F412440

General Info

Members Datasets Scaffolds Average Seq Length
335 237 670 246

Family's Representative Sequence

Representative Sequence 3300049649|Ga0501198_000020|Ga0501198_000020_34996_35868
Length 290
Sequence MLTRLKSLVAVGALLLAAWLGVLPMPSVAQPSDGSAARIEAPVPVAPAASAEKEVVDNPYGLQALWAQGDFIAKGTLIVLMIMSLGSWYIIVTKLYESLKISSEAKAARRRFFEQKTLLDATQTLKEGSAFRFIAETGIEASNHHEGALTEHIDRNTWVTMSVQRSVDDVNSRLQDGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGIAGQASIDKVAGPVGEALIMTAIGLFVAVPAVLGYNWLVRRNKVTMEAVRGFAADLHGVLMGARLAVPSSSRSPYGDERRQL

Samples

Sample ID Description Type Environment
1 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
191 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
192 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
193 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
194 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
195 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
206 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
207 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
208 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
214 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
234 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
235 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
236 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
237 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 1.19
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.19
Nodule 0.6
Rhizoplane 0.6
Rhizosphere 74.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501198_000020 3300049649 Bacteria 75919
2 JGI25152J39213_1003012 3300002773 Bacteria 5955
3 JGI25152J39213_1005518 3300002773 Bacteria 3663
4 JGI25150J39212_1002405 3300002774 Bacteria 4686
5 JGI25153J46596_10004402 3300003215 Bacteria 7603
6 JGI25153J46596_10005639 3300003215 Bacteria 6537
7 JGI25153J46596_10023574 3300003215 Bacteria 2239
8 Ga0055525_1000013 3300003759 Bacteria 440870
9 Ga0055526_1002267 3300003771 Bacteria 13145
10 Ga0055526_1012625 3300003771 Bacteria 3663
11 Ga0055524_1022573 3300003775 Bacteria 2051
12 Ga0055528_1013771 3300003790 Bacteria 3043
13 Ga0055530_10005091 3300003791 Bacteria 6445
14 Ga0065165_1012301 3300005262 Bacteria 3493
15 Ga0065707_10014439 3300005295 Bacteria 1752
16 Ga0070658_10248542 3300005327 Bacteria 1509
17 Ga0070676_10031110 3300005328 Bacteria 3047
18 Ga0070670_100155581 3300005331 Bacteria 1979
19 Ga0070666_10326183 3300005335 Bacteria 1096
20 Ga0068868_100056003 3300005338 Bacteria 3113
21 Ga0070660_100001633 3300005339 Bacteria 15421
22 Ga0070661_100134591 3300005344 Bacteria 1858
23 Ga0070675_100109340 3300005354 Bacteria 2336
24 Ga0070671_100098380 3300005355 Bacteria 2454
25 Ga0070671_100195978 3300005355 Bacteria 1712
26 Ga0070673_100048020 3300005364 Bacteria 3325
27 Ga0070659_100104438 3300005366 Bacteria 2282
28 Ga0070667_100187185 3300005367 Bacteria 1832
29 Ga0070667_100473983 3300005367 Bacteria 1146
30 Ga0070708_100336813 3300005445 Bacteria 1422
31 Ga0070663_100047610 3300005455 Bacteria 3037
32 Ga0070681_10201629 3300005458 Bacteria 1908
33 Ga0068867_100082203 3300005459 Bacteria 2429
34 Ga0068867_100107468 3300005459 Bacteria 2138
35 Ga0070706_100013540 3300005467 Bacteria 7540
36 Ga0070706_100275046 3300005467 Bacteria 1571
37 Ga0070698_100013266 3300005471 Bacteria 8719
38 Ga0068853_100461480 3300005539 Bacteria 1196
39 Ga0070693_100174119 3300005547 Bacteria 1380
40 Ga0068855_100080350 3300005563 Bacteria 3781
41 Ga0068855_100264471 3300005563 Bacteria 1915
42 Ga0068855_100651207 3300005563 Bacteria 1131
43 Ga0070664_100093274 3300005564 Bacteria 2608
44 Ga0070664_100184232 3300005564 Bacteria 1857
45 Ga0068857_100138036 3300005577 Bacteria 2202
46 Ga0068854_100106793 3300005578 Bacteria 2106
47 Ga0068852_100050463 3300005616 Bacteria 3565
48 Ga0068852_100072638 3300005616 Bacteria 3024
49 Ga0068852_100165917 3300005616 Bacteria 2066
50 Ga0068852_100266957 3300005616 Bacteria 1645
51 Ga0068859_100183306 3300005617 Bacteria 2177
52 Ga0068859_100379680 3300005617 Bacteria 1508
53 Ga0068863_100175145 3300005841 Bacteria 2058
54 Ga0068860_100183325 3300005843 Bacteria 2024
55 Ga0068860_100200329 3300005843 Bacteria 1934
56 Ga0068862_100016054 3300005844 Bacteria 6227
57 Ga0068862_100103725 3300005844 Bacteria 2490
58 Ga0075368_10085676 3300006042 Bacteria 1285
59 Ga0075364_10100812 3300006051 Bacteria 1922
60 Ga0075364_10303674 3300006051 Bacteria 1086
61 Ga0075367_10032516 3300006178 Bacteria 3002
62 Ga0075367_10147311 3300006178 Bacteria 1460
63 Ga0075366_10012267 3300006195 Bacteria 4858
64 Ga0075366_10091816 3300006195 Bacteria 1819
65 Ga0075366_10109993 3300006195 Bacteria 1657
66 Ga0075366_10130025 3300006195 Bacteria 1519
67 Ga0097621_100096904 3300006237 Bacteria 2476
68 Ga0075370_10003613 3300006353 Bacteria 7399
69 Ga0068871_100558257 3300006358 Bacteria 1038
70 Ga0075428_100380246 3300006844 Bacteria 1514
71 Ga0075430_100033000 3300006846 Bacteria 4394
72 Ga0075431_100002497 3300006847 Bacteria 17736
73 Ga0075431_100270784 3300006847 Bacteria 1721
74 Ga0075429_100000450 3300006880 Bacteria 30632
75 Ga0075429_100001338 3300006880 Bacteria 20124
76 Ga0068865_100114390 3300006881 Bacteria 1995
77 Ga0097620_100183310 3300006931 Bacteria 2177
78 Ga0097620_100379699 3300006931 Bacteria 1508
79 Ga0099823_1009434 3300006944 Bacteria 9912
80 Ga0105240_10029261 3300009093 Bacteria 7181
81 Ga0105245_10121165 3300009098 Bacteria 2444
82 Ga0114129_10000300 3300009147 Bacteria 57502
83 Ga0114129_10516483 3300009147 Bacteria 1558
84 Ga0105243_10283623 3300009148 Bacteria 1493
85 Ga0105243_10454730 3300009148 Bacteria 1202
86 Ga0105241_10093439 3300009174 Bacteria 2377
87 Ga0105242_10398504 3300009176 Bacteria 1284
88 Ga0105237_10168838 3300009545 Bacteria 2187
89 Ga0105238_10364196 3300009551 Bacteria 1435
90 Ga0105249_10503433 3300009553 Bacteria 1257
91 Ga0105239_10323741 3300010375 Bacteria 1738
92 Ga0157370_10002793 3300013104 Bacteria 20861
93 Ga0157370_10076483 3300013104 Bacteria 3153
94 Ga0157370_10337951 3300013104 Bacteria 1388
95 Ga0157378_10206124 3300013297 Bacteria 1862
96 Ga0157378_10253369 3300013297 Bacteria 1686
97 Ga0157375_10553531 3300013308 Bacteria 1312
98 Ga0157377_10000082 3300014745 Bacteria 74078
99 Ga0157379_10040550 3300014968 Bacteria 4156
100 Ga0182006_1017106 3300015261 Bacteria 3087
101 Ga0163161_10000927 3300017792 Bacteria 22658
102 Ga0213872_10000160 3300021361 Bacteria 61551
103 Ga0213872_10002893 3300021361 Bacteria 9768
104 Ga0213872_10063667 3300021361 Bacteria 1666
105 Ga0209674_105497 3300025226 Bacteria 1862
106 Ga0209563_100025 3300025230 Bacteria 596456
107 Ga0209258_109999 3300025242 Bacteria 1249
108 Ga0207425_1000957 3300025245 Bacteria 13595
109 Ga0207425_1004235 3300025245 Bacteria 4355
110 Ga0209129_1000113 3300025258 Bacteria 145178
111 Ga0209565_1012914 3300025263 Bacteria 1973
112 Ga0209673_1004869 3300025273 Bacteria 7011
113 Ga0209673_1005834 3300025273 Bacteria 6102
114 Ga0209673_1018195 3300025273 Bacteria 2565
115 Ga0209564_1000186 3300025295 Bacteria 147120
116 Ga0209564_1012630 3300025295 Bacteria 3663
117 Ga0209758_1000172 3300025297 Bacteria 147763
118 Ga0209758_1000304 3300025297 Bacteria 95770
119 Ga0209758_1001201 3300025297 Bacteria 32708
120 Ga0209050_1003635 3300025298 Bacteria 11149
121 Ga0209050_1005955 3300025298 Bacteria 7414
122 Ga0209256_1004272 3300025299 Bacteria 9128
123 Ga0209256_1015517 3300025299 Bacteria 2657
124 Ga0209256_1016141 3300025299 Bacteria 2564
125 Ga0209051_1002822 3300025303 Bacteria 11970
126 Ga0209051_1010428 3300025303 Bacteria 4692
127 Ga0209257_1001091 3300025304 Bacteria 35384
128 Ga0209257_1015253 3300025304 Bacteria 3216
129 Ga0209257_1037607 3300025304 Bacteria 1474
130 Ga0207688_10065359 3300025901 Bacteria 2055
131 Ga0207645_10043463 3300025907 Bacteria 2876
132 Ga0207643_10251788 3300025908 Bacteria 1088
133 Ga0207684_10377576 3300025910 Bacteria 1219
134 Ga0207654_10050295 3300025911 Bacteria 2394
135 Ga0207707_10188233 3300025912 Bacteria 1801
136 Ga0207695_10043848 3300025913 Bacteria 4762
137 Ga0207671_10046173 3300025914 Bacteria 3222
138 Ga0207657_10003264 3300025919 Bacteria 17360
139 Ga0207649_10145720 3300025920 Bacteria 1625
140 Ga0207681_10076306 3300025923 Bacteria 2353
141 Ga0207694_10100284 3300025924 Bacteria 2294
142 Ga0207694_10173806 3300025924 Bacteria 1745
143 Ga0207659_10078669 3300025926 Bacteria 2430
144 Ga0207659_10158320 3300025926 Bacteria 1775
145 Ga0207644_10120838 3300025931 Bacteria 1994
146 Ga0207690_10089792 3300025932 Bacteria 2167
147 Ga0207706_10021392 3300025933 Bacteria 5809
148 Ga0207709_10089066 3300025935 Bacteria 2011
149 Ga0207709_10186755 3300025935 Bacteria 1469
150 Ga0207691_10021713 3300025940 Bacteria 6059
151 Ga0207689_10084239 3300025942 Bacteria 2613
152 Ga0207679_10012918 3300025945 Bacteria 5463
153 Ga0207679_10108235 3300025945 Bacteria 2188
154 Ga0207667_10012827 3300025949 Bacteria 9629
155 Ga0207667_10312555 3300025949 Bacteria 1605
156 Ga0207677_10089497 3300026023 Bacteria 2235
157 Ga0207639_10082689 3300026041 Bacteria 2546
158 Ga0207678_10032071 3300026067 Bacteria 4580
159 Ga0207678_10042701 3300026067 Bacteria 3926
160 Ga0207648_10040111 3300026089 Bacteria 4115
161 Ga0207648_10076828 3300026089 Bacteria 2911
162 Ga0207648_10243572 3300026089 Bacteria 1601
163 Ga0207676_10563744 3300026095 Bacteria 1090
164 Ga0207674_10014874 3300026116 Bacteria 8581
165 Ga0207683_10119564 3300026121 Bacteria 2364
166 Ga0207698_10005709 3300026142 Bacteria 7709
167 Ga0207698_10063246 3300026142 Bacteria 2895
168 Ga0207698_10069065 3300026142 Bacteria 2792
169 Ga0207698_10400076 3300026142 Bacteria 1312
170 Ga0209389_1029426 3300027296 Bacteria 4669
171 Ga0209969_1008865 3300027360 Bacteria 1428
172 Ga0209813_10104847 3300027866 Bacteria 967
173 Ga0268265_10045559 3300028380 Bacteria 3273
174 Ga0268264_10111722 3300028381 Bacteria 2394
175 Ga0268264_10410099 3300028381 Bacteria 1304
176 Ga0307515_10122972 3300028794 Bacteria 2922
177 Ga0307515_10202645 3300028794 Bacteria 1855
178 Ga0265338_10089818 3300028800 Bacteria 2545
179 Ga0265324_10000811 3300029957 Bacteria 20354
180 Ga0265320_10003351 3300031240 Bacteria 10806
181 Ga0265325_10011501 3300031241 Bacteria 5084
182 Ga0307513_10064647 3300031456 Bacteria 3854
183 Ga0307509_10013581 3300031507 Bacteria 9633
184 Ga0307408_100220128 3300031548 Bacteria 1548
185 Ga0307408_100253520 3300031548 Bacteria 1453
186 Ga0307508_10143657 3300031616 Bacteria 1990
187 Ga0265314_10000185 3300031711 Bacteria 92226
188 Ga0265314_10056652 3300031711 Bacteria 2697
189 Ga0307516_10106242 3300031730 Bacteria 2618
190 Ga0307516_10183850 3300031730 Bacteria 1821
191 Ga0307510_10060435 3300033180 Bacteria 3900
192 Ga0373941_0086226 3300035115 Bacteria 1069
193 Ga0373943_0290292 3300035170 Bacteria 927
194 Ga0373931_0148638 3300035691 Bacteria 1364
195 Ga0373927_0215060 3300035695 Bacteria 1263
196 Ga0373933_0289810 3300035724 Bacteria 1059
197 Ga0373947_0025771 3300035725 Bacteria 3430
198 Ga0395905_0030251 3300037471 Bacteria 5104
199 Ga0395905_0036617 3300037471 Bacteria 4608
200 Ga0436361_0362312 3300039447 Bacteria 55943
201 Ga0436361_0420928 3300039447 Bacteria 8330
202 Ga0436361_0918193 3300039447 Bacteria 8074
203 Ga0436361_0991333 3300039447 Bacteria 2270
204 Ga0436361_1051692 3300039447 Bacteria 7862
205 Ga0451577_0001132 3300042876 Bacteria 37818
206 Ga0466965_0000825 3300044683 Bacteria 11715
207 Ga0466961_0434003 3300044693 Bacteria 795
208 Ga0466963_0099695 3300044694 Bacteria 1987
209 Ga0466964_0015004 3300044706 Bacteria 2952
210 Ga0466964_0026587 3300044706 Bacteria 2266
211 Ga0453684_0000356 3300044712 Bacteria 189329
212 Ga0453684_0176715 3300044712 Bacteria 2510
213 Ga0453684_0177075 3300044712 Bacteria 2507
214 Ga0466968_0027754 3300044735 Bacteria 2330
215 Ga0466968_0059998 3300044735 Bacteria 1639
216 Ga0495603_0009874 3300046455 Bacteria 5777
217 Ga0495590_0040763 3300046457 Bacteria 1619
218 Ga0495590_0055793 3300046457 Bacteria 1380
219 Ga0495629_0010178 3300046459 Bacteria 6853
220 Ga0495638_0140856 3300046460 Bacteria 1408
221 Ga0495582_0003244 3300046473 Bacteria 9133
222 Ga0495585_0012502 3300046492 Bacteria 5000
223 Ga0495607_0045137 3300046501 Bacteria 2594
224 Ga0495583_0001309 3300046506 Bacteria 25885
225 Ga0495583_0033650 3300046506 Bacteria 2463
226 Ga0495583_0057889 3300046506 Bacteria 1742
227 Ga0495610_0095196 3300046512 Bacteria 1343
228 Ga0495616_0000057 3300046513 Bacteria 100806
229 Ga0495616_0003725 3300046513 Bacteria 9726
230 Ga0495616_0018608 3300046513 Bacteria 3808
231 Ga0495631_0120840 3300046518 Bacteria 1126
232 Ga0495637_0017232 3300046520 Bacteria 3371
233 Ga0495637_0103411 3300046520 Bacteria 1111
234 Ga0495643_0078549 3300046522 Bacteria 1722
235 Ga0495644_0004008 3300046523 Bacteria 5793
236 Ga0495644_0004991 3300046523 Bacteria 5196
237 Ga0495642_0015835 3300046528 Bacteria 2935
238 Ga0495652_0004706 3300046529 Bacteria 13004
239 Ga0495665_0153043 3300046531 Bacteria 1203
240 Ga0495609_0000257 3300046538 Bacteria 50114
241 Ga0495609_0055019 3300046538 Bacteria 1766
242 Ga0495609_0148152 3300046538 Bacteria 999
243 Ga0495597_0038926 3300046542 Bacteria 2130
244 Ga0495597_0043409 3300046542 Bacteria 2002
245 Ga0495645_0163370 3300046543 Bacteria 1538
246 Ga0495622_0002043 3300046557 Bacteria 9862
247 Ga0495633_0004937 3300046558 Bacteria 8335
248 Ga0495668_0000025 3300046616 Bacteria 304546
249 Ga0495668_0008619 3300046616 Bacteria 6340
250 Ga0495668_0112726 3300046616 Bacteria 1487
251 Ga0495611_0003743 3300046648 Bacteria 6639
252 Ga0495611_0159234 3300046648 Bacteria 1054
253 Ga0495625_0147922 3300046660 Bacteria 1580
254 Ga0495635_0094454 3300046663 Bacteria 2044
255 Ga0495661_0019544 3300046665 Bacteria 4437
256 Ga0495588_0006212 3300046674 Bacteria 5369
257 Ga0495658_0015897 3300046683 Bacteria 3868
258 Ga0495669_0000298 3300046684 Bacteria 27587
259 Ga0495669_0002374 3300046684 Bacteria 7723
260 Ga0495613_0122290 3300046689 Bacteria 1868
261 Ga0495624_0166236 3300046690 Bacteria 1346
262 Ga0495671_0092379 3300046692 Bacteria 1481
263 Ga0495660_0004510 3300046810 Bacteria 8420
264 Ga0495660_0019392 3300046810 Bacteria 3904
265 Ga0495660_0062301 3300046810 Bacteria 2000
266 Ga0495581_0018675 3300047315 Bacteria 4026
267 Ga0495687_000143 3300047443 Bacteria 108306
268 Ga0495687_104569 3300047443 Bacteria 1054
269 Ga0495685_000955 3300047447 Bacteria 8746
270 Ga0495673_0109089 3300047469 Bacteria 1109
271 Ga0495686_0024439 3300047472 Bacteria 3969
272 Ga0495626_0099054 3300048091 Bacteria 1272
273 Ga0496106_0323435 3300048909 Bacteria 1238
274 Ga0496113_0157001 3300048916 Bacteria 1797
275 Ga0496125_0003327 3300048928 Bacteria 19631
276 Ga0501294_001762 3300049517 Bacteria 2124
277 Ga0501298_004728 3300049521 Bacteria 2157
278 Ga0501300_008774 3300049523 Bacteria 1479
279 Ga0501301_001941 3300049524 Bacteria 1340
280 Ga0501303_000774 3300049526 Bacteria 2411
281 Ga0501315_004684 3300049531 Bacteria 1444
282 Ga0501316_013338 3300049532 Bacteria 970
283 Ga0501321_000564 3300049537 Bacteria 2459
284 Ga0501325_000076 3300049541 Bacteria 3080
285 Ga0501067_0010133 3300049583 Bacteria 5213
286 Ga0501068_0127081 3300049584 Bacteria 1592
287 Ga0501069_0000753 3300049585 Bacteria 15120
288 Ga0501070_0000609 3300049586 Bacteria 32789
289 Ga0501074_0000574 3300049590 Bacteria 22747
290 Ga0501076_0222927 3300049592 Bacteria 1541
291 Ga0501199_004858 3300049650 Bacteria 1338
292 Ga0501206_001245 3300049653 Bacteria 3192
293 Ga0501222_000025 3300049662 Bacteria 64191
294 Ga0501233_014247 3300049668 Bacteria 1622
295 Ga0501257_011240 3300049686 Bacteria 2041
296 Ga0501079_0009186 3300049741 Bacteria 7487
297 Ga0501080_0012487 3300049742 Bacteria 7789
298 Ga0501083_0005518 3300049744 Bacteria 8962
299 Ga0501265_000776 3300049762 Bacteria 3501
300 Ga0501281_02435 3300049777 Bacteria 1363
301 Ga0501044_0164130 3300049823 Bacteria 2196
302 nmdc:mga03683_45365_c1 3300050489 Bacteria 1819
303 nmdc:mga03683_59509_c1 3300050489 Bacteria 1612
304 nmdc:mga00v17_57067_c1 3300050491 Bacteria 2388
305 nmdc:mga0k408_11566_c1 3300050493 Bacteria 4809
306 nmdc:mga0k408_120812_c1 3300050493 Bacteria 1552
307 nmdc:mga0k408_21283_c1 3300050493 Bacteria 3641
308 nmdc:mga0k408_58173_c1 3300050493 Bacteria 2245
309 nmdc:mga0k408_58867_c1 3300050493 Bacteria 2232
310 nmdc:mga0k408_86546_c1 3300050493 Bacteria 1839
311 nmdc:mga06z11_13092_c1 3300050494 Bacteria 3631
312 nmdc:mga06z11_35933_c1 3300050494 Bacteria 2442
313 nmdc:mga04h51_48309_c1 3300050495 Bacteria 1418
314 nmdc:mga07m45_109123_c1 3300050496 Bacteria 1593
315 nmdc:mga07m45_110817_c1 3300050496 Bacteria 1581
316 nmdc:mga07m45_115531_c1 3300050496 Bacteria 1548
317 nmdc:mga07m45_129865_c1 3300050496 Bacteria 1458
318 nmdc:mga07m45_19763_c1 3300050496 Bacteria 3652
319 nmdc:mga05p37_490_c1 3300050507 Bacteria 43384
320 nmdc:mga09592_1296_c1 3300050508 Bacteria 20095
321 nmdc:mga09592_9_c1 3300050508 Bacteria 108110
322 nmdc:mga0qj67_19083_c1 3300050509 Bacteria 5236
323 nmdc:mga06r32_4669_c1 3300050510 Bacteria 12295
324 Ga0495601_0165561 3300053077 Bacteria 1445
325 Ga0500635_0160123 3300053080 Bacteria 863
326 Ga0495595_0174516 3300053084 Bacteria 1065
327 Ga0500658_0013940 3300053134 Bacteria 2973
328 Ga0500568_0023002 3300053139 Bacteria 2655
329 Ga0500604_0001437 3300053151 Bacteria 6654
330 Ga0500622_0055470 3300053156 Bacteria 2030
331 2587730460 2585428057 Bacteria 6737412
332 2588295863 2588253510 Bacteria 6901809
333 2644142356 2643221625 Bacteria 6512927
334 2644275043 2643221648 Bacteria 6521465
335 2909401653 2909399089 Bacteria 3922598
336 Ga0501198_000020
337 JGI25152J39213_1003012
338 JGI25152J39213_1005518
339 JGI25150J39212_1002405
340 JGI25153J46596_10004402
341 JGI25153J46596_10005639
342 JGI25153J46596_10023574
343 Ga0055525_1000013
344 Ga0055526_1002267
345 Ga0055526_1012625
346 Ga0055524_1022573
347 Ga0055528_1013771
348 Ga0055530_10005091
349 Ga0065165_1012301
350 Ga0065707_10014439
351 Ga0070658_10248542
352 Ga0070676_10031110
353 Ga0070670_100155581
354 Ga0070666_10326183
355 Ga0068868_100056003
356 Ga0070660_100001633
357 Ga0070661_100134591
358 Ga0070675_100109340
359 Ga0070671_100098380
360 Ga0070671_100195978
361 Ga0070673_100048020
362 Ga0070659_100104438
363 Ga0070667_100187185
364 Ga0070667_100473983
365 Ga0070708_100336813
366 Ga0070663_100047610
367 Ga0070681_10201629
368 Ga0068867_100082203
369 Ga0068867_100107468
370 Ga0070706_100013540
371 Ga0070706_100275046
372 Ga0070698_100013266
373 Ga0068853_100461480
374 Ga0070693_100174119
375 Ga0068855_100080350
376 Ga0068855_100264471
377 Ga0068855_100651207
378 Ga0070664_100093274
379 Ga0070664_100184232
380 Ga0068857_100138036
381 Ga0068854_100106793
382 Ga0068852_100050463
383 Ga0068852_100072638
384 Ga0068852_100165917
385 Ga0068852_100266957
386 Ga0068859_100183306
387 Ga0068859_100379680
388 Ga0068863_100175145
389 Ga0068860_100183325
390 Ga0068860_100200329
391 Ga0068862_100016054
392 Ga0068862_100103725
393 Ga0075368_10085676
394 Ga0075364_10100812
395 Ga0075364_10303674
396 Ga0075367_10032516
397 Ga0075367_10147311
398 Ga0075366_10012267
399 Ga0075366_10091816
400 Ga0075366_10109993
401 Ga0075366_10130025
402 Ga0097621_100096904
403 Ga0075370_10003613
404 Ga0068871_100558257
405 Ga0075428_100380246
406 Ga0075430_100033000
407 Ga0075431_100002497
408 Ga0075431_100270784
409 Ga0075429_100000450
410 Ga0075429_100001338
411 Ga0068865_100114390
412 Ga0097620_100183310
413 Ga0097620_100379699
414 Ga0099823_1009434
415 Ga0105240_10029261
416 Ga0105245_10121165
417 Ga0114129_10000300
418 Ga0114129_10516483
419 Ga0105243_10283623
420 Ga0105243_10454730
421 Ga0105241_10093439
422 Ga0105242_10398504
423 Ga0105237_10168838
424 Ga0105238_10364196
425 Ga0105249_10503433
426 Ga0105239_10323741
427 Ga0157370_10002793
428 Ga0157370_10076483
429 Ga0157370_10337951
430 Ga0157378_10206124
431 Ga0157378_10253369
432 Ga0157375_10553531
433 Ga0157377_10000082
434 Ga0157379_10040550
435 Ga0182006_1017106
436 Ga0163161_10000927
437 Ga0213872_10000160
438 Ga0213872_10002893
439 Ga0213872_10063667
440 Ga0209674_105497
441 Ga0209563_100025
442 Ga0209258_109999
443 Ga0207425_1000957
444 Ga0207425_1004235
445 Ga0209129_1000113
446 Ga0209565_1012914
447 Ga0209673_1004869
448 Ga0209673_1005834
449 Ga0209673_1018195
450 Ga0209564_1000186
451 Ga0209564_1012630
452 Ga0209758_1000172
453 Ga0209758_1000304
454 Ga0209758_1001201
455 Ga0209050_1003635
456 Ga0209050_1005955
457 Ga0209256_1004272
458 Ga0209256_1015517
459 Ga0209256_1016141
460 Ga0209051_1002822
461 Ga0209051_1010428
462 Ga0209257_1001091
463 Ga0209257_1015253
464 Ga0209257_1037607
465 Ga0207688_10065359
466 Ga0207645_10043463
467 Ga0207643_10251788
468 Ga0207684_10377576
469 Ga0207654_10050295
470 Ga0207707_10188233
471 Ga0207695_10043848
472 Ga0207671_10046173
473 Ga0207657_10003264
474 Ga0207649_10145720
475 Ga0207681_10076306
476 Ga0207694_10100284
477 Ga0207694_10173806
478 Ga0207659_10078669
479 Ga0207659_10158320
480 Ga0207644_10120838
481 Ga0207690_10089792
482 Ga0207706_10021392
483 Ga0207709_10089066
484 Ga0207709_10186755
485 Ga0207691_10021713
486 Ga0207689_10084239
487 Ga0207679_10012918
488 Ga0207679_10108235
489 Ga0207667_10012827
490 Ga0207667_10312555
491 Ga0207677_10089497
492 Ga0207639_10082689
493 Ga0207678_10032071
494 Ga0207678_10042701
495 Ga0207648_10040111
496 Ga0207648_10076828
497 Ga0207648_10243572
498 Ga0207676_10563744
499 Ga0207674_10014874
500 Ga0207683_10119564
501 Ga0207698_10005709
502 Ga0207698_10063246
503 Ga0207698_10069065
504 Ga0207698_10400076
505 Ga0209389_1029426
506 Ga0209969_1008865
507 Ga0209813_10104847
508 Ga0268265_10045559
509 Ga0268264_10111722
510 Ga0268264_10410099
511 Ga0307515_10122972
512 Ga0307515_10202645
513 Ga0265338_10089818
514 Ga0265324_10000811
515 Ga0265320_10003351
516 Ga0265325_10011501
517 Ga0307513_10064647
518 Ga0307509_10013581
519 Ga0307408_100220128
520 Ga0307408_100253520
521 Ga0307508_10143657
522 Ga0265314_10000185
523 Ga0265314_10056652
524 Ga0307516_10106242
525 Ga0307516_10183850
526 Ga0307510_10060435
527 Ga0373941_0086226
528 Ga0373943_0290292
529 Ga0373931_0148638
530 Ga0373927_0215060
531 Ga0373933_0289810
532 Ga0373947_0025771
533 Ga0395905_0030251
534 Ga0395905_0036617
535 Ga0436361_0362312
536 Ga0436361_0420928
537 Ga0436361_0918193
538 Ga0436361_0991333
539 Ga0436361_1051692
540 Ga0451577_0001132
541 Ga0466965_0000825
542 Ga0466961_0434003
543 Ga0466963_0099695
544 Ga0466964_0015004
545 Ga0466964_0026587
546 Ga0453684_0000356
547 Ga0453684_0176715
548 Ga0453684_0177075
549 Ga0466968_0027754
550 Ga0466968_0059998
551 Ga0495603_0009874
552 Ga0495590_0040763
553 Ga0495590_0055793
554 Ga0495629_0010178
555 Ga0495638_0140856
556 Ga0495582_0003244
557 Ga0495585_0012502
558 Ga0495607_0045137
559 Ga0495583_0001309
560 Ga0495583_0033650
561 Ga0495583_0057889
562 Ga0495610_0095196
563 Ga0495616_0000057
564 Ga0495616_0003725
565 Ga0495616_0018608
566 Ga0495631_0120840
567 Ga0495637_0017232
568 Ga0495637_0103411
569 Ga0495643_0078549
570 Ga0495644_0004008
571 Ga0495644_0004991
572 Ga0495642_0015835
573 Ga0495652_0004706
574 Ga0495665_0153043
575 Ga0495609_0000257
576 Ga0495609_0055019
577 Ga0495609_0148152
578 Ga0495597_0038926
579 Ga0495597_0043409
580 Ga0495645_0163370
581 Ga0495622_0002043
582 Ga0495633_0004937
583 Ga0495668_0000025
584 Ga0495668_0008619
585 Ga0495668_0112726
586 Ga0495611_0003743
587 Ga0495611_0159234
588 Ga0495625_0147922
589 Ga0495635_0094454
590 Ga0495661_0019544
591 Ga0495588_0006212
592 Ga0495658_0015897
593 Ga0495669_0000298
594 Ga0495669_0002374
595 Ga0495613_0122290
596 Ga0495624_0166236
597 Ga0495671_0092379
598 Ga0495660_0004510
599 Ga0495660_0019392
600 Ga0495660_0062301
601 Ga0495581_0018675
602 Ga0495687_000143
603 Ga0495687_104569
604 Ga0495685_000955
605 Ga0495673_0109089
606 Ga0495686_0024439
607 Ga0495626_0099054
608 Ga0496106_0323435
609 Ga0496113_0157001
610 Ga0496125_0003327
611 Ga0501294_001762
612 Ga0501298_004728
613 Ga0501300_008774
614 Ga0501301_001941
615 Ga0501303_000774
616 Ga0501315_004684
617 Ga0501316_013338
618 Ga0501321_000564
619 Ga0501325_000076
620 Ga0501067_0010133
621 Ga0501068_0127081
622 Ga0501069_0000753
623 Ga0501070_0000609
624 Ga0501074_0000574
625 Ga0501076_0222927
626 Ga0501199_004858
627 Ga0501206_001245
628 Ga0501222_000025
629 Ga0501233_014247
630 Ga0501257_011240
631 Ga0501079_0009186
632 Ga0501080_0012487
633 Ga0501083_0005518
634 Ga0501265_000776
635 Ga0501281_02435
636 Ga0501044_0164130
637 nmdc:mga03683_45365_c1
638 nmdc:mga03683_59509_c1
639 nmdc:mga00v17_57067_c1
640 nmdc:mga0k408_11566_c1
641 nmdc:mga0k408_120812_c1
642 nmdc:mga0k408_21283_c1
643 nmdc:mga0k408_58173_c1
644 nmdc:mga0k408_58867_c1
645 nmdc:mga0k408_86546_c1
646 nmdc:mga06z11_13092_c1
647 nmdc:mga06z11_35933_c1
648 nmdc:mga04h51_48309_c1
649 nmdc:mga07m45_109123_c1
650 nmdc:mga07m45_110817_c1
651 nmdc:mga07m45_115531_c1
652 nmdc:mga07m45_129865_c1
653 nmdc:mga07m45_19763_c1
654 nmdc:mga05p37_490_c1
655 nmdc:mga09592_1296_c1
656 nmdc:mga09592_9_c1
657 nmdc:mga0qj67_19083_c1
658 nmdc:mga06r32_4669_c1
659 Ga0495601_0165561
660 Ga0500635_0160123
661 Ga0495595_0174516
662 Ga0500658_0013940
663 Ga0500568_0023002
664 Ga0500604_0001437
665 Ga0500622_0055470
666 2587730460
667 2588295863
668 2644142356
669 2644275043
670 2909401653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01618

MotA_ExbB

MotA/TolQ/ExbB proton channel family

127

258

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ye4-assembly1.cif.gz_C structure of exbb pentamer from serratia marcescens by single particle cryo electron microscopy 0.9114 36 244
5zfu-assembly1.cif.gz_F structure of the exbb/exbd hexameric complex (exbb6exbd3tm) 0.8934 45 244
5sv0-assembly1.cif.gz_B structure of the exbb/exbd complex from e. coli at ph 7.0 0.8916 38 244
5sv0-assembly2.cif.gz_J structure of the exbb/exbd complex from e. coli at ph 7.0 0.8866 45 244
5zfv-assembly1.cif.gz_E structure of the exbb/exbd pentameric complex (exbb5exbd1tm) 0.8825 37 244
ID Description Score Start End Superfamily
1ycef01 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.5582 152 216 1.20.20.10
2ysuB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix Hairpins 0.5114 93 245 1.10.287.620
3g67A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Methyl-accepting chemotaxis protein 0.506 62 244 1.10.287.950
af_B8A4S3_753_894_1.20.1230.10 Mainly Alpha;Up-down Bundle;Phospholipase C Beta; Chain: A;Phospholipase C beta, distal C-terminal domain 0.5041 139 246 1.20.1230.10
af_P0AFM6_2_219_1.10.287.1060 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.4988 104 244 1.10.287.1060
ID Description Score Start End GO Terms
AF-A0A849SW83-F1-model_v4 Biopolymer transport protein ExbB 0.9873 31 245 GO:0005886
GO:0017038
AF-A0A1J5CHT4-F1-model_v4 Biopolymer transport protein ExbB 0.9867 31 244 GO:0005886
GO:0017038
AF-A0A2M8BFT1-F1-model_v4 Biopolymer transport protein ExbB 0.986 31 244 GO:0005886
GO:0017038
AF-A0A4Q7WKZ7-F1-model_v4 Biopolymer transport protein ExbB 0.9849 57 244 GO:0005886
GO:0017038
AF-A0A158IDP4-F1-model_v4 Biopolymer transport protein ExbB 0.9836 30 245 GO:0005886
GO:0017038

Map