | Ga0207707_10000071 | 3300025912 | Bacteria | 102604 |
| 101 | Ga0207707_10271851 | 3300025912 | Bacteria | 1469 |
| 102 | Ga0207695_10433163 | 3300025913 | Bacteria | 1198 |
| 103 | Ga0207671_10015276 | 3300025914 | Bacteria | 6025 |
| 104 | Ga0207660_10000774 | 3300025917 | Bacteria | 21256 |
| 105 | Ga0207660_10208009 | 3300025917 | Bacteria | 1531 |
| 106 | Ga0207652_10005984 | 3300025921 | Bacteria | 9844 |
| 107 | Ga0207652_10517397 | 3300025921 | Bacteria | 1074 |
| 108 | Ga0207694_10119551 | 3300025924 | Bacteria | 2103 |
| 109 | Ga0207694_10857208 | 3300025924 | Bacteria | 768 |
| 110 | Ga0207694_10980411 | 3300025924 | Bacteria | 715 |
| 111 | Ga0207687_10351394 | 3300025927 | Bacteria | 1201 |
| 112 | Ga0207664_10000002 | 3300025929 | Bacteria | 657053 |
| 113 | Ga0207664_10005336 | 3300025929 | Bacteria | 8780 |
| 114 | Ga0207664_10791287 | 3300025929 | Bacteria | 853 |
| 115 | Ga0207661_10056355 | 3300025944 | Bacteria | 3155 |
| 116 | Ga0207667_10073802 | 3300025949 | Bacteria | 3545 |
| 117 | Ga0207640_10167100 | 3300025981 | Bacteria | 1635 |
| 118 | Ga0207658_10018711 | 3300025986 | Bacteria | 4788 |
| 119 | Ga0207677_11809698 | 3300026023 | Bacteria | 567 |
| 120 | Ga0207678_10227820 | 3300026067 | Bacteria | 1596 |
| 121 | Ga0207678_11236208 | 3300026067 | Bacteria | 661 |
| 122 | Ga0207702_10620170 | 3300026078 | Bacteria | 1062 |
| 123 | Ga0207641_10071311 | 3300026088 | Bacteria | 2988 |
| 124 | Ga0207698_10191232 | 3300026142 | Bacteria | 1823 |
| 125 | Ga0265326_10198280 | 3300028558 | Bacteria | 576 |
| 126 | Ga0265319_1025457 | 3300028563 | Bacteria | 2117 |
| 127 | Ga0265334_10009096 | 3300028573 | Bacteria | 4211 |
| 128 | Ga0265334_10079102 | 3300028573 | Bacteria | 1213 |
| 129 | Ga0307515_10405238 | 3300028794 | Bacteria | 988 |
| 130 | Ga0265338_10003370 | 3300028800 | Bacteria | 22562 |
| 131 | Ga0265320_10113960 | 3300031240 | Bacteria | 1237 |
| 132 | Ga0265325_10025920 | 3300031241 | Bacteria | 3180 |
| 133 | Ga0265340_10001266 | 3300031247 | Bacteria | 14505 |
| 134 | Ga0265339_10004122 | 3300031249 | Bacteria | 10017 |
| 135 | Ga0265339_10278887 | 3300031249 | Bacteria | 802 |
| 136 | Ga0265331_10461918 | 3300031250 | Bacteria | 571 |
| 137 | Ga0265331_10474103 | 3300031250 | Unclassified | 563 |
| 138 | Ga0265327_10252790 | 3300031251 | Bacteria | 784 |
| 139 | Ga0265316_10105219 | 3300031344 | Bacteria | 2141 |
| 140 | Ga0307513_10005977 | 3300031456 | Bacteria | 15977 |
| 141 | Ga0265313_10000368 | 3300031595 | Bacteria | 48821 |
| 142 | Ga0265314_10087920 | 3300031711 | Bacteria | 2030 |
| 143 | Ga0265314_10274085 | 3300031711 | Unclassified | 957 |
| 144 | Ga0307405_10641673 | 3300031731 | Bacteria | 872 |
| 145 | Ga0307413_10600229 | 3300031824 | Bacteria | 901 |
| 146 | Ga0307410_10427934 | 3300031852 | Bacteria | 1075 |
| 147 | Ga0307406_10000027 | 3300031901 | Bacteria | 91856 |
| 148 | Ga0307406_10117147 | 3300031901 | Bacteria | 1845 |
| 149 | Ga0307407_10366827 | 3300031903 | Bacteria | 1024 |
| 150 | Ga0307409_100936192 | 3300031995 | Bacteria | 882 |
| 151 | Ga0307409_101512835 | 3300031995 | Bacteria | 699 |
| 152 | Ga0307409_101643912 | 3300031995 | Bacteria | 671 |
| 153 | Ga0307414_10164831 | 3300032004 | Bacteria | 1765 |
| 154 | Ga0307411_10162283 | 3300032005 | Bacteria | 1676 |
| 155 | Ga0307415_100179948 | 3300032126 | Bacteria | 1658 |
| 156 | Ga0373927_0348187 | 3300035695 | Bacteria | 976 |
| 157 | Ga0373937_0746865 | 3300036401 | Unclassified | 926 |
| 158 | Ga0316584_0362307 | 3300036712 | Bacteria | 1039 |
| 159 | Ga0373925_0751505 | 3300037068 | Bacteria | 804 |
| 160 | Ga0395900_0515012 | 3300037418 | Bacteria | 1145 |
| 161 | Ga0395900_0628642 | 3300037418 | Bacteria | 1012 |
| 162 | Ga0395898_0306256 | 3300037466 | Bacteria | 1515 |
| 163 | Ga0395905_0051901 | 3300037471 | Bacteria | 3841 |
| 164 | Ga0395901_0052141 | 3300038443 | Bacteria | 4252 |
| 165 | Ga0395901_0108704 | 3300038443 | Bacteria | 2911 |
| 166 | Ga0395901_0286834 | 3300038443 | Bacteria | 1709 |
| 167 | Ga0400485_01612 | 3300038735 | Bacteria | 30354 |
| 168 | Ga0400488_52972 | 3300038741 | Bacteria | 7479 |
| 169 | Ga0400486_23270 | 3300038742 | Bacteria | 10183 |
| 170 | Ga0436363_0554910 | 3300039450 | Bacteria | 515 |
| 171 | Ga0436363_1247137 | 3300039450 | Bacteria | 2267 |
| 172 | Ga0436363_1596252 | 3300039450 | Bacteria | 609 |
| 173 | Ga0451793_0711570 | 3300041452 | Unclassified | 616 |
| 174 | Ga0451793_1564418 | 3300041452 | Bacteria | 736 |
| 175 | Ga0451797_1454330 | 3300041453 | Bacteria | 926 |
| 176 | Ga0451795_0096960 | 3300041456 | Bacteria | 1581 |
| 177 | Ga0451807_1156497 | 3300041486 | Bacteria | 738 |
| 178 | Ga0451833_0340883 | 3300041491 | Bacteria | 844 |
| 179 | Ga0451851_0712998 | 3300041507 | Bacteria | 830 |
| 180 | Ga0451843_1102626 | 3300041509 | Bacteria | 1962 |
| 181 | Ga0451843_1284714 | 3300041509 | Bacteria | 695 |
| 182 | Ga0451855_0740312 | 3300041511 | Bacteria | 893 |
| 183 | Ga0466972_0116042 | 3300044658 | Bacteria | 1264 |
| 184 | Ga0466972_0292035 | 3300044658 | Bacteria | 762 |
| 185 | Ga0466965_0100834 | 3300044683 | Bacteria | 1476 |
| 186 | Ga0466965_0166302 | 3300044683 | Bacteria | 1158 |
| 187 | Ga0466966_0238552 | 3300044684 | Bacteria | 1096 |
| 188 | Ga0466966_0528938 | 3300044684 | Bacteria | 709 |
| 189 | Ga0466966_0800845 | 3300044684 | Bacteria | 568 |
| 190 | Ga0466961_0154739 | 3300044693 | Bacteria | 1430 |
| 191 | Ga0466961_0312415 | 3300044693 | Bacteria | 959 |
| 192 | Ga0466961_0452329 | 3300044693 | Bacteria | 777 |
| 193 | Ga0466961_0828775 | 3300044693 | Bacteria | 552 |
| 194 | Ga0466963_0098688 | 3300044694 | Bacteria | 1997 |
| 195 | Ga0466963_0304636 | 3300044694 | Bacteria | 1121 |
| 196 | Ga0466963_0415447 | 3300044694 | Unclassified | 949 |
| 197 | Ga0466963_1127066 | 3300044694 | Bacteria | 552 |
| 198 | Ga0466964_0205171 | 3300044706 | Bacteria | 949 |
| 199 | Ga0466971_0038330 | 3300044719 | Bacteria | 2151 |
| 200 | Ga0466971_0214181 | 3300044719 | Bacteria | 912 |
| 201 | Ga0466971_0283386 | 3300044719 | Bacteria | 793 |
| 202 | Ga0466968_0292113 | 3300044735 | Bacteria | 782 |
| 203 | Ga0466970_0030162 | 3300044765 | Bacteria | 2859 |
| 204 | Ga0466970_0054757 | 3300044765 | Bacteria | 2130 |
| 205 | Ga0466970_0093396 | 3300044765 | Bacteria | 1634 |
| 206 | Ga0466970_0163577 | 3300044765 | Bacteria | 1231 |
| 207 | Ga0466970_0174058 | 3300044765 | Bacteria | 1193 |
| 208 | Ga0466970_0204316 | 3300044765 | Bacteria | 1099 |
| 209 | Ga0466970_0304912 | 3300044765 | Bacteria | 899 |
| 210 | Ga0466970_0611364 | 3300044765 | Bacteria | 633 |
| 211 | Ga0466957_0133419 | 3300044842 | Bacteria | 1594 |
| 212 | Ga0466957_0598828 | 3300044842 | Bacteria | 771 |
| 213 | Ga0466957_1324874 | 3300044842 | Bacteria | 523 |
| 214 | Ga0466960_0072829 | 3300044901 | Bacteria | 1713 |
| 215 | Ga0466960_0285753 | 3300044901 | Bacteria | 926 |
| 216 | Ga0466959_0085232 | 3300045049 | Bacteria | 2274 |
| 217 | Ga0466959_0872850 | 3300045049 | Bacteria | 600 |
| 218 | Ga0466958_0151510 | 3300045836 | Bacteria | 1463 |
| 219 | Ga0466958_0197847 | 3300045836 | Bacteria | 1279 |
| 220 | Ga0466958_0210792 | 3300045836 | Bacteria | 1238 |
| 221 | Ga0466958_0358629 | 3300045836 | Bacteria | 939 |
| 222 | Ga0466958_0475786 | 3300045836 | Bacteria | 810 |
| 223 | Ga0466967_0505587 | 3300045976 | Bacteria | 1186 |
| 224 | Ga0466967_0676376 | 3300045976 | Bacteria | 1022 |
| 225 | Ga0466967_1541111 | 3300045976 | Bacteria | 662 |
| 226 | Ga0466967_1927117 | 3300045976 | Bacteria | 588 |
| 227 | Ga0495650_0259311 | 3300046471 | Bacteria | 589 |
| 228 | Ga0495608_0820745 | 3300046511 | Bacteria | 548 |
| 229 | Ga0495620_0143030 | 3300046515 | Bacteria | 935 |
| 230 | Ga0495630_0561881 | 3300046517 | Bacteria | 875 |
| 231 | Ga0495652_0637574 | 3300046529 | Unclassified | 723 |
| 232 | Ga0495609_0064414 | 3300046538 | Bacteria | 1617 |
| 233 | Ga0495597_0121372 | 3300046542 | Bacteria | 1089 |
| 234 | Ga0495645_0535328 | 3300046543 | Unclassified | 728 |
| 235 | Ga0495593_0370337 | 3300047673 | Unclassified | 716 |
| 236 | Ga0496100_0719968 | 3300048903 | Bacteria | 779 |
| 237 | Ga0496100_1051128 | 3300048903 | Bacteria | 641 |
| 238 | Ga0496101_0199953 | 3300048904 | Bacteria | 1545 |
| 239 | Ga0496102_0000029 | 3300048905 | Bacteria | 222195 |
| 240 | Ga0496102_0403772 | 3300048905 | Bacteria | 1284 |
| 241 | Ga0496104_0260200 | 3300048907 | Bacteria | 1648 |
| 242 | Ga0496104_0636422 | 3300048907 | Bacteria | 976 |
| 243 | Ga0496105_0123399 | 3300048908 | Bacteria | 2135 |
| 244 | Ga0496105_0204057 | 3300048908 | Bacteria | 1613 |
| 245 | Ga0496108_0017784 | 3300048911 | Bacteria | 5813 |
| 246 | Ga0496108_0218413 | 3300048911 | Bacteria | 1656 |
| 247 | Ga0496109_0003689 | 3300048912 | Bacteria | 12801 |
| 248 | Ga0496109_0041851 | 3300048912 | Bacteria | 4150 |
| 249 | Ga0496109_0681892 | 3300048912 | Bacteria | 965 |
| 250 | Ga0496109_1253963 | 3300048912 | Bacteria | 678 |
| 251 | Ga0496110_0007230 | 3300048913 | Bacteria | 8847 |
| 252 | Ga0496110_0470510 | 3300048913 | Bacteria | 1145 |
| 253 | Ga0496111_0352103 | 3300048914 | Bacteria | 1090 |
| 254 | Ga0496111_0442131 | 3300048914 | Bacteria | 960 |
| 255 | Ga0496112_0001388 | 3300048915 | Bacteria | 18480 |
| 256 | Ga0496112_0137710 | 3300048915 | Bacteria | 2411 |
| 257 | Ga0496112_0833680 | 3300048915 | Bacteria | 846 |
| 258 | Ga0496112_1658003 | 3300048915 | Bacteria | 552 |
| 259 | Ga0496113_0168451 | 3300048916 | Bacteria | 1734 |
| 260 | Ga0496113_1374968 | 3300048916 | Bacteria | 547 |
| 261 | Ga0496115_0093517 | 3300048918 | Bacteria | 2458 |
| 262 | Ga0496115_0383416 | 3300048918 | Bacteria | 1143 |
| 263 | Ga0496117_0004584 | 3300048920 | Bacteria | 15115 |
| 264 | Ga0496117_0171105 | 3300048920 | Bacteria | 1261 |
| 265 | Ga0496118_0000270 | 3300048921 | Bacteria | 91081 |
| 266 | Ga0496118_0012908 | 3300048921 | Bacteria | 7955 |
| 267 | Ga0496118_0058736 | 3300048921 | Bacteria | 2871 |
| 268 | Ga0496119_0130771 | 3300048922 | Bacteria | 1368 |
| 269 | Ga0496119_0152561 | 3300048922 | Bacteria | 1236 |
| 270 | Ga0496119_0180042 | 3300048922 | Bacteria | 1109 |
| 271 | Ga0496120_0041793 | 3300048923 | Bacteria | 2682 |
| 272 | Ga0496121_0099163 | 3300048924 | Bacteria | 2252 |
| 273 | Ga0496122_0001848 | 3300048925 | Bacteria | 32283 |
| 274 | Ga0496122_0141485 | 3300048925 | Bacteria | 1504 |
| 275 | Ga0496123_0000112 | 3300048926 | Bacteria | 163990 |
| 276 | Ga0496123_0183586 | 3300048926 | Bacteria | 1089 |
| 277 | Ga0496124_0002132 | 3300048927 | Bacteria | 26592 |
| 278 | Ga0496124_0044855 | 3300048927 | Bacteria | 3792 |
| 279 | Ga0496124_0110503 | 3300048927 | Bacteria | 2213 |
| 280 | Ga0496126_0000013 | 3300048929 | Bacteria | 690046 |
| 281 | Ga0496126_0392892 | 3300048929 | Bacteria | 1127 |
| 282 | Ga0501031_0035269 | 3300049568 | Bacteria | 3263 |
| 283 | Ga0501032_0047634 | 3300049569 | Bacteria | 2894 |
| 284 | Ga0501033_0065700 | 3300049570 | Bacteria | 2669 |
| 285 | Ga0501033_0081372 | 3300049570 | Bacteria | 2375 |
| 286 | Ga0501034_0060646 | 3300049571 | Bacteria | 3800 |
| 287 | Ga0501036_0311393 | 3300049572 | Bacteria | 1316 |
| 288 | Ga0501037_0207856 | 3300049573 | Bacteria | 1381 |
| 289 | Ga0501038_0005774 | 3300049574 | Bacteria | 11462 |
| 290 | Ga0501039_0301262 | 3300049575 | Bacteria | 1260 |
| 291 | Ga0501043_0168231 | 3300049579 | Bacteria | 1711 |
| 292 | Ga0501047_0001104 | 3300049581 | Bacteria | 26810 |
| 293 | Ga0501048_0002743 | 3300049582 | Bacteria | 13429 |
| 294 | Ga0501070_0012279 | 3300049586 | Bacteria | 7229 |
| 295 | Ga0501073_0046242 | 3300049589 | Bacteria | 3062 |
| 296 | Ga0501074_0352617 | 3300049590 | Bacteria | 1044 |
| 297 | Ga0501080_1288402 | 3300049742 | Unclassified | 626 |
| 298 | Ga0501035_0004467 | 3300049822 | Bacteria | 13276 |
| 299 | Ga0501044_0104869 | 3300049823 | Bacteria | 2840 |
| 300 | nmdc:mga06z11_26971_c1 | 3300050494 | Bacteria | 2741 |
| 301 | nmdc:mga05p37_966312_c1 | 3300050507 | Bacteria | 909 |
| 302 | Ga0495601_0677208 | 3300053077 | Bacteria | 659 |
| 303 | Ga0500628_016731 | 3300053129 | Bacteria | 1422 |
| 304 | Ga0500628_018623 | 3300053129 | Bacteria | 1372 |
| 305 | Ga0500604_0077841 | 3300053151 | Bacteria | 1067 |
| 306 | Ga0500616_0002092 | 3300053153 | Bacteria | 17409 |
| 307 | Ga0501082_0522404 | 3300060353 | Bacteria | 1038 |
| 308 | Ga0501082_0790385 | 3300060353 | Bacteria | 830 |
| 309 | Ga0466962_0215761 | 3300061719 | Bacteria | 939 |
| 310 | Ga0466962_0309157 | 3300061719 | Bacteria | 783 |
| 311 | Ga0466962_0429949 | 3300061719 | Bacteria | 663 |
| 312 | Ga0466962_0573216 | 3300061719 | Bacteria | 574 |
| 313 | Ga0466962_0659440 | 3300061719 | Bacteria | 535 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041486 | Ga0451807_1156497 | Ga0451807_1156497_292_696 | 110 |
| 2 | 3300031731 | Ga0307405_10641673 | Ga0307405_106416732 | 112 |
| 3 | 3300031852 | Ga0307410_10427934 | Ga0307410_104279342 | 112 |
| 4 | 3300031903 | Ga0307407_10366827 | Ga0307407_103668272 | 112 |
| 5 | 3300041452 | Ga0451793_1564418 | Ga0451793_1564418_13_357 | 114 |
| 6 | 3300041453 | Ga0451797_1454330 | Ga0451797_1454330_481_843 | 114 |
| 7 | 3300048913 | Ga0496110_0470510 | Ga0496110_0470510_19_363 | 114 |
| 8 | 3300061719 | Ga0466962_0659440 | Ga0466962_0659440_11_355 | 114 |
| 9 | 3300005336 | Ga0070680_100181911 | Ga0070680_1001819112 | 117 |
| 10 | 3300005366 | Ga0070659_100646178 | Ga0070659_1006461782 | 117 |
| 11 | 3300005455 | Ga0070663_101562338 | Ga0070663_1015623382 | 117 |
| 12 | 3300005458 | Ga0070681_11749666 | Ga0070681_117496661 | 117 |
| 13 | 3300005530 | Ga0070679_100147226 | Ga0070679_1001472262 | 117 |
| 14 | 3300013105 | Ga0157369_10357388 | Ga0157369_103573883 | 117 |
| 15 | 3300020082 | Ga0206353_10445773 | Ga0206353_104457733 | 117 |
| 16 | 3300025917 | Ga0207660_10208009 | Ga0207660_102080092 | 117 |
| 17 | 3300026067 | Ga0207678_11236208 | Ga0207678_112362082 | 117 |
| 18 | 3300044658 | Ga0466972_0292035 | Ga0466972_0292035_107_499 | 117 |
| 19 | 3300044693 | Ga0466961_0312415 | Ga0466961_0312415_326_718 | 117 |
| 20 | 3300044842 | Ga0466957_0598828 | Ga0466957_0598828_184_576 | 117 |
| 21 | 3300045836 | Ga0466958_0475786 | Ga0466958_0475786_347_739 | 117 |
| 22 | 3300061719 | Ga0466962_0215761 | Ga0466962_0215761_25_417 | 117 |
| 23 | 3300005337 | Ga0070682_100061465 | Ga0070682_1000614653 | 118 |
| 24 | 3300005577 | Ga0068857_102528355 | Ga0068857_1025283552 | 118 |
| 25 | 3300025927 | Ga0207687_10351394 | Ga0207687_103513942 | 118 |
| 26 | 3300037466 | Ga0395898_0306256 | Ga0395898_0306256_443_847 | 118 |
| 27 | 3300037471 | Ga0395905_0051901 | Ga0395905_0051901_2521_2925 | 118 |
| 28 | 3300005327 | Ga0070658_10828287 | Ga0070658_108282872 | 120 |
| 29 | 3300038443 | Ga0395901_0052141 | Ga0395901_0052141_2076_2480 | 120 |
| 30 | 3300036712 | Ga0316584_0362307 | Ga0316584_0362307_21_386 | 121 |
| 31 | 3300044694 | Ga0466963_0304636 | Ga0466963_0304636_92_496 | 121 |
| 32 | 3300048916 | Ga0496113_1374968 | Ga0496113_1374968_162_527 | 121 |
| 33 | 3300046542 | Ga0495597_0121372 | Ga0495597_0121372_247_618 | 123 |
| 34 | 3300046511 | Ga0495608_0820745 | Ga0495608_0820745_155_529 | 124 |
| 35 | iso_pu_bacteria | 2643221553 | 2643785909 | 125 |
| 36 | iso_pu_bacteria | 2643221724 | 2644680314 | 125 |
| 37 | iso_pu_bacteria | 2728369380 | 2730229766 | 125 |
| 38 | iso_pu_bacteria | 2747842429 | 2747954663 | 125 |
| 39 | iso_pu_bacteria | 2808606368 | 2808884194 | 125 |
| 40 | iso_pu_bacteria | 2857720070 | 2857723078 | 125 |
| 41 | iso_pu_bacteria | 2857723135 | 2857723958 | 125 |
| 42 | iso_pu_bacteria | 2928090899 | 2928093616 | 125 |
| 43 | iso_pu_bacteria | 2984580707 | 2984582690 | 125 |
| 44 | 3300044693 | Ga0466961_0452329 | Ga0466961_0452329_85_483 | 126 |
| 45 | 3300061719 | Ga0466962_0309157 | Ga0466962_0309157_166_564 | 126 |
| 46 | iso_pu_bacteria | 2643221567 | 2643851658 | 126 |
| 47 | iso_pu_bacteria | 2643221624 | 2644137751 | 126 |
| 48 | iso_pu_bacteria | 2751185788 | 2753301906 | 126 |
| 49 | iso_pu_bacteria | 2904430863 | 2904432971 | 126 |
| 50 | iso_pu_bacteria | 2904501621 | 2904502905 | 126 |
| 51 | iso_pu_bacteria | 2908674828 | 2908675919 | 126 |
| 52 | iso_pu_bacteria | 2909074476 | 2909074978 | 126 |
| 53 | iso_pu_bacteria | 2919039151 | 2919041146 | 126 |
| 54 | iso_pu_bacteria | 2919042368 | 2919044532 | 126 |
| 55 | iso_pu_bacteria | 2928500415 | 2928502241 | 126 |
| 56 | iso_pu_bacteria | 2966924647 | 2966926465 | 126 |
| 57 | iso_pu_bacteria | 2984551494 | 2984554053 | 126 |
| 58 | 3300044683 | Ga0466965_0100834 | Ga0466965_0100834_374_760 | 127 |
| 59 | 3300044693 | Ga0466961_0154739 | Ga0466961_0154739_440_826 | 127 |
| 60 | 3300044719 | Ga0466971_0038330 | Ga0466971_0038330_1191_1577 | 127 |
| 61 | 3300044719 | Ga0466971_0283386 | Ga0466971_0283386_151_537 | 127 |
| 62 | 3300044765 | Ga0466970_0030162 | Ga0466970_0030162_457_843 | 127 |
| 63 | 3300044765 | Ga0466970_0093396 | Ga0466970_0093396_886_1272 | 127 |
| 64 | 3300044765 | Ga0466970_0174058 | Ga0466970_0174058_100_486 | 127 |
| 65 | 3300044765 | Ga0466970_0204316 | Ga0466970_0204316_67_453 | 127 |
| 66 | 3300044765 | Ga0466970_0611364 | Ga0466970_0611364_147_533 | 127 |
| 67 | 3300044901 | Ga0466960_0072829 | Ga0466960_0072829_891_1277 | 127 |
| 68 | 3300045836 | Ga0466958_0151510 | Ga0466958_0151510_510_896 | 127 |
| 69 | 3300045836 | Ga0466958_0210792 | Ga0466958_0210792_507_893 | 127 |
| 70 | 3300045976 | Ga0466967_0676376 | Ga0466967_0676376_256_642 | 127 |
| 71 | 3300046471 | Ga0495650_0259311 | Ga0495650_0259311_159_545 | 127 |
| 72 | 3300061719 | Ga0466962_0429949 | Ga0466962_0429949_37_423 | 127 |
| 73 | iso_pu_bacteria | 2919446982 | 2919448348 | 127 |
| 74 | 3300005327 | Ga0070658_10000157 | Ga0070658_1000015748 | 128 |
| 75 | 3300005616 | Ga0068852_100947171 | Ga0068852_1009471713 | 128 |
| 76 | 3300013102 | Ga0157371_10001726 | Ga0157371_100017267 | 128 |
| 77 | 3300013102 | Ga0157371_10133178 | Ga0157371_101331782 | 128 |
| 78 | 3300020082 | Ga0206353_11790157 | Ga0206353_117901572 | 128 |
| 79 | 3300037418 | Ga0395900_0515012 | Ga0395900_0515012_301_690 | 128 |
| 80 | 3300038443 | Ga0395901_0108704 | Ga0395901_0108704_185_574 | 128 |
| 81 | 3300044684 | Ga0466966_0528938 | Ga0466966_0528938_284_673 | 128 |
| 82 | 3300044693 | Ga0466961_0828775 | Ga0466961_0828775_113_502 | 128 |
| 83 | 3300044694 | Ga0466963_1127066 | Ga0466963_1127066_119_508 | 128 |
| 84 | 3300044842 | Ga0466957_0133419 | Ga0466957_0133419_32_421 | 128 |
| 85 | 3300048912 | Ga0496109_1253963 | Ga0496109_1253963_116_502 | 128 |
| 86 | 3300048914 | Ga0496111_0442131 | Ga0496111_0442131_119_505 | 128 |
| 87 | iso_pu_bacteria | 2734482000 | 2734968418 | 128 |
| 88 | 3300003320 | rootH2_10187235 | rootH2_101872352 | 129 |
| 89 | 3300005329 | Ga0070683_100657940 | Ga0070683_1006579403 | 129 |
| 90 | 3300005435 | Ga0070714_100002504 | Ga0070714_10000250415 | 129 |
| 91 | 3300013307 | Ga0157372_11603066 | Ga0157372_116030662 | 129 |
| 92 | 3300025929 | Ga0207664_10005336 | Ga0207664_100053363 | 129 |
| 93 | 3300031824 | Ga0307413_10600229 | Ga0307413_106002292 | 129 |
| 94 | 3300031901 | Ga0307406_10000027 | Ga0307406_1000002722 | 129 |
| 95 | 3300031995 | Ga0307409_100936192 | Ga0307409_1009361922 | 129 |
| 96 | 3300031995 | Ga0307409_101512835 | Ga0307409_1015128352 | 129 |
| 97 | 3300032004 | Ga0307414_10164831 | Ga0307414_101648313 | 129 |
| 98 | 3300044765 | Ga0466970_0163577 | Ga0466970_0163577_797_1189 | 129 |
| 99 | 3300048908 | Ga0496105_0123399 | Ga0496105_0123399_726_1118 | 129 |
| 100 | 3300048918 | Ga0496115_0093517 | Ga0496115_0093517_544_936 | 129 |
| 101 | 3300048922 | Ga0496119_0152561 | Ga0496119_0152561_277_669 | 129 |
| 102 | 3300048927 | Ga0496124_0110503 | Ga0496124_0110503_821_1213 | 129 |
| 103 | 3300048929 | Ga0496126_0392892 | Ga0496126_0392892_142_534 | 129 |
| 104 | 3300037418 | Ga0395900_0628642 | Ga0395900_0628642_312_713 | 130 |
| 105 | 3300038443 | Ga0395901_0286834 | Ga0395901_0286834_590_991 | 130 |
| 106 | 3300044735 | Ga0466968_0292113 | Ga0466968_0292113_295_690 | 130 |
| 107 | 3300044765 | Ga0466970_0054757 | Ga0466970_0054757_1196_1591 | 130 |
| 108 | 3300046515 | Ga0495620_0143030 | Ga0495620_0143030_64_459 | 130 |
| 109 | 3300046538 | Ga0495609_0064414 | Ga0495609_0064414_673_1068 | 130 |
| 110 | 3300048903 | Ga0496100_1051128 | Ga0496100_1051128_99_494 | 130 |
| 111 | 3300048904 | Ga0496101_0199953 | Ga0496101_0199953_22_417 | 130 |
| 112 | 3300048905 | Ga0496102_0403772 | Ga0496102_0403772_510_905 | 130 |
| 113 | 3300048920 | Ga0496117_0004584 | Ga0496117_0004584_10126_10521 | 130 |
| 114 | 3300048921 | Ga0496118_0000270 | Ga0496118_0000270_17960_18355 | 130 |
| 115 | 3300048922 | Ga0496119_0180042 | Ga0496119_0180042_348_743 | 130 |
| 116 | 3300048923 | Ga0496120_0041793 | Ga0496120_0041793_2030_2425 | 130 |
| 117 | 3300048925 | Ga0496122_0141485 | Ga0496122_0141485_536_931 | 130 |
| 118 | 3300048926 | Ga0496123_0183586 | Ga0496123_0183586_167_562 | 130 |
| 119 | 3300048927 | Ga0496124_0002132 | Ga0496124_0002132_17924_18319 | 130 |
| 120 | 3300005327 | Ga0070658_10005852 | Ga0070658_100058526 | 131 |
| 121 | 3300005327 | Ga0070658_10511259 | Ga0070658_105112592 | 131 |
| 122 | 3300006028 | Ga0070717_10324099 | Ga0070717_103240992 | 131 |
| 123 | 3300014497 | Ga0182008_10340943 | Ga0182008_103409432 | 131 |
| 124 | 3300025909 | Ga0207705_10002261 | Ga0207705_100022616 | 131 |
| 125 | 3300031901 | Ga0307406_10117147 | Ga0307406_101171473 | 131 |
| 126 | 3300032005 | Ga0307411_10162283 | Ga0307411_101622833 | 131 |
| 127 | 3300041511 | Ga0451855_0740312 | Ga0451855_0740312_16_411 | 131 |
| 128 | 3300003203 | JGI25406J46586_10001287 | JGI25406J46586_100012879 | 132 |
| 129 | 3300005338 | Ga0068868_100438469 | Ga0068868_1004384691 | 132 |
| 130 | 3300005435 | Ga0070714_100441702 | Ga0070714_1004417023 | 132 |
| 131 | 3300005563 | Ga0068855_101932388 | Ga0068855_1019323881 | 132 |
| 132 | 3300005614 | Ga0068856_100229956 | Ga0068856_1002299563 | 132 |
| 133 | 3300005616 | Ga0068852_100474110 | Ga0068852_1004741102 | 132 |
| 134 | 3300005618 | Ga0068864_100426957 | Ga0068864_1004269573 | 132 |
| 135 | 3300005841 | Ga0068863_100067348 | Ga0068863_1000673484 | 132 |
| 136 | 3300005983 | Ga0081540_1007049 | Ga0081540_10070496 | 132 |
| 137 | 3300005985 | Ga0081539_10048172 | Ga0081539_100481722 | 132 |
| 138 | 3300005985 | Ga0081539_10104127 | Ga0081539_101041272 | 132 |
| 139 | 3300009551 | Ga0105238_11111412 | Ga0105238_111114122 | 132 |
| 140 | 3300013104 | Ga0157370_10863627 | Ga0157370_108636272 | 132 |
| 141 | 3300013105 | Ga0157369_10836809 | Ga0157369_108368092 | 132 |
| 142 | 3300013307 | Ga0157372_10098689 | Ga0157372_100986895 | 132 |
| 143 | 3300014497 | Ga0182008_10737637 | Ga0182008_107376371 | 132 |
| 144 | 3300014745 | Ga0157377_11133310 | Ga0157377_111333101 | 132 |
| 145 | 3300025321 | Ga0207656_10304171 | Ga0207656_103041712 | 132 |
| 146 | 3300025924 | Ga0207694_10980411 | Ga0207694_109804112 | 132 |
| 147 | 3300025929 | Ga0207664_10791287 | Ga0207664_107912871 | 132 |
| 148 | 3300026023 | Ga0207677_11809698 | Ga0207677_118096982 | 132 |
| 149 | 3300026078 | Ga0207702_10620170 | Ga0207702_106201702 | 132 |
| 150 | 3300026088 | Ga0207641_10071311 | Ga0207641_100713113 | 132 |
| 151 | 3300026142 | Ga0207698_10191232 | Ga0207698_101912322 | 132 |
| 152 | 3300028573 | Ga0265334_10009096 | Ga0265334_100090965 | 132 |
| 153 | 3300028794 | Ga0307515_10405238 | Ga0307515_104052382 | 132 |
| 154 | 3300031456 | Ga0307513_10005977 | Ga0307513_100059779 | 132 |
| 155 | 3300038741 | Ga0400488_52972 | Ga0400488_52972_3146_3544 | 132 |
| 156 | 3300039450 | Ga0436363_1247137 | Ga0436363_1247137_594_992 | 132 |
| 157 | 3300039450 | Ga0436363_1596252 | Ga0436363_1596252_145_543 | 132 |
| 158 | 3300041452 | Ga0451793_0711570 | Ga0451793_0711570_33_431 | 132 |
| 159 | 3300041456 | Ga0451795_0096960 | Ga0451795_0096960_569_967 | 132 |
| 160 | 3300041491 | Ga0451833_0340883 | Ga0451833_0340883_268_666 | 132 |
| 161 | 3300041507 | Ga0451851_0712998 | Ga0451851_0712998_134_532 | 132 |
| 162 | 3300041509 | Ga0451843_1102626 | Ga0451843_1102626_691_1089 | 132 |
| 163 | 3300041509 | Ga0451843_1284714 | Ga0451843_1284714_238_636 | 132 |
| 164 | 3300044658 | Ga0466972_0116042 | Ga0466972_0116042_483_881 | 132 |
| 165 | 3300044683 | Ga0466965_0166302 | Ga0466965_0166302_584_982 | 132 |
| 166 | 3300044684 | Ga0466966_0800845 | Ga0466966_0800845_100_498 | 132 |
| 167 | 3300044694 | Ga0466963_0098688 | Ga0466963_0098688_748_1146 | 132 |
| 168 | 3300044706 | Ga0466964_0205171 | Ga0466964_0205171_31_429 | 132 |
| 169 | 3300044765 | Ga0466970_0304912 | Ga0466970_0304912_309_707 | 132 |
| 170 | 3300044842 | Ga0466957_1324874 | Ga0466957_1324874_54_452 | 132 |
| 171 | 3300044901 | Ga0466960_0285753 | Ga0466960_0285753_130_528 | 132 |
| 172 | 3300045049 | Ga0466959_0085232 | Ga0466959_0085232_1409_1807 | 132 |
| 173 | 3300045049 | Ga0466959_0872850 | Ga0466959_0872850_95_493 | 132 |
| 174 | 3300045836 | Ga0466958_0197847 | Ga0466958_0197847_411_809 | 132 |
| 175 | 3300045976 | Ga0466967_0505587 | Ga0466967_0505587_425_823 | 132 |
| 176 | 3300048907 | Ga0496104_0636422 | Ga0496104_0636422_106_504 | 132 |
| 177 | 3300048911 | Ga0496108_0218413 | Ga0496108_0218413_1021_1419 | 132 |
| 178 | 3300048915 | Ga0496112_0833680 | Ga0496112_0833680_101_499 | 132 |
| 179 | 3300053129 | Ga0500628_016731 | Ga0500628_016731_546_944 | 132 |
| 180 | 3300053129 | Ga0500628_018623 | Ga0500628_018623_666_1064 | 132 |
| 181 | 3300053153 | Ga0500616_0002092 | Ga0500616_0002092_9800_10198 | 132 |
| 182 | 3300006038 | Ga0075365_10277438 | Ga0075365_102774382 | 133 |
| 183 | 3300006178 | Ga0075367_10074499 | Ga0075367_100744993 | 133 |
| 184 | 3300031247 | Ga0265340_10001266 | Ga0265340_100012668 | 133 |
| 185 | 3300050494 | nmdc:mga06z11_26971_c1 | nmdc:mga06z11_26971_c1_1002_1403 | 133 |
| 186 | 3300005439 | Ga0070711_100759469 | Ga0070711_1007594692 | 134 |
| 187 | 3300010375 | Ga0105239_13131649 | Ga0105239_131316492 | 134 |
| 188 | 3300013102 | Ga0157371_10152439 | Ga0157371_101524393 | 134 |
| 189 | 3300038735 | Ga0400485_01612 | Ga0400485_01612_6254_6658 | 134 |
| 190 | 3300038742 | Ga0400486_23270 | Ga0400486_23270_7007_7411 | 134 |
| 191 | 3300048921 | Ga0496118_0058736 | Ga0496118_0058736_60_464 | 134 |
| 192 | 3300048925 | Ga0496122_0001848 | Ga0496122_0001848_10494_10898 | 134 |
| 193 | 3300048926 | Ga0496123_0000112 | Ga0496123_0000112_21412_21816 | 134 |
| 194 | 3300048927 | Ga0496124_0044855 | Ga0496124_0044855_3114_3518 | 134 |
| 195 | 3300005327 | Ga0070658_10099740 | Ga0070658_100997403 | 135 |
| 196 | 3300005327 | Ga0070658_10965774 | Ga0070658_109657742 | 135 |
| 197 | 3300005329 | Ga0070683_100018404 | Ga0070683_1000184046 | 135 |
| 198 | 3300005336 | Ga0070680_100000038 | Ga0070680_1000000389 | 135 |
| 199 | 3300005336 | Ga0070680_100698287 | Ga0070680_1006982872 | 135 |
| 200 | 3300005455 | Ga0070663_100302412 | Ga0070663_1003024122 | 135 |
| 201 | 3300005458 | Ga0070681_10000106 | Ga0070681_1000010650 | 135 |
| 202 | 3300005458 | Ga0070681_10304195 | Ga0070681_103041952 | 135 |
| 203 | 3300005530 | Ga0070679_100000026 | Ga0070679_10000002619 | 135 |
| 204 | 3300005530 | Ga0070679_100651790 | Ga0070679_1006517902 | 135 |
| 205 | 3300005535 | Ga0070684_100201079 | Ga0070684_1002010793 | 135 |
| 206 | 3300005535 | Ga0070684_100424702 | Ga0070684_1004247022 | 135 |
| 207 | 3300005563 | Ga0068855_100092706 | Ga0068855_1000927062 | 135 |
| 208 | 3300005578 | Ga0068854_100124726 | Ga0068854_1001247263 | 135 |
| 209 | 3300005614 | Ga0068856_100041209 | Ga0068856_1000412093 | 135 |
| 210 | 3300005614 | Ga0068856_100681977 | Ga0068856_1006819773 | 135 |
| 211 | 3300005616 | Ga0068852_100348227 | Ga0068852_1003482273 | 135 |
| 212 | 3300005617 | Ga0068859_100030443 | Ga0068859_1000304435 | 135 |
| 213 | 3300006931 | Ga0097620_100030443 | Ga0097620_1000304435 | 135 |
| 214 | 3300009093 | Ga0105240_10695434 | Ga0105240_106954343 | 135 |
| 215 | 3300009101 | Ga0105247_10003370 | Ga0105247_1000337011 | 135 |
| 216 | 3300009545 | Ga0105237_10020837 | Ga0105237_100208376 | 135 |
| 217 | 3300009545 | Ga0105237_10583496 | Ga0105237_105834961 | 135 |
| 218 | 3300010375 | Ga0105239_10028455 | Ga0105239_100284553 | 135 |
| 219 | 3300013105 | Ga0157369_10265286 | Ga0157369_102652863 | 135 |
| 220 | 3300020081 | Ga0206354_10353655 | Ga0206354_103536552 | 135 |
| 221 | 3300020081 | Ga0206354_10914441 | Ga0206354_109144411 | 135 |
| 222 | 3300020082 | Ga0206353_11289145 | Ga0206353_112891452 | 135 |
| 223 | 3300020082 | Ga0206353_11538786 | Ga0206353_115387862 | 135 |
| 224 | 3300025900 | Ga0207710_10012016 | Ga0207710_100120164 | 135 |
| 225 | 3300025904 | Ga0207647_10044329 | Ga0207647_100443293 | 135 |
| 226 | 3300025909 | Ga0207705_10033205 | Ga0207705_100332054 | 135 |
| 227 | 3300025909 | Ga0207705_10195142 | Ga0207705_101951423 | 135 |
| 228 | 3300025912 | Ga0207707_10000071 | Ga0207707_1000007122 | 135 |
| 229 | 3300025912 | Ga0207707_10271851 | Ga0207707_102718513 | 135 |
| 230 | 3300025913 | Ga0207695_10433163 | Ga0207695_104331633 | 135 |
| 231 | 3300025914 | Ga0207671_10015276 | Ga0207671_100152766 | 135 |
| 232 | 3300025917 | Ga0207660_10000774 | Ga0207660_1000077419 | 135 |
| 233 | 3300025921 | Ga0207652_10005984 | Ga0207652_100059847 | 135 |
| 234 | 3300025921 | Ga0207652_10517397 | Ga0207652_105173971 | 135 |
| 235 | 3300025944 | Ga0207661_10056355 | Ga0207661_100563553 | 135 |
| 236 | 3300025949 | Ga0207667_10073802 | Ga0207667_100738025 | 135 |
| 237 | 3300025981 | Ga0207640_10167100 | Ga0207640_101671003 | 135 |
| 238 | 3300026067 | Ga0207678_10227820 | Ga0207678_102278203 | 135 |
| 239 | 3300044684 | Ga0466966_0238552 | Ga0466966_0238552_68_475 | 135 |
| 240 | 3300044694 | Ga0466963_0415447 | Ga0466963_0415447_496_903 | 135 |
| 241 | 3300048903 | Ga0496100_0719968 | Ga0496100_0719968_333_743 | 135 |
| 242 | 3300048905 | Ga0496102_0000029 | Ga0496102_0000029_44514_44924 | 135 |
| 243 | 3300048920 | Ga0496117_0171105 | Ga0496117_0171105_323_733 | 135 |
| 244 | 3300048921 | Ga0496118_0012908 | Ga0496118_0012908_7147_7557 | 135 |
| 245 | 3300048922 | Ga0496119_0130771 | Ga0496119_0130771_289_699 | 135 |
| 246 | 3300048924 | Ga0496121_0099163 | Ga0496121_0099163_673_1083 | 135 |
| 247 | 3300049568 | Ga0501031_0035269 | Ga0501031_0035269_874_1281 | 135 |
| 248 | 3300049569 | Ga0501032_0047634 | Ga0501032_0047634_163_570 | 135 |
| 249 | 3300049570 | Ga0501033_0065700 | Ga0501033_0065700_146_553 | 135 |
| 250 | 3300049570 | Ga0501033_0081372 | Ga0501033_0081372_1080_1487 | 135 |
| 251 | 3300049571 | Ga0501034_0060646 | Ga0501034_0060646_677_1084 | 135 |
| 252 | 3300049572 | Ga0501036_0311393 | Ga0501036_0311393_448_855 | 135 |
| 253 | 3300049573 | Ga0501037_0207856 | Ga0501037_0207856_653_1060 | 135 |
| 254 | 3300049574 | Ga0501038_0005774 | Ga0501038_0005774_9625_10032 | 135 |
| 255 | 3300049575 | Ga0501039_0301262 | Ga0501039_0301262_133_540 | 135 |
| 256 | 3300049579 | Ga0501043_0168231 | Ga0501043_0168231_711_1118 | 135 |
| 257 | 3300049581 | Ga0501047_0001104 | Ga0501047_0001104_3421_3828 | 135 |
| 258 | 3300049582 | Ga0501048_0002743 | Ga0501048_0002743_6912_7319 | 135 |
| 259 | 3300049586 | Ga0501070_0012279 | Ga0501070_0012279_6181_6588 | 135 |
| 260 | 3300049590 | Ga0501074_0352617 | Ga0501074_0352617_68_475 | 135 |
| 261 | 3300049742 | Ga0501080_1288402 | Ga0501080_1288402_106_513 | 135 |
| 262 | 3300049822 | Ga0501035_0004467 | Ga0501035_0004467_6664_7071 | 135 |
| 263 | 3300049823 | Ga0501044_0104869 | Ga0501044_0104869_515_922 | 135 |
| 264 | 3300060353 | Ga0501082_0522404 | Ga0501082_0522404_419_826 | 135 |
| 265 | 3300009176 | Ga0105242_11544703 | Ga0105242_115447032 | 136 |
| 266 | 3300013306 | Ga0163162_12502191 | Ga0163162_125021912 | 136 |
| 267 | 3300014325 | Ga0163163_10897654 | Ga0163163_108976541 | 136 |
| 268 | 3300039450 | Ga0436363_0554910 | Ga0436363_0554910_34_444 | 136 |
| 269 | 3300045976 | Ga0466967_1541111 | Ga0466967_1541111_205_615 | 136 |
| 270 | 3300048907 | Ga0496104_0260200 | Ga0496104_0260200_385_798 | 136 |
| 271 | 3300048908 | Ga0496105_0204057 | Ga0496105_0204057_436_849 | 136 |
| 272 | 3300048911 | Ga0496108_0017784 | Ga0496108_0017784_1019_1432 | 136 |
| 273 | 3300048912 | Ga0496109_0003689 | Ga0496109_0003689_4887_5300 | 136 |
| 274 | 3300048913 | Ga0496110_0007230 | Ga0496110_0007230_6312_6725 | 136 |
| 275 | 3300048914 | Ga0496111_0352103 | Ga0496111_0352103_486_899 | 136 |
| 276 | 3300048915 | Ga0496112_0001388 | Ga0496112_0001388_9503_9916 | 136 |
| 277 | 3300005327 | Ga0070658_10318537 | Ga0070658_103185371 | 137 |
| 278 | 3300005337 | Ga0070682_100436139 | Ga0070682_1004361392 | 137 |
| 279 | 3300005367 | Ga0070667_100455687 | Ga0070667_1004556873 | 137 |
| 280 | 3300005435 | Ga0070714_100000116 | Ga0070714_1000001166 | 137 |
| 281 | 3300005466 | Ga0070685_10201729 | Ga0070685_102017292 | 137 |
| 282 | 3300005563 | Ga0068855_101399768 | Ga0068855_1013997682 | 137 |
| 283 | 3300005564 | Ga0070664_101421256 | Ga0070664_1014212562 | 137 |
| 284 | 3300009551 | Ga0105238_10121863 | Ga0105238_101218631 | 137 |
| 285 | 3300009551 | Ga0105238_10126091 | Ga0105238_101260913 | 137 |
| 286 | 3300013307 | Ga0157372_10000023 | Ga0157372_1000002323 | 137 |
| 287 | 3300020082 | Ga0206353_11266225 | Ga0206353_112662252 | 137 |
| 288 | 3300025924 | Ga0207694_10119551 | Ga0207694_101195513 | 137 |
| 289 | 3300025924 | Ga0207694_10857208 | Ga0207694_108572082 | 137 |
| 290 | 3300025929 | Ga0207664_10000002 | Ga0207664_10000002390 | 137 |
| 291 | 3300025986 | Ga0207658_10018711 | Ga0207658_100187116 | 137 |
| 292 | 3300035695 | Ga0373927_0348187 | Ga0373927_0348187_474_887 | 137 |
| 293 | 3300036401 | Ga0373937_0746865 | Ga0373937_0746865_101_514 | 137 |
| 294 | 3300037068 | Ga0373925_0751505 | Ga0373925_0751505_36_449 | 137 |
| 295 | 3300044719 | Ga0466971_0214181 | Ga0466971_0214181_95_523 | 137 |
| 296 | 3300045836 | Ga0466958_0358629 | Ga0466958_0358629_480_893 | 137 |
| 297 | 3300045976 | Ga0466967_1927117 | Ga0466967_1927117_138_551 | 137 |
| 298 | 3300046517 | Ga0495630_0561881 | Ga0495630_0561881_443_856 | 137 |
| 299 | 3300046529 | Ga0495652_0637574 | Ga0495652_0637574_120_533 | 137 |
| 300 | 3300046543 | Ga0495645_0535328 | Ga0495645_0535328_279_692 | 137 |
| 301 | 3300047673 | Ga0495593_0370337 | Ga0495593_0370337_74_487 | 137 |
| 302 | 3300048912 | Ga0496109_0041851 | Ga0496109_0041851_3596_4009 | 137 |
| 303 | 3300048912 | Ga0496109_0681892 | Ga0496109_0681892_221_634 | 137 |
| 304 | 3300048915 | Ga0496112_0137710 | Ga0496112_0137710_306_719 | 137 |
| 305 | 3300048915 | Ga0496112_1658003 | Ga0496112_1658003_26_439 | 137 |
| 306 | 3300048916 | Ga0496113_0168451 | Ga0496113_0168451_1258_1671 | 137 |
| 307 | 3300061719 | Ga0466962_0573216 | Ga0466962_0573216_39_467 | 137 |
| 308 | 3300005457 | Ga0070662_100665005 | Ga0070662_1006650052 | 138 |
| 309 | 3300006844 | Ga0075428_102321746 | Ga0075428_1023217461 | 138 |
| 310 | 3300009094 | Ga0111539_11481957 | Ga0111539_114819571 | 138 |
| 311 | 3300009147 | Ga0114129_10716548 | Ga0114129_107165481 | 138 |
| 312 | 3300028558 | Ga0265326_10198280 | Ga0265326_101982802 | 138 |
| 313 | 3300028563 | Ga0265319_1025457 | Ga0265319_10254573 | 138 |
| 314 | 3300028573 | Ga0265334_10079102 | Ga0265334_100791022 | 138 |
| 315 | 3300028800 | Ga0265338_10003370 | Ga0265338_1000337016 | 138 |
| 316 | 3300031240 | Ga0265320_10113960 | Ga0265320_101139602 | 138 |
| 317 | 3300031241 | Ga0265325_10025920 | Ga0265325_100259203 | 138 |
| 318 | 3300031249 | Ga0265339_10004122 | Ga0265339_100041227 | 138 |
| 319 | 3300031249 | Ga0265339_10278887 | Ga0265339_102788872 | 138 |
| 320 | 3300031250 | Ga0265331_10461918 | Ga0265331_104619181 | 138 |
| 321 | 3300031250 | Ga0265331_10474103 | Ga0265331_104741031 | 138 |
| 322 | 3300031251 | Ga0265327_10252790 | Ga0265327_102527901 | 138 |
| 323 | 3300031344 | Ga0265316_10105219 | Ga0265316_101052192 | 138 |
| 324 | 3300031595 | Ga0265313_10000368 | Ga0265313_1000036838 | 138 |
| 325 | 3300031711 | Ga0265314_10087920 | Ga0265314_100879203 | 138 |
| 326 | 3300031711 | Ga0265314_10274085 | Ga0265314_102740853 | 138 |
| 327 | 3300031995 | Ga0307409_101643912 | Ga0307409_1016439122 | 138 |
| 328 | 3300032126 | Ga0307415_100179948 | Ga0307415_1001799482 | 138 |
| 329 | 3300048918 | Ga0496115_0383416 | Ga0496115_0383416_10_429 | 138 |
| 330 | 3300048929 | Ga0496126_0000013 | Ga0496126_0000013_86433_86849 | 138 |
| 331 | 3300049589 | Ga0501073_0046242 | Ga0501073_0046242_757_1176 | 138 |
| 332 | 3300050507 | nmdc:mga05p37_966312_c1 | nmdc:mga05p37_966312_c1_41_460 | 138 |
| 333 | 3300053077 | Ga0495601_0677208 | Ga0495601_0677208_78_497 | 138 |
| 334 | 3300060353 | Ga0501082_0790385 | Ga0501082_0790385_322_741 | 138 |
| 335 | 3300053151 | Ga0500604_0077841 | Ga0500604_0077841_504_926 | 139 |
| 336 | 3300002067 | JGI24735J21928_10010955 | JGI24735J21928_100109553 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cg0-assembly1.cif.gz_p | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.8214 | 2 | 138 |
| 7cg0-assembly1.cif.gz_i | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.8212 | 2 | 136 |
| 7cg0-assembly1.cif.gz_h | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.8135 | 2 | 136 |
| 7cg0-assembly1.cif.gz_p | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.81 | 2 | 138 |
| 7cg0-assembly1.cif.gz_g | cryo-em structure of the flagellar proximal rod with flif peptides from salmonella | 0.8084 | 2 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HEZ3_130_415_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.9757 | 101 | 131 | 1.20.1270.60 |
| af_G5EDU9_166_462_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.831 | 3 | 137 | 2.60.40.150 |
| 5jdhA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.6905 | 104 | 138 | 6.10.280.80 |
| 5jdmA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.6866 | 101 | 138 | 6.10.280.80 |
| 5jdfA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.6865 | 104 | 138 | 6.10.280.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7WZ28-F1-model_v4 | Flagellar basal-body rod protein FlgC | 0.9762 | 4 | 142 |
|
| AF-A0A7W7WZ28-F1-model_v4 | Flagellar basal-body rod protein FlgC | 0.9614 | 4 | 142 |
|
| AF-A0A6J4JWE2-F1-model_v4 | Flagellar basal-body rod protein FlgC | 0.9569 | 4 | 140 |
GO:0030694
GO:0071978 |
| AF-A0A7V1XNU3-F1-model_v4 | Flagellar basal-body rod protein FlgC | 0.9527 | 2 | 142 |
GO:0030694
GO:0071978 |
| AF-A0A7K0JY81-F1-model_v4 | deleted | 0.9425 | 4 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar