F412502

General Info

Members Datasets Scaffolds Average Seq Length
336 209 313 132

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10010955|JGI24735J21928_100109553
Length 142
Sequence MSIFGAMNTSGTGMSTMRSWLDVLANNIANVNTVRPTSQNAFQASYVEVSEIKGDSSAAPGDAAGHGVEITTLRQGSAEGRLTYQPDNPLADKKGYVRLPDVDLGEQMGNLIMAQRGFQANAAVIDRARTVYEAAINIGKNH

Samples

Sample ID Description Type Environment
1 2643221553 Microbacterium sp. Root553 Isolate Unclassified
2 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
3 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
4 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
5 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
6 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
7 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
8 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
9 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
10 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
11 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
12 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
13 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
14 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
15 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
16 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
17 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
18 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
19 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
20 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
21 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
22 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
23 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
130 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
131 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
138 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
139 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
140 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
206 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.07
Metatranscriptomes 2.08
Isolates 6.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 9.52
Rhizosphere 74.7
Stem 0
Stem Tuber 0
Unclassified 13.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10010955 3300002067 Bacteria 2881
2 JGI25406J46586_10001287 3300003203 Bacteria 11799
3 rootH2_10187235 3300003320 Bacteria 4914
4 Ga0070658_10000157 3300005327 Bacteria 60238
5 Ga0070658_10005852 3300005327 Bacteria 9970
6 Ga0070658_10099740 3300005327 Bacteria 2400
7 Ga0070658_10318537 3300005327 Bacteria 1328
8 Ga0070658_10511259 3300005327 Bacteria 1038
9 Ga0070658_10828287 3300005327 Unclassified 804
10 Ga0070658_10965774 3300005327 Bacteria 741
11 Ga0070683_100018404 3300005329 Bacteria 6187
12 Ga0070683_100657940 3300005329 Bacteria 1003
13 Ga0070680_100000038 3300005336 Bacteria 66468
14 Ga0070680_100181911 3300005336 Bacteria 1770
15 Ga0070680_100698287 3300005336 Bacteria 873
16 Ga0070682_100061465 3300005337 Bacteria 2377
17 Ga0070682_100436139 3300005337 Bacteria 1000
18 Ga0068868_100438469 3300005338 Bacteria 1134
19 Ga0070659_100646178 3300005366 Bacteria 912
20 Ga0070667_100455687 3300005367 Bacteria 1169
21 Ga0070714_100000116 3300005435 Bacteria 64800
22 Ga0070714_100002504 3300005435 Bacteria 13550
23 Ga0070714_100441702 3300005435 Bacteria 1235
24 Ga0070711_100759469 3300005439 Bacteria 820
25 Ga0070663_100302412 3300005455 Bacteria 1281
26 Ga0070663_101562338 3300005455 Bacteria 588
27 Ga0070662_100665005 3300005457 Bacteria 879
28 Ga0070681_10000106 3300005458 Bacteria 62398
29 Ga0070681_10304195 3300005458 Bacteria 1504
30 Ga0070681_11749666 3300005458 Bacteria 548
31 Ga0070685_10201729 3300005466 Bacteria 1293
32 Ga0070679_100000026 3300005530 Bacteria 115669
33 Ga0070679_100147226 3300005530 Bacteria 2332
34 Ga0070679_100651790 3300005530 Bacteria 996
35 Ga0070684_100201079 3300005535 Bacteria 1815
36 Ga0070684_100424702 3300005535 Bacteria 1227
37 Ga0068855_100092706 3300005563 Bacteria 3483
38 Ga0068855_101399768 3300005563 Bacteria 721
39 Ga0068855_101932388 3300005563 Bacteria 597
40 Ga0070664_101421256 3300005564 Bacteria 656
41 Ga0068857_102528355 3300005577 Bacteria 504
42 Ga0068854_100124726 3300005578 Bacteria 1960
43 Ga0068856_100041209 3300005614 Bacteria 4537
44 Ga0068856_100229956 3300005614 Bacteria 1870
45 Ga0068856_100681977 3300005614 Bacteria 1048
46 Ga0068852_100348227 3300005616 Bacteria 1446
47 Ga0068852_100474110 3300005616 Bacteria 1243
48 Ga0068852_100947171 3300005616 Bacteria 879
49 Ga0068859_100030443 3300005617 Bacteria 5416
50 Ga0068864_100426957 3300005618 Bacteria 1264
51 Ga0068863_100067348 3300005841 Bacteria 3387
52 Ga0081540_1007049 3300005983 Bacteria 8081
53 Ga0081539_10048172 3300005985 Bacteria 2427
54 Ga0081539_10104127 3300005985 Bacteria 1441
55 Ga0070717_10324099 3300006028 Bacteria 1373
56 Ga0075365_10277438 3300006038 Bacteria 1179
57 Ga0075367_10074499 3300006178 Bacteria 2047
58 Ga0075428_102321746 3300006844 Unclassified 552
59 Ga0097620_100030443 3300006931 Bacteria 5416
60 Ga0105240_10695434 3300009093 Bacteria 1110
61 Ga0111539_11481957 3300009094 Bacteria 787
62 Ga0105247_10003370 3300009101 Bacteria 10454
63 Ga0114129_10716548 3300009147 Bacteria 1284
64 Ga0105242_11544703 3300009176 Bacteria 696
65 Ga0105237_10020837 3300009545 Bacteria 6751
66 Ga0105237_10583496 3300009545 Bacteria 1125
67 Ga0105238_10121863 3300009551 Bacteria 2587
68 Ga0105238_10126091 3300009551 Bacteria 2538
69 Ga0105238_11111412 3300009551 Bacteria 813
70 Ga0105239_10028455 3300010375 Bacteria 6147
71 Ga0105239_13131649 3300010375 Bacteria 539
72 Ga0157371_10001726 3300013102 Bacteria 22181
73 Ga0157371_10133178 3300013102 Bacteria 1769
74 Ga0157371_10152439 3300013102 Bacteria 1649
75 Ga0157370_10863627 3300013104 Bacteria 822
76 Ga0157369_10265286 3300013105 Bacteria 1790
77 Ga0157369_10357388 3300013105 Bacteria 1517
78 Ga0157369_10836809 3300013105 Bacteria 945
79 Ga0163162_12502191 3300013306 Unclassified 594
80 Ga0157372_10000023 3300013307 Bacteria 198536
81 Ga0157372_10098689 3300013307 Bacteria 3332
82 Ga0157372_11603066 3300013307 Bacteria 749
83 Ga0163163_10897654 3300014325 Bacteria 950
84 Ga0182008_10340943 3300014497 Bacteria 793
85 Ga0182008_10737637 3300014497 Bacteria 566
86 Ga0157377_11133310 3300014745 Bacteria 601
87 Ga0206354_10353655 3300020081 Bacteria 1043
88 Ga0206354_10914441 3300020081 Bacteria 649
89 Ga0206353_10445773 3300020082 Bacteria 2297
90 Ga0206353_11266225 3300020082 Bacteria 3277
91 Ga0206353_11289145 3300020082 Bacteria 938
92 Ga0206353_11538786 3300020082 Bacteria 2510
93 Ga0206353_11790157 3300020082 Bacteria 570
94 Ga0207656_10304171 3300025321 Bacteria 790
95 Ga0207710_10012016 3300025900 Bacteria 3640
96 Ga0207647_10044329 3300025904 Bacteria 2780
97 Ga0207705_10002261 3300025909 Bacteria 14896
98 Ga0207705_10033205 3300025909 Bacteria 3687
99 Ga0207705_10195142 3300025909 Bacteria 1532
100 Ga0207707_10000071 3300025912 Bacteria 102604
101 Ga0207707_10271851 3300025912 Bacteria 1469
102 Ga0207695_10433163 3300025913 Bacteria 1198
103 Ga0207671_10015276 3300025914 Bacteria 6025
104 Ga0207660_10000774 3300025917 Bacteria 21256
105 Ga0207660_10208009 3300025917 Bacteria 1531
106 Ga0207652_10005984 3300025921 Bacteria 9844
107 Ga0207652_10517397 3300025921 Bacteria 1074
108 Ga0207694_10119551 3300025924 Bacteria 2103
109 Ga0207694_10857208 3300025924 Bacteria 768
110 Ga0207694_10980411 3300025924 Bacteria 715
111 Ga0207687_10351394 3300025927 Bacteria 1201
112 Ga0207664_10000002 3300025929 Bacteria 657053
113 Ga0207664_10005336 3300025929 Bacteria 8780
114 Ga0207664_10791287 3300025929 Bacteria 853
115 Ga0207661_10056355 3300025944 Bacteria 3155
116 Ga0207667_10073802 3300025949 Bacteria 3545
117 Ga0207640_10167100 3300025981 Bacteria 1635
118 Ga0207658_10018711 3300025986 Bacteria 4788
119 Ga0207677_11809698 3300026023 Bacteria 567
120 Ga0207678_10227820 3300026067 Bacteria 1596
121 Ga0207678_11236208 3300026067 Bacteria 661
122 Ga0207702_10620170 3300026078 Bacteria 1062
123 Ga0207641_10071311 3300026088 Bacteria 2988
124 Ga0207698_10191232 3300026142 Bacteria 1823
125 Ga0265326_10198280 3300028558 Bacteria 576
126 Ga0265319_1025457 3300028563 Bacteria 2117
127 Ga0265334_10009096 3300028573 Bacteria 4211
128 Ga0265334_10079102 3300028573 Bacteria 1213
129 Ga0307515_10405238 3300028794 Bacteria 988
130 Ga0265338_10003370 3300028800 Bacteria 22562
131 Ga0265320_10113960 3300031240 Bacteria 1237
132 Ga0265325_10025920 3300031241 Bacteria 3180
133 Ga0265340_10001266 3300031247 Bacteria 14505
134 Ga0265339_10004122 3300031249 Bacteria 10017
135 Ga0265339_10278887 3300031249 Bacteria 802
136 Ga0265331_10461918 3300031250 Bacteria 571
137 Ga0265331_10474103 3300031250 Unclassified 563
138 Ga0265327_10252790 3300031251 Bacteria 784
139 Ga0265316_10105219 3300031344 Bacteria 2141
140 Ga0307513_10005977 3300031456 Bacteria 15977
141 Ga0265313_10000368 3300031595 Bacteria 48821
142 Ga0265314_10087920 3300031711 Bacteria 2030
143 Ga0265314_10274085 3300031711 Unclassified 957
144 Ga0307405_10641673 3300031731 Bacteria 872
145 Ga0307413_10600229 3300031824 Bacteria 901
146 Ga0307410_10427934 3300031852 Bacteria 1075
147 Ga0307406_10000027 3300031901 Bacteria 91856
148 Ga0307406_10117147 3300031901 Bacteria 1845
149 Ga0307407_10366827 3300031903 Bacteria 1024
150 Ga0307409_100936192 3300031995 Bacteria 882
151 Ga0307409_101512835 3300031995 Bacteria 699
152 Ga0307409_101643912 3300031995 Bacteria 671
153 Ga0307414_10164831 3300032004 Bacteria 1765
154 Ga0307411_10162283 3300032005 Bacteria 1676
155 Ga0307415_100179948 3300032126 Bacteria 1658
156 Ga0373927_0348187 3300035695 Bacteria 976
157 Ga0373937_0746865 3300036401 Unclassified 926
158 Ga0316584_0362307 3300036712 Bacteria 1039
159 Ga0373925_0751505 3300037068 Bacteria 804
160 Ga0395900_0515012 3300037418 Bacteria 1145
161 Ga0395900_0628642 3300037418 Bacteria 1012
162 Ga0395898_0306256 3300037466 Bacteria 1515
163 Ga0395905_0051901 3300037471 Bacteria 3841
164 Ga0395901_0052141 3300038443 Bacteria 4252
165 Ga0395901_0108704 3300038443 Bacteria 2911
166 Ga0395901_0286834 3300038443 Bacteria 1709
167 Ga0400485_01612 3300038735 Bacteria 30354
168 Ga0400488_52972 3300038741 Bacteria 7479
169 Ga0400486_23270 3300038742 Bacteria 10183
170 Ga0436363_0554910 3300039450 Bacteria 515
171 Ga0436363_1247137 3300039450 Bacteria 2267
172 Ga0436363_1596252 3300039450 Bacteria 609
173 Ga0451793_0711570 3300041452 Unclassified 616
174 Ga0451793_1564418 3300041452 Bacteria 736
175 Ga0451797_1454330 3300041453 Bacteria 926
176 Ga0451795_0096960 3300041456 Bacteria 1581
177 Ga0451807_1156497 3300041486 Bacteria 738
178 Ga0451833_0340883 3300041491 Bacteria 844
179 Ga0451851_0712998 3300041507 Bacteria 830
180 Ga0451843_1102626 3300041509 Bacteria 1962
181 Ga0451843_1284714 3300041509 Bacteria 695
182 Ga0451855_0740312 3300041511 Bacteria 893
183 Ga0466972_0116042 3300044658 Bacteria 1264
184 Ga0466972_0292035 3300044658 Bacteria 762
185 Ga0466965_0100834 3300044683 Bacteria 1476
186 Ga0466965_0166302 3300044683 Bacteria 1158
187 Ga0466966_0238552 3300044684 Bacteria 1096
188 Ga0466966_0528938 3300044684 Bacteria 709
189 Ga0466966_0800845 3300044684 Bacteria 568
190 Ga0466961_0154739 3300044693 Bacteria 1430
191 Ga0466961_0312415 3300044693 Bacteria 959
192 Ga0466961_0452329 3300044693 Bacteria 777
193 Ga0466961_0828775 3300044693 Bacteria 552
194 Ga0466963_0098688 3300044694 Bacteria 1997
195 Ga0466963_0304636 3300044694 Bacteria 1121
196 Ga0466963_0415447 3300044694 Unclassified 949
197 Ga0466963_1127066 3300044694 Bacteria 552
198 Ga0466964_0205171 3300044706 Bacteria 949
199 Ga0466971_0038330 3300044719 Bacteria 2151
200 Ga0466971_0214181 3300044719 Bacteria 912
201 Ga0466971_0283386 3300044719 Bacteria 793
202 Ga0466968_0292113 3300044735 Bacteria 782
203 Ga0466970_0030162 3300044765 Bacteria 2859
204 Ga0466970_0054757 3300044765 Bacteria 2130
205 Ga0466970_0093396 3300044765 Bacteria 1634
206 Ga0466970_0163577 3300044765 Bacteria 1231
207 Ga0466970_0174058 3300044765 Bacteria 1193
208 Ga0466970_0204316 3300044765 Bacteria 1099
209 Ga0466970_0304912 3300044765 Bacteria 899
210 Ga0466970_0611364 3300044765 Bacteria 633
211 Ga0466957_0133419 3300044842 Bacteria 1594
212 Ga0466957_0598828 3300044842 Bacteria 771
213 Ga0466957_1324874 3300044842 Bacteria 523
214 Ga0466960_0072829 3300044901 Bacteria 1713
215 Ga0466960_0285753 3300044901 Bacteria 926
216 Ga0466959_0085232 3300045049 Bacteria 2274
217 Ga0466959_0872850 3300045049 Bacteria 600
218 Ga0466958_0151510 3300045836 Bacteria 1463
219 Ga0466958_0197847 3300045836 Bacteria 1279
220 Ga0466958_0210792 3300045836 Bacteria 1238
221 Ga0466958_0358629 3300045836 Bacteria 939
222 Ga0466958_0475786 3300045836 Bacteria 810
223 Ga0466967_0505587 3300045976 Bacteria 1186
224 Ga0466967_0676376 3300045976 Bacteria 1022
225 Ga0466967_1541111 3300045976 Bacteria 662
226 Ga0466967_1927117 3300045976 Bacteria 588
227 Ga0495650_0259311 3300046471 Bacteria 589
228 Ga0495608_0820745 3300046511 Bacteria 548
229 Ga0495620_0143030 3300046515 Bacteria 935
230 Ga0495630_0561881 3300046517 Bacteria 875
231 Ga0495652_0637574 3300046529 Unclassified 723
232 Ga0495609_0064414 3300046538 Bacteria 1617
233 Ga0495597_0121372 3300046542 Bacteria 1089
234 Ga0495645_0535328 3300046543 Unclassified 728
235 Ga0495593_0370337 3300047673 Unclassified 716
236 Ga0496100_0719968 3300048903 Bacteria 779
237 Ga0496100_1051128 3300048903 Bacteria 641
238 Ga0496101_0199953 3300048904 Bacteria 1545
239 Ga0496102_0000029 3300048905 Bacteria 222195
240 Ga0496102_0403772 3300048905 Bacteria 1284
241 Ga0496104_0260200 3300048907 Bacteria 1648
242 Ga0496104_0636422 3300048907 Bacteria 976
243 Ga0496105_0123399 3300048908 Bacteria 2135
244 Ga0496105_0204057 3300048908 Bacteria 1613
245 Ga0496108_0017784 3300048911 Bacteria 5813
246 Ga0496108_0218413 3300048911 Bacteria 1656
247 Ga0496109_0003689 3300048912 Bacteria 12801
248 Ga0496109_0041851 3300048912 Bacteria 4150
249 Ga0496109_0681892 3300048912 Bacteria 965
250 Ga0496109_1253963 3300048912 Bacteria 678
251 Ga0496110_0007230 3300048913 Bacteria 8847
252 Ga0496110_0470510 3300048913 Bacteria 1145
253 Ga0496111_0352103 3300048914 Bacteria 1090
254 Ga0496111_0442131 3300048914 Bacteria 960
255 Ga0496112_0001388 3300048915 Bacteria 18480
256 Ga0496112_0137710 3300048915 Bacteria 2411
257 Ga0496112_0833680 3300048915 Bacteria 846
258 Ga0496112_1658003 3300048915 Bacteria 552
259 Ga0496113_0168451 3300048916 Bacteria 1734
260 Ga0496113_1374968 3300048916 Bacteria 547
261 Ga0496115_0093517 3300048918 Bacteria 2458
262 Ga0496115_0383416 3300048918 Bacteria 1143
263 Ga0496117_0004584 3300048920 Bacteria 15115
264 Ga0496117_0171105 3300048920 Bacteria 1261
265 Ga0496118_0000270 3300048921 Bacteria 91081
266 Ga0496118_0012908 3300048921 Bacteria 7955
267 Ga0496118_0058736 3300048921 Bacteria 2871
268 Ga0496119_0130771 3300048922 Bacteria 1368
269 Ga0496119_0152561 3300048922 Bacteria 1236
270 Ga0496119_0180042 3300048922 Bacteria 1109
271 Ga0496120_0041793 3300048923 Bacteria 2682
272 Ga0496121_0099163 3300048924 Bacteria 2252
273 Ga0496122_0001848 3300048925 Bacteria 32283
274 Ga0496122_0141485 3300048925 Bacteria 1504
275 Ga0496123_0000112 3300048926 Bacteria 163990
276 Ga0496123_0183586 3300048926 Bacteria 1089
277 Ga0496124_0002132 3300048927 Bacteria 26592
278 Ga0496124_0044855 3300048927 Bacteria 3792
279 Ga0496124_0110503 3300048927 Bacteria 2213
280 Ga0496126_0000013 3300048929 Bacteria 690046
281 Ga0496126_0392892 3300048929 Bacteria 1127
282 Ga0501031_0035269 3300049568 Bacteria 3263
283 Ga0501032_0047634 3300049569 Bacteria 2894
284 Ga0501033_0065700 3300049570 Bacteria 2669
285 Ga0501033_0081372 3300049570 Bacteria 2375
286 Ga0501034_0060646 3300049571 Bacteria 3800
287 Ga0501036_0311393 3300049572 Bacteria 1316
288 Ga0501037_0207856 3300049573 Bacteria 1381
289 Ga0501038_0005774 3300049574 Bacteria 11462
290 Ga0501039_0301262 3300049575 Bacteria 1260
291 Ga0501043_0168231 3300049579 Bacteria 1711
292 Ga0501047_0001104 3300049581 Bacteria 26810
293 Ga0501048_0002743 3300049582 Bacteria 13429
294 Ga0501070_0012279 3300049586 Bacteria 7229
295 Ga0501073_0046242 3300049589 Bacteria 3062
296 Ga0501074_0352617 3300049590 Bacteria 1044
297 Ga0501080_1288402 3300049742 Unclassified 626
298 Ga0501035_0004467 3300049822 Bacteria 13276
299 Ga0501044_0104869 3300049823 Bacteria 2840
300 nmdc:mga06z11_26971_c1 3300050494 Bacteria 2741
301 nmdc:mga05p37_966312_c1 3300050507 Bacteria 909
302 Ga0495601_0677208 3300053077 Bacteria 659
303 Ga0500628_016731 3300053129 Bacteria 1422
304 Ga0500628_018623 3300053129 Bacteria 1372
305 Ga0500604_0077841 3300053151 Bacteria 1067
306 Ga0500616_0002092 3300053153 Bacteria 17409
307 Ga0501082_0522404 3300060353 Bacteria 1038
308 Ga0501082_0790385 3300060353 Bacteria 830
309 Ga0466962_0215761 3300061719 Bacteria 939
310 Ga0466962_0309157 3300061719 Bacteria 783
311 Ga0466962_0429949 3300061719 Bacteria 663
312 Ga0466962_0573216 3300061719 Bacteria 574
313 Ga0466962_0659440 3300061719 Bacteria 535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_1156497 Ga0451807_1156497_292_696 110
2 3300031731 Ga0307405_10641673 Ga0307405_106416732 112
3 3300031852 Ga0307410_10427934 Ga0307410_104279342 112
4 3300031903 Ga0307407_10366827 Ga0307407_103668272 112
5 3300041452 Ga0451793_1564418 Ga0451793_1564418_13_357 114
6 3300041453 Ga0451797_1454330 Ga0451797_1454330_481_843 114
7 3300048913 Ga0496110_0470510 Ga0496110_0470510_19_363 114
8 3300061719 Ga0466962_0659440 Ga0466962_0659440_11_355 114
9 3300005336 Ga0070680_100181911 Ga0070680_1001819112 117
10 3300005366 Ga0070659_100646178 Ga0070659_1006461782 117
11 3300005455 Ga0070663_101562338 Ga0070663_1015623382 117
12 3300005458 Ga0070681_11749666 Ga0070681_117496661 117
13 3300005530 Ga0070679_100147226 Ga0070679_1001472262 117
14 3300013105 Ga0157369_10357388 Ga0157369_103573883 117
15 3300020082 Ga0206353_10445773 Ga0206353_104457733 117
16 3300025917 Ga0207660_10208009 Ga0207660_102080092 117
17 3300026067 Ga0207678_11236208 Ga0207678_112362082 117
18 3300044658 Ga0466972_0292035 Ga0466972_0292035_107_499 117
19 3300044693 Ga0466961_0312415 Ga0466961_0312415_326_718 117
20 3300044842 Ga0466957_0598828 Ga0466957_0598828_184_576 117
21 3300045836 Ga0466958_0475786 Ga0466958_0475786_347_739 117
22 3300061719 Ga0466962_0215761 Ga0466962_0215761_25_417 117
23 3300005337 Ga0070682_100061465 Ga0070682_1000614653 118
24 3300005577 Ga0068857_102528355 Ga0068857_1025283552 118
25 3300025927 Ga0207687_10351394 Ga0207687_103513942 118
26 3300037466 Ga0395898_0306256 Ga0395898_0306256_443_847 118
27 3300037471 Ga0395905_0051901 Ga0395905_0051901_2521_2925 118
28 3300005327 Ga0070658_10828287 Ga0070658_108282872 120
29 3300038443 Ga0395901_0052141 Ga0395901_0052141_2076_2480 120
30 3300036712 Ga0316584_0362307 Ga0316584_0362307_21_386 121
31 3300044694 Ga0466963_0304636 Ga0466963_0304636_92_496 121
32 3300048916 Ga0496113_1374968 Ga0496113_1374968_162_527 121
33 3300046542 Ga0495597_0121372 Ga0495597_0121372_247_618 123
34 3300046511 Ga0495608_0820745 Ga0495608_0820745_155_529 124
35 iso_pu_bacteria 2643221553 2643785909 125
36 iso_pu_bacteria 2643221724 2644680314 125
37 iso_pu_bacteria 2728369380 2730229766 125
38 iso_pu_bacteria 2747842429 2747954663 125
39 iso_pu_bacteria 2808606368 2808884194 125
40 iso_pu_bacteria 2857720070 2857723078 125
41 iso_pu_bacteria 2857723135 2857723958 125
42 iso_pu_bacteria 2928090899 2928093616 125
43 iso_pu_bacteria 2984580707 2984582690 125
44 3300044693 Ga0466961_0452329 Ga0466961_0452329_85_483 126
45 3300061719 Ga0466962_0309157 Ga0466962_0309157_166_564 126
46 iso_pu_bacteria 2643221567 2643851658 126
47 iso_pu_bacteria 2643221624 2644137751 126
48 iso_pu_bacteria 2751185788 2753301906 126
49 iso_pu_bacteria 2904430863 2904432971 126
50 iso_pu_bacteria 2904501621 2904502905 126
51 iso_pu_bacteria 2908674828 2908675919 126
52 iso_pu_bacteria 2909074476 2909074978 126
53 iso_pu_bacteria 2919039151 2919041146 126
54 iso_pu_bacteria 2919042368 2919044532 126
55 iso_pu_bacteria 2928500415 2928502241 126
56 iso_pu_bacteria 2966924647 2966926465 126
57 iso_pu_bacteria 2984551494 2984554053 126
58 3300044683 Ga0466965_0100834 Ga0466965_0100834_374_760 127
59 3300044693 Ga0466961_0154739 Ga0466961_0154739_440_826 127
60 3300044719 Ga0466971_0038330 Ga0466971_0038330_1191_1577 127
61 3300044719 Ga0466971_0283386 Ga0466971_0283386_151_537 127
62 3300044765 Ga0466970_0030162 Ga0466970_0030162_457_843 127
63 3300044765 Ga0466970_0093396 Ga0466970_0093396_886_1272 127
64 3300044765 Ga0466970_0174058 Ga0466970_0174058_100_486 127
65 3300044765 Ga0466970_0204316 Ga0466970_0204316_67_453 127
66 3300044765 Ga0466970_0611364 Ga0466970_0611364_147_533 127
67 3300044901 Ga0466960_0072829 Ga0466960_0072829_891_1277 127
68 3300045836 Ga0466958_0151510 Ga0466958_0151510_510_896 127
69 3300045836 Ga0466958_0210792 Ga0466958_0210792_507_893 127
70 3300045976 Ga0466967_0676376 Ga0466967_0676376_256_642 127
71 3300046471 Ga0495650_0259311 Ga0495650_0259311_159_545 127
72 3300061719 Ga0466962_0429949 Ga0466962_0429949_37_423 127
73 iso_pu_bacteria 2919446982 2919448348 127
74 3300005327 Ga0070658_10000157 Ga0070658_1000015748 128
75 3300005616 Ga0068852_100947171 Ga0068852_1009471713 128
76 3300013102 Ga0157371_10001726 Ga0157371_100017267 128
77 3300013102 Ga0157371_10133178 Ga0157371_101331782 128
78 3300020082 Ga0206353_11790157 Ga0206353_117901572 128
79 3300037418 Ga0395900_0515012 Ga0395900_0515012_301_690 128
80 3300038443 Ga0395901_0108704 Ga0395901_0108704_185_574 128
81 3300044684 Ga0466966_0528938 Ga0466966_0528938_284_673 128
82 3300044693 Ga0466961_0828775 Ga0466961_0828775_113_502 128
83 3300044694 Ga0466963_1127066 Ga0466963_1127066_119_508 128
84 3300044842 Ga0466957_0133419 Ga0466957_0133419_32_421 128
85 3300048912 Ga0496109_1253963 Ga0496109_1253963_116_502 128
86 3300048914 Ga0496111_0442131 Ga0496111_0442131_119_505 128
87 iso_pu_bacteria 2734482000 2734968418 128
88 3300003320 rootH2_10187235 rootH2_101872352 129
89 3300005329 Ga0070683_100657940 Ga0070683_1006579403 129
90 3300005435 Ga0070714_100002504 Ga0070714_10000250415 129
91 3300013307 Ga0157372_11603066 Ga0157372_116030662 129
92 3300025929 Ga0207664_10005336 Ga0207664_100053363 129
93 3300031824 Ga0307413_10600229 Ga0307413_106002292 129
94 3300031901 Ga0307406_10000027 Ga0307406_1000002722 129
95 3300031995 Ga0307409_100936192 Ga0307409_1009361922 129
96 3300031995 Ga0307409_101512835 Ga0307409_1015128352 129
97 3300032004 Ga0307414_10164831 Ga0307414_101648313 129
98 3300044765 Ga0466970_0163577 Ga0466970_0163577_797_1189 129
99 3300048908 Ga0496105_0123399 Ga0496105_0123399_726_1118 129
100 3300048918 Ga0496115_0093517 Ga0496115_0093517_544_936 129
101 3300048922 Ga0496119_0152561 Ga0496119_0152561_277_669 129
102 3300048927 Ga0496124_0110503 Ga0496124_0110503_821_1213 129
103 3300048929 Ga0496126_0392892 Ga0496126_0392892_142_534 129
104 3300037418 Ga0395900_0628642 Ga0395900_0628642_312_713 130
105 3300038443 Ga0395901_0286834 Ga0395901_0286834_590_991 130
106 3300044735 Ga0466968_0292113 Ga0466968_0292113_295_690 130
107 3300044765 Ga0466970_0054757 Ga0466970_0054757_1196_1591 130
108 3300046515 Ga0495620_0143030 Ga0495620_0143030_64_459 130
109 3300046538 Ga0495609_0064414 Ga0495609_0064414_673_1068 130
110 3300048903 Ga0496100_1051128 Ga0496100_1051128_99_494 130
111 3300048904 Ga0496101_0199953 Ga0496101_0199953_22_417 130
112 3300048905 Ga0496102_0403772 Ga0496102_0403772_510_905 130
113 3300048920 Ga0496117_0004584 Ga0496117_0004584_10126_10521 130
114 3300048921 Ga0496118_0000270 Ga0496118_0000270_17960_18355 130
115 3300048922 Ga0496119_0180042 Ga0496119_0180042_348_743 130
116 3300048923 Ga0496120_0041793 Ga0496120_0041793_2030_2425 130
117 3300048925 Ga0496122_0141485 Ga0496122_0141485_536_931 130
118 3300048926 Ga0496123_0183586 Ga0496123_0183586_167_562 130
119 3300048927 Ga0496124_0002132 Ga0496124_0002132_17924_18319 130
120 3300005327 Ga0070658_10005852 Ga0070658_100058526 131
121 3300005327 Ga0070658_10511259 Ga0070658_105112592 131
122 3300006028 Ga0070717_10324099 Ga0070717_103240992 131
123 3300014497 Ga0182008_10340943 Ga0182008_103409432 131
124 3300025909 Ga0207705_10002261 Ga0207705_100022616 131
125 3300031901 Ga0307406_10117147 Ga0307406_101171473 131
126 3300032005 Ga0307411_10162283 Ga0307411_101622833 131
127 3300041511 Ga0451855_0740312 Ga0451855_0740312_16_411 131
128 3300003203 JGI25406J46586_10001287 JGI25406J46586_100012879 132
129 3300005338 Ga0068868_100438469 Ga0068868_1004384691 132
130 3300005435 Ga0070714_100441702 Ga0070714_1004417023 132
131 3300005563 Ga0068855_101932388 Ga0068855_1019323881 132
132 3300005614 Ga0068856_100229956 Ga0068856_1002299563 132
133 3300005616 Ga0068852_100474110 Ga0068852_1004741102 132
134 3300005618 Ga0068864_100426957 Ga0068864_1004269573 132
135 3300005841 Ga0068863_100067348 Ga0068863_1000673484 132
136 3300005983 Ga0081540_1007049 Ga0081540_10070496 132
137 3300005985 Ga0081539_10048172 Ga0081539_100481722 132
138 3300005985 Ga0081539_10104127 Ga0081539_101041272 132
139 3300009551 Ga0105238_11111412 Ga0105238_111114122 132
140 3300013104 Ga0157370_10863627 Ga0157370_108636272 132
141 3300013105 Ga0157369_10836809 Ga0157369_108368092 132
142 3300013307 Ga0157372_10098689 Ga0157372_100986895 132
143 3300014497 Ga0182008_10737637 Ga0182008_107376371 132
144 3300014745 Ga0157377_11133310 Ga0157377_111333101 132
145 3300025321 Ga0207656_10304171 Ga0207656_103041712 132
146 3300025924 Ga0207694_10980411 Ga0207694_109804112 132
147 3300025929 Ga0207664_10791287 Ga0207664_107912871 132
148 3300026023 Ga0207677_11809698 Ga0207677_118096982 132
149 3300026078 Ga0207702_10620170 Ga0207702_106201702 132
150 3300026088 Ga0207641_10071311 Ga0207641_100713113 132
151 3300026142 Ga0207698_10191232 Ga0207698_101912322 132
152 3300028573 Ga0265334_10009096 Ga0265334_100090965 132
153 3300028794 Ga0307515_10405238 Ga0307515_104052382 132
154 3300031456 Ga0307513_10005977 Ga0307513_100059779 132
155 3300038741 Ga0400488_52972 Ga0400488_52972_3146_3544 132
156 3300039450 Ga0436363_1247137 Ga0436363_1247137_594_992 132
157 3300039450 Ga0436363_1596252 Ga0436363_1596252_145_543 132
158 3300041452 Ga0451793_0711570 Ga0451793_0711570_33_431 132
159 3300041456 Ga0451795_0096960 Ga0451795_0096960_569_967 132
160 3300041491 Ga0451833_0340883 Ga0451833_0340883_268_666 132
161 3300041507 Ga0451851_0712998 Ga0451851_0712998_134_532 132
162 3300041509 Ga0451843_1102626 Ga0451843_1102626_691_1089 132
163 3300041509 Ga0451843_1284714 Ga0451843_1284714_238_636 132
164 3300044658 Ga0466972_0116042 Ga0466972_0116042_483_881 132
165 3300044683 Ga0466965_0166302 Ga0466965_0166302_584_982 132
166 3300044684 Ga0466966_0800845 Ga0466966_0800845_100_498 132
167 3300044694 Ga0466963_0098688 Ga0466963_0098688_748_1146 132
168 3300044706 Ga0466964_0205171 Ga0466964_0205171_31_429 132
169 3300044765 Ga0466970_0304912 Ga0466970_0304912_309_707 132
170 3300044842 Ga0466957_1324874 Ga0466957_1324874_54_452 132
171 3300044901 Ga0466960_0285753 Ga0466960_0285753_130_528 132
172 3300045049 Ga0466959_0085232 Ga0466959_0085232_1409_1807 132
173 3300045049 Ga0466959_0872850 Ga0466959_0872850_95_493 132
174 3300045836 Ga0466958_0197847 Ga0466958_0197847_411_809 132
175 3300045976 Ga0466967_0505587 Ga0466967_0505587_425_823 132
176 3300048907 Ga0496104_0636422 Ga0496104_0636422_106_504 132
177 3300048911 Ga0496108_0218413 Ga0496108_0218413_1021_1419 132
178 3300048915 Ga0496112_0833680 Ga0496112_0833680_101_499 132
179 3300053129 Ga0500628_016731 Ga0500628_016731_546_944 132
180 3300053129 Ga0500628_018623 Ga0500628_018623_666_1064 132
181 3300053153 Ga0500616_0002092 Ga0500616_0002092_9800_10198 132
182 3300006038 Ga0075365_10277438 Ga0075365_102774382 133
183 3300006178 Ga0075367_10074499 Ga0075367_100744993 133
184 3300031247 Ga0265340_10001266 Ga0265340_100012668 133
185 3300050494 nmdc:mga06z11_26971_c1 nmdc:mga06z11_26971_c1_1002_1403 133
186 3300005439 Ga0070711_100759469 Ga0070711_1007594692 134
187 3300010375 Ga0105239_13131649 Ga0105239_131316492 134
188 3300013102 Ga0157371_10152439 Ga0157371_101524393 134
189 3300038735 Ga0400485_01612 Ga0400485_01612_6254_6658 134
190 3300038742 Ga0400486_23270 Ga0400486_23270_7007_7411 134
191 3300048921 Ga0496118_0058736 Ga0496118_0058736_60_464 134
192 3300048925 Ga0496122_0001848 Ga0496122_0001848_10494_10898 134
193 3300048926 Ga0496123_0000112 Ga0496123_0000112_21412_21816 134
194 3300048927 Ga0496124_0044855 Ga0496124_0044855_3114_3518 134
195 3300005327 Ga0070658_10099740 Ga0070658_100997403 135
196 3300005327 Ga0070658_10965774 Ga0070658_109657742 135
197 3300005329 Ga0070683_100018404 Ga0070683_1000184046 135
198 3300005336 Ga0070680_100000038 Ga0070680_1000000389 135
199 3300005336 Ga0070680_100698287 Ga0070680_1006982872 135
200 3300005455 Ga0070663_100302412 Ga0070663_1003024122 135
201 3300005458 Ga0070681_10000106 Ga0070681_1000010650 135
202 3300005458 Ga0070681_10304195 Ga0070681_103041952 135
203 3300005530 Ga0070679_100000026 Ga0070679_10000002619 135
204 3300005530 Ga0070679_100651790 Ga0070679_1006517902 135
205 3300005535 Ga0070684_100201079 Ga0070684_1002010793 135
206 3300005535 Ga0070684_100424702 Ga0070684_1004247022 135
207 3300005563 Ga0068855_100092706 Ga0068855_1000927062 135
208 3300005578 Ga0068854_100124726 Ga0068854_1001247263 135
209 3300005614 Ga0068856_100041209 Ga0068856_1000412093 135
210 3300005614 Ga0068856_100681977 Ga0068856_1006819773 135
211 3300005616 Ga0068852_100348227 Ga0068852_1003482273 135
212 3300005617 Ga0068859_100030443 Ga0068859_1000304435 135
213 3300006931 Ga0097620_100030443 Ga0097620_1000304435 135
214 3300009093 Ga0105240_10695434 Ga0105240_106954343 135
215 3300009101 Ga0105247_10003370 Ga0105247_1000337011 135
216 3300009545 Ga0105237_10020837 Ga0105237_100208376 135
217 3300009545 Ga0105237_10583496 Ga0105237_105834961 135
218 3300010375 Ga0105239_10028455 Ga0105239_100284553 135
219 3300013105 Ga0157369_10265286 Ga0157369_102652863 135
220 3300020081 Ga0206354_10353655 Ga0206354_103536552 135
221 3300020081 Ga0206354_10914441 Ga0206354_109144411 135
222 3300020082 Ga0206353_11289145 Ga0206353_112891452 135
223 3300020082 Ga0206353_11538786 Ga0206353_115387862 135
224 3300025900 Ga0207710_10012016 Ga0207710_100120164 135
225 3300025904 Ga0207647_10044329 Ga0207647_100443293 135
226 3300025909 Ga0207705_10033205 Ga0207705_100332054 135
227 3300025909 Ga0207705_10195142 Ga0207705_101951423 135
228 3300025912 Ga0207707_10000071 Ga0207707_1000007122 135
229 3300025912 Ga0207707_10271851 Ga0207707_102718513 135
230 3300025913 Ga0207695_10433163 Ga0207695_104331633 135
231 3300025914 Ga0207671_10015276 Ga0207671_100152766 135
232 3300025917 Ga0207660_10000774 Ga0207660_1000077419 135
233 3300025921 Ga0207652_10005984 Ga0207652_100059847 135
234 3300025921 Ga0207652_10517397 Ga0207652_105173971 135
235 3300025944 Ga0207661_10056355 Ga0207661_100563553 135
236 3300025949 Ga0207667_10073802 Ga0207667_100738025 135
237 3300025981 Ga0207640_10167100 Ga0207640_101671003 135
238 3300026067 Ga0207678_10227820 Ga0207678_102278203 135
239 3300044684 Ga0466966_0238552 Ga0466966_0238552_68_475 135
240 3300044694 Ga0466963_0415447 Ga0466963_0415447_496_903 135
241 3300048903 Ga0496100_0719968 Ga0496100_0719968_333_743 135
242 3300048905 Ga0496102_0000029 Ga0496102_0000029_44514_44924 135
243 3300048920 Ga0496117_0171105 Ga0496117_0171105_323_733 135
244 3300048921 Ga0496118_0012908 Ga0496118_0012908_7147_7557 135
245 3300048922 Ga0496119_0130771 Ga0496119_0130771_289_699 135
246 3300048924 Ga0496121_0099163 Ga0496121_0099163_673_1083 135
247 3300049568 Ga0501031_0035269 Ga0501031_0035269_874_1281 135
248 3300049569 Ga0501032_0047634 Ga0501032_0047634_163_570 135
249 3300049570 Ga0501033_0065700 Ga0501033_0065700_146_553 135
250 3300049570 Ga0501033_0081372 Ga0501033_0081372_1080_1487 135
251 3300049571 Ga0501034_0060646 Ga0501034_0060646_677_1084 135
252 3300049572 Ga0501036_0311393 Ga0501036_0311393_448_855 135
253 3300049573 Ga0501037_0207856 Ga0501037_0207856_653_1060 135
254 3300049574 Ga0501038_0005774 Ga0501038_0005774_9625_10032 135
255 3300049575 Ga0501039_0301262 Ga0501039_0301262_133_540 135
256 3300049579 Ga0501043_0168231 Ga0501043_0168231_711_1118 135
257 3300049581 Ga0501047_0001104 Ga0501047_0001104_3421_3828 135
258 3300049582 Ga0501048_0002743 Ga0501048_0002743_6912_7319 135
259 3300049586 Ga0501070_0012279 Ga0501070_0012279_6181_6588 135
260 3300049590 Ga0501074_0352617 Ga0501074_0352617_68_475 135
261 3300049742 Ga0501080_1288402 Ga0501080_1288402_106_513 135
262 3300049822 Ga0501035_0004467 Ga0501035_0004467_6664_7071 135
263 3300049823 Ga0501044_0104869 Ga0501044_0104869_515_922 135
264 3300060353 Ga0501082_0522404 Ga0501082_0522404_419_826 135
265 3300009176 Ga0105242_11544703 Ga0105242_115447032 136
266 3300013306 Ga0163162_12502191 Ga0163162_125021912 136
267 3300014325 Ga0163163_10897654 Ga0163163_108976541 136
268 3300039450 Ga0436363_0554910 Ga0436363_0554910_34_444 136
269 3300045976 Ga0466967_1541111 Ga0466967_1541111_205_615 136
270 3300048907 Ga0496104_0260200 Ga0496104_0260200_385_798 136
271 3300048908 Ga0496105_0204057 Ga0496105_0204057_436_849 136
272 3300048911 Ga0496108_0017784 Ga0496108_0017784_1019_1432 136
273 3300048912 Ga0496109_0003689 Ga0496109_0003689_4887_5300 136
274 3300048913 Ga0496110_0007230 Ga0496110_0007230_6312_6725 136
275 3300048914 Ga0496111_0352103 Ga0496111_0352103_486_899 136
276 3300048915 Ga0496112_0001388 Ga0496112_0001388_9503_9916 136
277 3300005327 Ga0070658_10318537 Ga0070658_103185371 137
278 3300005337 Ga0070682_100436139 Ga0070682_1004361392 137
279 3300005367 Ga0070667_100455687 Ga0070667_1004556873 137
280 3300005435 Ga0070714_100000116 Ga0070714_1000001166 137
281 3300005466 Ga0070685_10201729 Ga0070685_102017292 137
282 3300005563 Ga0068855_101399768 Ga0068855_1013997682 137
283 3300005564 Ga0070664_101421256 Ga0070664_1014212562 137
284 3300009551 Ga0105238_10121863 Ga0105238_101218631 137
285 3300009551 Ga0105238_10126091 Ga0105238_101260913 137
286 3300013307 Ga0157372_10000023 Ga0157372_1000002323 137
287 3300020082 Ga0206353_11266225 Ga0206353_112662252 137
288 3300025924 Ga0207694_10119551 Ga0207694_101195513 137
289 3300025924 Ga0207694_10857208 Ga0207694_108572082 137
290 3300025929 Ga0207664_10000002 Ga0207664_10000002390 137
291 3300025986 Ga0207658_10018711 Ga0207658_100187116 137
292 3300035695 Ga0373927_0348187 Ga0373927_0348187_474_887 137
293 3300036401 Ga0373937_0746865 Ga0373937_0746865_101_514 137
294 3300037068 Ga0373925_0751505 Ga0373925_0751505_36_449 137
295 3300044719 Ga0466971_0214181 Ga0466971_0214181_95_523 137
296 3300045836 Ga0466958_0358629 Ga0466958_0358629_480_893 137
297 3300045976 Ga0466967_1927117 Ga0466967_1927117_138_551 137
298 3300046517 Ga0495630_0561881 Ga0495630_0561881_443_856 137
299 3300046529 Ga0495652_0637574 Ga0495652_0637574_120_533 137
300 3300046543 Ga0495645_0535328 Ga0495645_0535328_279_692 137
301 3300047673 Ga0495593_0370337 Ga0495593_0370337_74_487 137
302 3300048912 Ga0496109_0041851 Ga0496109_0041851_3596_4009 137
303 3300048912 Ga0496109_0681892 Ga0496109_0681892_221_634 137
304 3300048915 Ga0496112_0137710 Ga0496112_0137710_306_719 137
305 3300048915 Ga0496112_1658003 Ga0496112_1658003_26_439 137
306 3300048916 Ga0496113_0168451 Ga0496113_0168451_1258_1671 137
307 3300061719 Ga0466962_0573216 Ga0466962_0573216_39_467 137
308 3300005457 Ga0070662_100665005 Ga0070662_1006650052 138
309 3300006844 Ga0075428_102321746 Ga0075428_1023217461 138
310 3300009094 Ga0111539_11481957 Ga0111539_114819571 138
311 3300009147 Ga0114129_10716548 Ga0114129_107165481 138
312 3300028558 Ga0265326_10198280 Ga0265326_101982802 138
313 3300028563 Ga0265319_1025457 Ga0265319_10254573 138
314 3300028573 Ga0265334_10079102 Ga0265334_100791022 138
315 3300028800 Ga0265338_10003370 Ga0265338_1000337016 138
316 3300031240 Ga0265320_10113960 Ga0265320_101139602 138
317 3300031241 Ga0265325_10025920 Ga0265325_100259203 138
318 3300031249 Ga0265339_10004122 Ga0265339_100041227 138
319 3300031249 Ga0265339_10278887 Ga0265339_102788872 138
320 3300031250 Ga0265331_10461918 Ga0265331_104619181 138
321 3300031250 Ga0265331_10474103 Ga0265331_104741031 138
322 3300031251 Ga0265327_10252790 Ga0265327_102527901 138
323 3300031344 Ga0265316_10105219 Ga0265316_101052192 138
324 3300031595 Ga0265313_10000368 Ga0265313_1000036838 138
325 3300031711 Ga0265314_10087920 Ga0265314_100879203 138
326 3300031711 Ga0265314_10274085 Ga0265314_102740853 138
327 3300031995 Ga0307409_101643912 Ga0307409_1016439122 138
328 3300032126 Ga0307415_100179948 Ga0307415_1001799482 138
329 3300048918 Ga0496115_0383416 Ga0496115_0383416_10_429 138
330 3300048929 Ga0496126_0000013 Ga0496126_0000013_86433_86849 138
331 3300049589 Ga0501073_0046242 Ga0501073_0046242_757_1176 138
332 3300050507 nmdc:mga05p37_966312_c1 nmdc:mga05p37_966312_c1_41_460 138
333 3300053077 Ga0495601_0677208 Ga0495601_0677208_78_497 138
334 3300060353 Ga0501082_0790385 Ga0501082_0790385_322_741 138
335 3300053151 Ga0500604_0077841 Ga0500604_0077841_504_926 139
336 3300002067 JGI24735J21928_10010955 JGI24735J21928_100109553 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00460

Flg_bb_rod

Flagella basal body rod protein

7

37

0.95

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

93

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8214 2 138
7cg0-assembly1.cif.gz_i cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8212 2 136
7cg0-assembly1.cif.gz_h cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8135 2 136
7cg0-assembly1.cif.gz_p cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.81 2 138
7cg0-assembly1.cif.gz_g cryo-em structure of the flagellar proximal rod with flif peptides from salmonella 0.8084 2 139
ID Description Score Start End Superfamily
af_A0A1D6HEZ3_130_415_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9757 101 131 1.20.1270.60
af_G5EDU9_166_462_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.831 3 137 2.60.40.150
5jdhA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6905 104 138 6.10.280.80
5jdmA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6866 101 138 6.10.280.80
5jdfA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6865 104 138 6.10.280.80
ID Description Score Start End GO Terms
AF-A0A7W7WZ28-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9762 4 142
AF-A0A7W7WZ28-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9614 4 142
AF-A0A6J4JWE2-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9569 4 140 GO:0030694
GO:0071978
AF-A0A7V1XNU3-F1-model_v4 Flagellar basal-body rod protein FlgC 0.9527 2 142 GO:0030694
GO:0071978
AF-A0A7K0JY81-F1-model_v4 deleted 0.9425 4 138

Feature Viewer

pLDDT pTM Quality
83.95 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map