F412337

General Info

Members Datasets Scaffolds Average Seq Length
335 250 254 316

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0013424|Ga0439436_0013424_1107_2231
Length 374
Sequence LDRSIRPYAGKTFAASGEAPILPDSFRMNDASRLRSRSPPSAFHLRENHMQTIGSPMLWGAFVAFVVVALLVDLVLMRHGGPHKVTFKEAAWWSVGWIGLALAFNAGLWWWVTQQSGAEIGNRIGLEFLTGYLVEKSLAVDNIFVFLMLFSYFAMPEEQRQRVLVIGVLGAIALRAILIFAGALLLAKFHWILYVFGVFLVVTGIKMLLAAGKAPDLDSNPLLKWMRSHLRLTDGYHGAAISIRRDGQRWYTPLFVVIVLIGVTDVIFAVDSIPAIFAITEDPFIVLTSNVFAVLGLRAMFFLLQGMADRFHLLPYGLALVLVFIGTKMLLIDVYKVPILVSLLGVAAIIGAAIALSLLRPAPAKTDSSDSTEV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
6 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
7 2547132374 Acidovorax radicis N35 Isolate Unclassified
8 2547132512 Azospira oryzae 6a3 Isolate Unclassified
9 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
10 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
11 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
12 2643221570 Acidovorax sp. Root568 Isolate Unclassified
13 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
14 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
15 2643221593 Lysobacter sp. Root690 Isolate Unclassified
16 2643221596 Acidovorax sp. Root70 Isolate Unclassified
17 2643221609 Acidovorax sp. Root217 Isolate Unclassified
18 2643221611 Acidovorax sp. Root219 Isolate Unclassified
19 2643221652 Acidovorax sp. Root402 Isolate Unclassified
20 2643221717 Acidovorax sp. Root267 Isolate Unclassified
21 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
22 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
23 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
24 2738543012 Acidovorax sp. CF301 Isolate Unclassified
25 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
26 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
27 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
28 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
29 2816332133 Acidovorax radicis 2721A Isolate Unclassified
30 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
31 2818991457 Xanthomonas translucens 569 Isolate Unclassified
32 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
33 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
34 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
35 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
36 2847085930 Erwinia persicina B64 Isolate Bulb
37 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
38 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
39 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
40 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
41 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
42 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
43 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
44 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
45 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
46 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
47 2919513703 Luteimonas sp. 3794 Isolate Unclassified
48 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
49 2919675420 Luteimonas terrae 4099 Isolate Unclassified
50 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
51 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
52 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
53 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
54 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
55 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
56 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
57 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
58 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
59 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
60 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
61 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
62 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
63 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
64 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
65 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
66 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
67 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
68 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
69 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
70 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
71 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
72 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
73 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
74 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
75 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
76 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
77 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
78 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
79 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
81 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
84 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
85 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
86 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
87 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
88 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
89 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
90 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
91 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
92 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
93 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
94 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
95 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
111 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
112 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
166 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
167 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
183 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
235 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 639633007 Azoarcus olearius BH72 Isolate Unclassified
242 640753048 Serratia proteamaculans 568 Isolate Endosphere
243 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
244 8004592986 Serratia sp. S119 Isolate Unclassified
245 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
246 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
247 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
248 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
249 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
250 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.82
Metatranscriptomes 0
Isolates 24.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0.3
Endosphere 18.81
Nodule 0.3
Rhizoplane 2.09
Rhizosphere 55.52
Stem 0
Stem Tuber 0
Unclassified 22.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2024786 2162886007 Bacteria 1232
2 SwRhRL2b_contig_2323243 2162886007 Bacteria 6421
3 JGI25152J39213_1000458 3300002773 Bacteria 23782
4 JGI25150J39212_1000308 3300002774 Bacteria 24412
5 JGI25151J46595_10000093 3300003187 Bacteria 121884
6 JGI25151J46595_10000385 3300003187 Bacteria 45916
7 JGI25153J46596_10000061 3300003215 Bacteria 131624
8 rootL2_10074475 3300003322 Bacteria 4606
9 rootH1_10164873 3300003323 Bacteria 2488
10 JGI25407J50210_10013119 3300003373 Bacteria 2128
11 Ga0055526_1000012 3300003771 Bacteria 234368
12 Ga0055526_1000365 3300003771 Bacteria 36588
13 Ga0055537_1000204 3300003773 Bacteria 44323
14 Ga0055537_1000586 3300003773 Bacteria 20276
15 Ga0055524_1000191 3300003775 Bacteria 67323
16 Ga0055536_1000602 3300003781 Bacteria 24515
17 Ga0055536_1003095 3300003781 Bacteria 9054
18 Ga0055534_1000006 3300003784 Bacteria 234368
19 Ga0055534_1000069 3300003784 Bacteria 80193
20 Ga0055534_1000184 3300003784 Bacteria 45725
21 Ga0055528_1000006 3300003790 Bacteria 234368
22 Ga0055528_1000878 3300003790 Bacteria 20385
23 Ga0055531_10029063 3300003794 Bacteria 1891
24 Ga0058692_1000005 3300003856 Bacteria 398815
25 Ga0058692_1000061 3300003856 Bacteria 98304
26 Ga0065165_1000482 3300005262 Bacteria 61748
27 Ga0065704_10000943 3300005289 Bacteria 15160
28 Ga0065704_10012193 3300005289 Bacteria 2265
29 Ga0065704_10071175 3300005289 Bacteria 12659
30 Ga0065704_10093260 3300005289 Bacteria 2608
31 Ga0065704_10149028 3300005289 Bacteria 1446
32 Ga0065715_10205770 3300005293 Bacteria 1338
33 Ga0070670_100000145 3300005331 Bacteria 65889
34 Ga0070668_100007910 3300005347 Bacteria 7895
35 Ga0070659_100284065 3300005366 Bacteria 1377
36 Ga0070667_100014544 3300005367 Bacteria 6503
37 Ga0070705_100162147 3300005440 Bacteria 1496
38 Ga0070663_100049738 3300005455 Bacteria 2979
39 Ga0068853_100023122 3300005539 Bacteria 5202
40 Ga0070665_100156664 3300005548 Bacteria 2279
41 Ga0070665_100223521 3300005548 Bacteria 1883
42 Ga0068855_100002965 3300005563 Bacteria 20752
43 Ga0068857_100263292 3300005577 Bacteria 1583
44 Ga0068854_100151543 3300005578 Bacteria 1788
45 Ga0068859_100000912 3300005617 Bacteria 30207
46 Ga0068863_100007767 3300005841 Bacteria 10488
47 Ga0068863_100016648 3300005841 Bacteria 7054
48 Ga0068858_100303041 3300005842 Bacteria 1525
49 Ga0068862_100000290 3300005844 Bacteria 55379
50 Ga0081538_10000220 3300005981 Bacteria 64287
51 Ga0081539_10013665 3300005985 Bacteria 6097
52 Ga0075364_10002354 3300006051 Bacteria 10615
53 Ga0075364_10002683 3300006051 Bacteria 9992
54 Ga0075364_10005357 3300006051 Bacteria 7450
55 Ga0075364_10059388 3300006051 Bacteria 2507
56 Ga0075364_10237648 3300006051 Bacteria 1237
57 Ga0075370_10008600 3300006353 Bacteria 5262
58 Ga0075428_100201954 3300006844 Bacteria 2149
59 Ga0075431_100134673 3300006847 Bacteria 2547
60 Ga0075433_10216943 3300006852 Bacteria 1700
61 Ga0075434_100241552 3300006871 Bacteria 1826
62 Ga0075429_100023646 3300006880 Bacteria 5332
63 Ga0075429_100283859 3300006880 Bacteria 1450
64 Ga0097620_100000912 3300006931 Bacteria 30207
65 Ga0105251_10000070 3300009011 Bacteria 97706
66 Ga0105251_10012082 3300009011 Bacteria 4900
67 Ga0105244_10025768 3300009036 Bacteria 3190
68 Ga0111539_10026583 3300009094 Bacteria 7076
69 Ga0114129_10436264 3300009147 Bacteria 1720
70 Ga0105243_10000962 3300009148 Bacteria 26918
71 Ga0105243_10171741 3300009148 Bacteria 1878
72 Ga0105241_10086474 3300009174 Bacteria 2466
73 Ga0105237_10042999 3300009545 Bacteria 4554
74 Ga0105237_10100025 3300009545 Bacteria 2891
75 Ga0105028_103014 3300009993 Bacteria 1767
76 Ga0105239_10006590 3300010375 Bacteria 13448
77 Ga0105239_10124506 3300010375 Bacteria 2864
78 Ga0157373_10277321 3300013100 Bacteria 1188
79 Ga0157371_10004635 3300013102 Bacteria 11908
80 Ga0157370_10021809 3300013104 Bacteria 6379
81 Ga0157369_10014869 3300013105 Bacteria 8786
82 Ga0182008_10000241 3300014497 Bacteria 42378
83 Ga0182007_10000094 3300015262 Bacteria 64491
84 Ga0182005_1000828 3300015265 Bacteria 13915
85 Ga0182005_1012424 3300015265 Bacteria 2403
86 Ga0183360_10002 3300015689 Bacteria 953821
87 Ga0163161_10005099 3300017792 Bacteria 9141
88 Ga0207425_1000015 3300025245 Bacteria 466368
89 Ga0207425_1001257 3300025245 Bacteria 11083
90 Ga0207425_1023501 3300025245 Bacteria 1290
91 Ga0209129_1000131 3300025258 Bacteria 127801
92 Ga0209565_1000002 3300025263 Bacteria 1423083
93 Ga0209565_1000033 3300025263 Bacteria 313960
94 Ga0209673_1000002 3300025273 Bacteria 1423083
95 Ga0209673_1000062 3300025273 Bacteria 260727
96 Ga0209130_1015915 3300025284 Bacteria 1838
97 Ga0209675_1000002 3300025291 Bacteria 1423083
98 Ga0209675_1000197 3300025291 Bacteria 65149
99 Ga0209676_1000035 3300025292 Bacteria 459284
100 Ga0209676_1000095 3300025292 Bacteria 245393
101 Ga0209676_1000104 3300025292 Bacteria 226581
102 Ga0209025_1000002 3300025294 Bacteria 1393142
103 Ga0209025_1000069 3300025294 Bacteria 290193
104 Ga0209564_1000004 3300025295 Bacteria 1424639
105 Ga0209564_1000367 3300025295 Bacteria 83971
106 Ga0209758_1000003 3300025297 Bacteria 1398533
107 Ga0209758_1007878 3300025297 Bacteria 7080
108 Ga0209050_1000806 3300025298 Bacteria 44135
109 Ga0209050_1000900 3300025298 Bacteria 39393
110 Ga0209256_1000004 3300025299 Bacteria 1424643
111 Ga0209256_1005362 3300025299 Bacteria 7426
112 Ga0209051_1004233 3300025303 Bacteria 8944
113 Ga0209257_1000153 3300025304 Bacteria 189177
114 Ga0209257_1000434 3300025304 Bacteria 80353
115 Ga0209257_1004643 3300025304 Bacteria 10397
116 Ga0207655_1011354 3300025728 Bacteria 5308
117 Ga0207713_1000161 3300025735 Bacteria 99533
118 Ga0207713_1013800 3300025735 Bacteria 4234
119 Ga0207671_10075012 3300025914 Bacteria 2529
120 Ga0207671_10141480 3300025914 Bacteria 1854
121 Ga0207650_10000847 3300025925 Bacteria 23152
122 Ga0207709_10000588 3300025935 Bacteria 30425
123 Ga0207709_10000819 3300025935 Bacteria 24065
124 Ga0207691_10125429 3300025940 Bacteria 2272
125 Ga0207667_10003904 3300025949 Bacteria 18337
126 Ga0207668_10000753 3300025972 Bacteria 19804
127 Ga0207640_10065139 3300025981 Bacteria 2430
128 Ga0207658_10051893 3300025986 Bacteria 3024
129 Ga0207639_10006658 3300026041 Bacteria 7858
130 Ga0207678_10082660 3300026067 Bacteria 2748
131 Ga0207641_10021313 3300026088 Bacteria 5327
132 Ga0207641_10082946 3300026088 Bacteria 2786
133 Ga0209371_1000031 3300027312 Bacteria 399263
134 Ga0209371_1000168 3300027312 Bacteria 98356
135 Ga0268266_10123307 3300028379 Bacteria 2308
136 Ga0268266_10193225 3300028379 Bacteria 1859
137 Ga0268265_10000136 3300028380 Bacteria 93413
138 Ga0268264_10075698 3300028381 Bacteria 2862
139 Ga0268256_1000034 3300030500 Bacteria 398909
140 Ga0268256_1000140 3300030500 Bacteria 98356
141 Ga0314311_1167891 3300030733 Bacteria 4590
142 Ga0316183_1032423 3300030742 Bacteria 14871
143 Ga0307408_100001271 3300031548 Bacteria 18940
144 Ga0307406_10001984 3300031901 Bacteria 11186
145 Ga0307414_10006979 3300032004 Bacteria 6330
146 Ga0307411_10145064 3300032005 Bacteria 1756
147 Ga0307411_10246641 3300032005 Bacteria 1402
148 Ga0307411_10300949 3300032005 Bacteria 1286
149 Ga0373942_0030980 3300035207 Bacteria 1412
150 Ga0237819_00066 3300038705 Bacteria 37717
151 Ga0436361_0125896 3300039447 Bacteria 3433
152 Ga0439436_0003591 3300041404 Bacteria 4717
153 Ga0439436_0013424 3300041404 Bacteria 2478
154 Ga0439447_005743 3300041407 Bacteria 4103
155 Ga0439465_0002527 3300041413 Bacteria 5969
156 Ga0451791_0144645 3300041451 Bacteria 1481
157 Ga0451793_0762851 3300041452 Bacteria 2972
158 Ga0451800_0866438 3300041459 Bacteria 7120
159 Ga0451802_0387539 3300041460 Bacteria 3467
160 Ga0451806_017076 3300041462 Bacteria 3850
161 Ga0451804_0897221 3300041463 Bacteria 2482
162 Ga0451807_2111521 3300041486 Bacteria 3766
163 Ga0451841_0888238 3300041498 Bacteria 2044
164 Ga0451843_0829735 3300041509 Bacteria 1783
165 Ga0439449_0000068 3300042007 Bacteria 32267
166 Ga0439464_0021033 3300042439 Bacteria 1789
167 Ga0466972_0000904 3300044658 Bacteria 14274
168 Ga0453683_0036955 3300044673 Bacteria 3073
169 Ga0453683_0146731 3300044673 Bacteria 1490
170 Ga0453684_0000369 3300044712 Bacteria 184784
171 Ga0453684_0004907 3300044712 Bacteria 27376
172 Ga0453684_0038431 3300044712 Bacteria 6543
173 Ga0453684_0039005 3300044712 Bacteria 6479
174 Ga0453684_0304414 3300044712 Bacteria 1811
175 Ga0466970_0009908 3300044765 Bacteria 4824
176 Ga0466959_0002284 3300045049 Bacteria 12230
177 Ga0451576_0000140 3300045051 Bacteria 183279
178 Ga0451576_0000169 3300045051 Bacteria 164329
179 Ga0451576_0012245 3300045051 Bacteria 9658
180 Ga0451576_0092266 3300045051 Bacteria 3149
181 Ga0451576_0213424 3300045051 Bacteria 2016
182 Ga0451576_0351187 3300045051 Bacteria 1544
183 Ga0495638_0013441 3300046460 Bacteria 5573
184 Ga0495607_0035328 3300046501 Bacteria 3024
185 Ga0495643_0000708 3300046522 Bacteria 38280
186 Ga0495668_0000307 3300046616 Bacteria 67683
187 Ga0495625_0156228 3300046660 Bacteria 1530
188 Ga0495672_0000408 3300047320 Bacteria 52165
189 Ga0495681_0039203 3300047470 Bacteria 2316
190 Ga0496117_0000648 3300048920 Bacteria 55974
191 Ga0496117_0010646 3300048920 Bacteria 8341
192 Ga0496117_0031004 3300048920 Bacteria 4090
193 Ga0496118_0001127 3300048921 Bacteria 41290
194 Ga0496118_0069332 3300048921 Bacteria 2554
195 Ga0496119_0000301 3300048922 Bacteria 69339
196 Ga0496120_0000402 3300048923 Bacteria 69322
197 Ga0496120_0000576 3300048923 Bacteria 56027
198 Ga0496121_0024630 3300048924 Bacteria 5746
199 Ga0496122_0000879 3300048925 Bacteria 56300
200 Ga0496122_0021021 3300048925 Bacteria 5862
201 Ga0496123_0000671 3300048926 Bacteria 56544
202 Ga0496123_0000676 3300048926 Bacteria 56312
203 Ga0496123_0005214 3300048926 Bacteria 13203
204 Ga0496124_0000020 3300048927 Bacteria 434107
205 Ga0496124_0000791 3300048927 Bacteria 51733
206 Ga0496124_0002389 3300048927 Bacteria 24712
207 Ga0496124_0005284 3300048927 Bacteria 14608
208 Ga0496124_0006814 3300048927 Bacteria 12333
209 Ga0496124_0011751 3300048927 Bacteria 8732
210 Ga0496124_0059260 3300048927 Bacteria 3216
211 Ga0496125_0010496 3300048928 Bacteria 9367
212 Ga0496125_0016354 3300048928 Bacteria 7129
213 Ga0496125_0016355 3300048928 Bacteria 7128
214 Ga0496125_0030766 3300048928 Bacteria 4795
215 Ga0496126_0021517 3300048929 Bacteria 6297
216 Ga0501300_015037 3300049523 Bacteria 1130
217 Ga0501033_0001693 3300049570 Bacteria 19299
218 Ga0501034_0004127 3300049571 Bacteria 16269
219 Ga0501034_0075067 3300049571 Bacteria 3389
220 Ga0501034_0174800 3300049571 Bacteria 2114
221 Ga0501037_0251384 3300049573 Bacteria 1237
222 Ga0501038_0130485 3300049574 Bacteria 2064
223 Ga0501038_0136072 3300049574 Bacteria 2013
224 Ga0501040_0263951 3300049576 Bacteria 1229
225 Ga0501042_0071333 3300049578 Bacteria 2485
226 Ga0501046_0161676 3300049580 Bacteria 1684
227 Ga0501071_0107426 3300049587 Bacteria 2060
228 Ga0501072_0130981 3300049588 Bacteria 1999
229 Ga0501075_0007474 3300049591 Bacteria 7578
230 Ga0501075_0031596 3300049591 Bacteria 3931
231 Ga0501075_0062325 3300049591 Bacteria 2811
232 Ga0501076_0075158 3300049592 Bacteria 2708
233 Ga0501076_0152003 3300049592 Bacteria 1883
234 Ga0501076_0449947 3300049592 Bacteria 1060
235 Ga0501225_0005789 3300049705 Bacteria 3619
236 Ga0501079_0132594 3300049741 Bacteria 1939
237 Ga0501275_000058 3300049772 Bacteria 11255
238 Ga0501035_0155552 3300049822 Bacteria 1982
239 Ga0501045_0014449 3300049824 Bacteria 5595
240 Ga0501045_0020377 3300049824 Bacteria 4736
241 Ga0501045_0042429 3300049824 Bacteria 3311
242 nmdc:mga00v17_2375_c1 3300050491 Bacteria 9639
243 nmdc:mga07m45_7679_c1 3300050496 Bacteria 5519
244 nmdc:mga09592_97476_c1 3300050508 Bacteria 2516
245 nmdc:mga06r32_31504_c1 3300050510 Bacteria 4981
246 Ga0500651_0000479 3300053093 Bacteria 20992
247 Ga0500651_0001250 3300053093 Bacteria 12648
248 Ga0500607_021037 3300053121 Bacteria 3679
249 Ga0500634_0007748 3300053161 Bacteria 5325
250 Ga0500636_0000154 3300053177 Bacteria 35799
251 Ga0500637_0067082 3300053178 Bacteria 2060
252 Ga0500625_001453 3300053729 Bacteria 8134
253 Ga0501084_0241843 3300054114 Bacteria 1524
254 Ga0530510_0138396 3300061734 Bacteria 1793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0005284 Ga0496124_0005284_11669_12688 282
2 3300006051 Ga0075364_10002683 Ga0075364_100026837 285
3 3300050491 nmdc:mga00v17_2375_c1 nmdc:mga00v17_2375_c1_6692_7717 285
4 3300006051 Ga0075364_10002354 Ga0075364_100023544 291
5 3300006051 Ga0075364_10005357 Ga0075364_100053574 291
6 3300031548 Ga0307408_100001271 Ga0307408_10000127113 291
7 3300045051 Ga0451576_0351187 Ga0451576_0351187_324_1310 292
8 3300041452 Ga0451793_0762851 Ga0451793_0762851_844_1803 298
9 3300041460 Ga0451802_0387539 Ga0451802_0387539_2484_3443 298
10 3300053093 Ga0500651_0001250 Ga0500651_0001250_1563_2522 298
11 3300005367 Ga0070667_100014544 Ga0070667_1000145443 299
12 3300005455 Ga0070663_100049738 Ga0070663_1000497382 299
13 3300005539 Ga0068853_100023122 Ga0068853_1000231225 299
14 3300005563 Ga0068855_100002965 Ga0068855_10000296519 299
15 3300005577 Ga0068857_100263292 Ga0068857_1002632922 299
16 3300005617 Ga0068859_100000912 Ga0068859_1000009127 299
17 3300005841 Ga0068863_100007767 Ga0068863_10000776711 299
18 3300005841 Ga0068863_100016648 Ga0068863_1000166486 299
19 3300005842 Ga0068858_100303041 Ga0068858_1003030412 299
20 3300005844 Ga0068862_100000290 Ga0068862_1000002904 299
21 3300006931 Ga0097620_100000912 Ga0097620_1000009127 299
22 3300009174 Ga0105241_10086474 Ga0105241_100864742 299
23 3300009545 Ga0105237_10042999 Ga0105237_100429992 299
24 3300009545 Ga0105237_10100025 Ga0105237_101000252 299
25 3300010375 Ga0105239_10006590 Ga0105239_100065902 299
26 3300010375 Ga0105239_10124506 Ga0105239_101245062 299
27 3300025914 Ga0207671_10075012 Ga0207671_100750122 299
28 3300025914 Ga0207671_10141480 Ga0207671_101414802 299
29 3300025949 Ga0207667_10003904 Ga0207667_1000390410 299
30 3300025986 Ga0207658_10051893 Ga0207658_100518932 299
31 3300026041 Ga0207639_10006658 Ga0207639_100066582 299
32 3300026067 Ga0207678_10082660 Ga0207678_100826602 299
33 3300026088 Ga0207641_10021313 Ga0207641_100213131 299
34 3300026088 Ga0207641_10082946 Ga0207641_100829462 299
35 3300028379 Ga0268266_10123307 Ga0268266_101233072 299
36 3300028380 Ga0268265_10000136 Ga0268265_1000013642 299
37 3300028381 Ga0268264_10075698 Ga0268264_100756982 299
38 3300006871 Ga0075434_100241552 Ga0075434_1002415521 300
39 3300009094 Ga0111539_10026583 Ga0111539_100265835 300
40 3300035207 Ga0373942_0030980 Ga0373942_0030980_73_1065 300
41 3300046460 Ga0495638_0013441 Ga0495638_0013441_889_1848 300
42 3300049824 Ga0501045_0042429 Ga0501045_0042429_2283_3242 300
43 3300061734 Ga0530510_0138396 Ga0530510_0138396_206_1165 300
44 3300006852 Ga0075433_10216943 Ga0075433_102169431 301
45 3300042439 Ga0439464_0021033 Ga0439464_0021033_423_1424 301
46 3300041509 Ga0451843_0829735 Ga0451843_0829735_472_1437 303
47 3300046616 Ga0495668_0000307 Ga0495668_0000307_54747_55709 304
48 3300049580 Ga0501046_0161676 Ga0501046_0161676_108_1094 304
49 3300049591 Ga0501075_0062325 Ga0501075_0062325_1323_2309 304
50 3300049592 Ga0501076_0075158 Ga0501076_0075158_1017_2003 304
51 3300003373 JGI25407J50210_10013119 JGI25407J50210_100131192 305
52 3300005440 Ga0070705_100162147 Ga0070705_1001621472 305
53 3300005981 Ga0081538_10000220 Ga0081538_1000022048 305
54 3300006844 Ga0075428_100201954 Ga0075428_1002019542 305
55 3300006880 Ga0075429_100283859 Ga0075429_1002838592 305
56 3300009147 Ga0114129_10436264 Ga0114129_104362642 305
57 3300044673 Ga0453683_0036955 Ga0453683_0036955_296_1270 305
58 3300044712 Ga0453684_0039005 Ga0453684_0039005_4762_5856 305
59 3300049592 Ga0501076_0152003 Ga0501076_0152003_913_1872 305
60 3300005289 Ga0065704_10012193 Ga0065704_100121932 306
61 3300041407 Ga0439447_005743 Ga0439447_005743_1127_2095 306
62 3300049571 Ga0501034_0004127 Ga0501034_0004127_12322_13281 306
63 3300044765 Ga0466970_0009908 Ga0466970_0009908_2722_3651 307
64 3300053177 Ga0500636_0000154 Ga0500636_0000154_34047_35012 307
65 3300002773 JGI25152J39213_1000458 JGI25152J39213_100045818 308
66 3300002774 JGI25150J39212_1000308 JGI25150J39212_100030818 308
67 3300003187 JGI25151J46595_10000093 JGI25151J46595_1000009368 308
68 3300003215 JGI25153J46596_10000061 JGI25153J46596_1000006174 308
69 3300005293 Ga0065715_10205770 Ga0065715_102057701 308
70 3300025245 Ga0207425_1000015 Ga0207425_1000015387 308
71 3300025258 Ga0209129_1000131 Ga0209129_100013185 308
72 3300025294 Ga0209025_1000002 Ga0209025_10000021286 308
73 3300025297 Ga0209758_1000003 Ga0209758_10000031293 308
74 3300032004 Ga0307414_10006979 Ga0307414_100069793 308
75 3300041459 Ga0451800_0866438 Ga0451800_0866438_5870_6823 308
76 3300041462 Ga0451806_017076 Ga0451806_017076_1502_2455 308
77 3300041463 Ga0451804_0897221 Ga0451804_0897221_195_1148 308
78 3300041486 Ga0451807_2111521 Ga0451807_2111521_1332_2285 308
79 3300053121 Ga0500607_021037 Ga0500607_021037_2141_3106 308
80 3300053178 Ga0500637_0067082 Ga0500637_0067082_892_1857 308
81 iso_pu_bacteria 2919493220 2919493577 308
82 iso_pu_bacteria 2919543075 2919545024 308
83 2162886007 SwRhRL2b_contig_2323243 SwRhRL2b_0367.00000590 309
84 3300003322 rootL2_10074475 rootL2_100744753 309
85 3300003771 Ga0055526_1000012 Ga0055526_100001211 309
86 3300003773 Ga0055537_1000204 Ga0055537_100020430 309
87 3300003775 Ga0055524_1000191 Ga0055524_100019147 309
88 3300003784 Ga0055534_1000006 Ga0055534_100000611 309
89 3300003790 Ga0055528_1000006 Ga0055528_100000611 309
90 3300005289 Ga0065704_10071175 Ga0065704_100711751 309
91 3300005331 Ga0070670_100000145 Ga0070670_10000014544 309
92 3300005548 Ga0070665_100223521 Ga0070665_1002235212 309
93 3300009011 Ga0105251_10000070 Ga0105251_1000007016 309
94 3300009148 Ga0105243_10000962 Ga0105243_1000096213 309
95 3300015265 Ga0182005_1012424 Ga0182005_10124242 309
96 3300015689 Ga0183360_10002 Ga0183360_10002397 309
97 3300025263 Ga0209565_1000002 Ga0209565_1000002622 309
98 3300025273 Ga0209673_1000002 Ga0209673_1000002622 309
99 3300025291 Ga0209675_1000002 Ga0209675_1000002622 309
100 3300025295 Ga0209564_1000004 Ga0209564_1000004623 309
101 3300025299 Ga0209256_1000004 Ga0209256_1000004623 309
102 3300025735 Ga0207713_1000161 Ga0207713_100016117 309
103 3300025925 Ga0207650_10000847 Ga0207650_1000084716 309
104 3300025935 Ga0207709_10000588 Ga0207709_1000058814 309
105 3300028379 Ga0268266_10193225 Ga0268266_101932252 309
106 3300045049 Ga0466959_0002284 Ga0466959_0002284_8087_9022 309
107 3300045051 Ga0451576_0000140 Ga0451576_0000140_55192_56169 309
108 3300048920 Ga0496117_0000648 Ga0496117_0000648_28323_29276 309
109 3300048920 Ga0496117_0010646 Ga0496117_0010646_83_1018 309
110 3300048921 Ga0496118_0001127 Ga0496118_0001127_19264_20199 309
111 3300048923 Ga0496120_0000576 Ga0496120_0000576_28327_29280 309
112 3300048924 Ga0496121_0024630 Ga0496121_0024630_323_1288 309
113 3300048926 Ga0496123_0000671 Ga0496123_0000671_28791_29744 309
114 3300048927 Ga0496124_0000791 Ga0496124_0000791_25034_25987 309
115 3300053729 Ga0500625_001453 Ga0500625_001453_2328_3293 309
116 iso_pu_bacteria 2547132512 2548846170 309
117 3300003856 Ga0058692_1000061 Ga0058692_100006115 310
118 3300006880 Ga0075429_100023646 Ga0075429_1000236463 310
119 3300027312 Ga0209371_1000168 Ga0209371_100016815 310
120 3300030500 Ga0268256_1000140 Ga0268256_100014015 310
121 3300038705 Ga0237819_00066 Ga0237819_00066_17071_18027 310
122 3300049574 Ga0501038_0136072 Ga0501038_0136072_208_1185 310
123 3300049591 Ga0501075_0031596 Ga0501075_0031596_1206_2183 310
124 3300049592 Ga0501076_0449947 Ga0501076_0449947_38_1015 310
125 3300049824 Ga0501045_0014449 Ga0501045_0014449_4538_5515 310
126 3300050508 nmdc:mga09592_97476_c1 nmdc:mga09592_97476_c1_332_1306 310
127 3300050510 nmdc:mga06r32_31504_c1 nmdc:mga06r32_31504_c1_2398_3372 310
128 iso_pu_bacteria 2847085930 2847089232 310
129 3300005262 Ga0065165_1000482 Ga0065165_10004829 311
130 iso_pu_bacteria 2547132374 2548501310 311
131 iso_pu_bacteria 2571042365 2572255542 311
132 iso_pu_bacteria 2643221570 2643868458 311
133 iso_pu_bacteria 2643221596 2643994565 311
134 iso_pu_bacteria 2643221609 2644061611 311
135 iso_pu_bacteria 2643221611 2644075143 311
136 iso_pu_bacteria 2643221652 2644295410 311
137 iso_pu_bacteria 2643221717 2644649146 311
138 iso_pu_bacteria 2738543012 2739243307 311
139 iso_pu_bacteria 2816332133 2816473885 311
140 iso_pu_bacteria 2990710928 2990715495 311
141 iso_pu_bacteria 639633007 639786033 311
142 iso_pu_bacteria 8055225921 8055225965 311
143 3300003781 Ga0055536_1000602 Ga0055536_10006022 312
144 3300005289 Ga0065704_10000943 Ga0065704_100009433 312
145 3300025292 Ga0209676_1000035 Ga0209676_1000035105 312
146 3300041404 Ga0439436_0003591 Ga0439436_0003591_847_1899 312
147 3300041413 Ga0439465_0002527 Ga0439465_0002527_2802_3884 312
148 3300042007 Ga0439449_0000068 Ga0439449_0000068_29798_30880 312
149 3300049705 Ga0501225_0005789 Ga0501225_0005789_2139_3098 312
150 iso_pu_bacteria 2524614729 2525557584 312
151 iso_pu_bacteria 2627854209 2630649175 312
152 iso_pu_bacteria 2842718218 2842721973 312
153 iso_pu_bacteria 2939568625 2939572333 312
154 iso_pu_bacteria 2939607340 2939610476 312
155 iso_pu_bacteria 2939642701 2939645538 312
156 iso_pu_bacteria 2974320154 2974321902 312
157 iso_pu_bacteria 8004592986 8004593780 312
158 iso_pu_bacteria 8055087960 8055089614 312
159 iso_pu_bacteria 8055092621 8055095900 312
160 iso_pu_bacteria 2506520007 2506580521 313
161 iso_pu_bacteria 2506520008 2506585660 313
162 iso_pu_bacteria 2526164512 2526212075 313
163 iso_pu_bacteria 2654587920 2656276406 313
164 iso_pu_bacteria 2687453601 2689447066 313
165 iso_pu_bacteria 2738541276 2738717072 313
166 iso_pu_bacteria 2806310673 2807179315 313
167 iso_pu_bacteria 2818991457 2819662078 313
168 iso_pu_bacteria 2852684882 2852688744 313
169 iso_pu_bacteria 2869551831 2869556481 313
170 iso_pu_bacteria 2919130084 2919133418 313
171 iso_pu_bacteria 2929195423 2929195551 313
172 iso_pu_bacteria 640753048 640939879 313
173 iso_pu_bacteria 8021622325 8021623484 313
174 iso_pu_bacteria 8021626552 8021629595 313
175 iso_pu_bacteria 8021648035 8021650916 313
176 3300049573 Ga0501037_0251384 Ga0501037_0251384_226_1188 314
177 iso_pu_bacteria 2547132130 2547500335 314
178 iso_pu_bacteria 2576861471 2578460370 314
179 iso_pu_bacteria 2643221579 2643907441 314
180 iso_pu_bacteria 2643221581 2643914270 314
181 iso_pu_bacteria 2643221593 2643976411 314
182 iso_pu_bacteria 2747842428 2747948957 314
183 iso_pu_bacteria 2747842501 2748019782 314
184 iso_pu_bacteria 2765235840 2765581198 314
185 iso_pu_bacteria 2816332141 2816519588 314
186 iso_pu_bacteria 2842391507 2842393475 314
187 iso_pu_bacteria 2842757796 2842760409 314
188 iso_pu_bacteria 2842780639 2842784163 314
189 iso_pu_bacteria 2852649853 2852652859 314
190 iso_pu_bacteria 2857442823 2857444150 314
191 iso_pu_bacteria 2874220319 2874224144 314
192 iso_pu_bacteria 2895525241 2895526136 314
193 iso_pu_bacteria 2919089067 2919089916 314
194 iso_pu_bacteria 2919134579 2919138209 314
195 iso_pu_bacteria 2919513703 2919514135 314
196 iso_pu_bacteria 2919675420 2919676094 314
197 iso_pu_bacteria 2923516293 2923516717 314
198 iso_pu_bacteria 2928496128 2928499693 314
199 iso_pu_bacteria 2931380184 2931382762 314
200 iso_pu_bacteria 2937610967 2937613361 314
201 iso_pu_bacteria 2939589442 2939592852 314
202 iso_pu_bacteria 2939622612 2939623204 314
203 iso_pu_bacteria 2939626828 2939629983 314
204 iso_pu_bacteria 2941475908 2941479147 314
205 iso_pu_bacteria 2941489479 2941492219 314
206 iso_pu_bacteria 2961047084 2961050908 314
207 iso_pu_bacteria 2961064222 2961064250 314
208 iso_pu_bacteria 2974307012 2974310799 314
209 iso_pu_bacteria 2977247770 2977251542 314
210 iso_pu_bacteria 2984514374 2984517825 314
211 iso_pu_bacteria 2995948881 2995949090 314
212 iso_pu_bacteria 2998344455 2998347645 314
213 iso_pu_bacteria 8002869464 8002870564 314
214 3300025940 Ga0207691_10125429 Ga0207691_101254293 315
215 3300039447 Ga0436361_0125896 Ga0436361_0125896_161_1129 315
216 3300044658 Ga0466972_0000904 Ga0466972_0000904_12104_13057 315
217 3300049570 Ga0501033_0001693 Ga0501033_0001693_18198_19163 315
218 3300049571 Ga0501034_0174800 Ga0501034_0174800_361_1326 315
219 3300053093 Ga0500651_0000479 Ga0500651_0000479_17872_18819 315
220 iso_pu_bacteria 2987605356 2987607054 315
221 3300044712 Ga0453684_0038431 Ga0453684_0038431_4190_5149 316
222 3300045051 Ga0451576_0012245 Ga0451576_0012245_733_1704 316
223 3300003794 Ga0055531_10029063 Ga0055531_100290632 317
224 3300025304 Ga0209257_1000434 Ga0209257_100043456 317
225 3300032005 Ga0307411_10246641 Ga0307411_102466411 317
226 3300032005 Ga0307411_10300949 Ga0307411_103009491 317
227 3300044673 Ga0453683_0146731 Ga0453683_0146731_85_1047 317
228 3300044712 Ga0453684_0000369 Ga0453684_0000369_59967_60932 317
229 3300044712 Ga0453684_0004907 Ga0453684_0004907_1281_2243 317
230 3300045051 Ga0451576_0000169 Ga0451576_0000169_80862_81824 317
231 3300045051 Ga0451576_0213424 Ga0451576_0213424_775_1743 317
232 2162886007 SwRhRL2b_contig_2024786 SwRhRL2b_0041.00006460 318
233 3300003187 JGI25151J46595_10000385 JGI25151J46595_1000038514 318
234 3300003323 rootH1_10164873 rootH1_101648732 318
235 3300003771 Ga0055526_1000365 Ga0055526_100036523 318
236 3300003773 Ga0055537_1000586 Ga0055537_10005862 318
237 3300003781 Ga0055536_1003095 Ga0055536_10030956 318
238 3300003784 Ga0055534_1000069 Ga0055534_100006971 318
239 3300003784 Ga0055534_1000184 Ga0055534_100018439 318
240 3300003790 Ga0055528_1000878 Ga0055528_100087814 318
241 3300003856 Ga0058692_1000005 Ga0058692_1000005318 318
242 3300005289 Ga0065704_10093260 Ga0065704_100932601 318
243 3300005289 Ga0065704_10149028 Ga0065704_101490282 318
244 3300005347 Ga0070668_100007910 Ga0070668_1000079104 318
245 3300005366 Ga0070659_100284065 Ga0070659_1002840651 318
246 3300005548 Ga0070665_100156664 Ga0070665_1001566642 318
247 3300005578 Ga0068854_100151543 Ga0068854_1001515431 318
248 3300005985 Ga0081539_10013665 Ga0081539_100136651 318
249 3300006051 Ga0075364_10059388 Ga0075364_100593883 318
250 3300006051 Ga0075364_10237648 Ga0075364_102376482 318
251 3300006353 Ga0075370_10008600 Ga0075370_100086002 318
252 3300006847 Ga0075431_100134673 Ga0075431_1001346732 318
253 3300009011 Ga0105251_10012082 Ga0105251_100120824 318
254 3300009036 Ga0105244_10025768 Ga0105244_100257682 318
255 3300009148 Ga0105243_10171741 Ga0105243_101717412 318
256 3300009993 Ga0105028_103014 Ga0105028_1030141 318
257 3300013100 Ga0157373_10277321 Ga0157373_102773212 318
258 3300013102 Ga0157371_10004635 Ga0157371_100046353 318
259 3300013104 Ga0157370_10021809 Ga0157370_100218095 318
260 3300013105 Ga0157369_10014869 Ga0157369_100148696 318
261 3300014497 Ga0182008_10000241 Ga0182008_1000024131 318
262 3300015262 Ga0182007_10000094 Ga0182007_1000009413 318
263 3300015265 Ga0182005_1000828 Ga0182005_100082811 318
264 3300017792 Ga0163161_10005099 Ga0163161_100050996 318
265 3300025245 Ga0207425_1001257 Ga0207425_10012576 318
266 3300025245 Ga0207425_1023501 Ga0207425_10235012 318
267 3300025263 Ga0209565_1000033 Ga0209565_1000033227 318
268 3300025273 Ga0209673_1000062 Ga0209673_100006239 318
269 3300025284 Ga0209130_1015915 Ga0209130_10159151 318
270 3300025291 Ga0209675_1000197 Ga0209675_100019739 318
271 3300025292 Ga0209676_1000095 Ga0209676_100009531 318
272 3300025292 Ga0209676_1000104 Ga0209676_1000104140 318
273 3300025294 Ga0209025_1000069 Ga0209025_100006984 318
274 3300025295 Ga0209564_1000367 Ga0209564_100036737 318
275 3300025297 Ga0209758_1007878 Ga0209758_10078783 318
276 3300025298 Ga0209050_1000806 Ga0209050_100080627 318
277 3300025298 Ga0209050_1000900 Ga0209050_100090024 318
278 3300025299 Ga0209256_1005362 Ga0209256_10053621 318
279 3300025303 Ga0209051_1004233 Ga0209051_10042331 318
280 3300025304 Ga0209257_1000153 Ga0209257_1000153132 318
281 3300025304 Ga0209257_1004643 Ga0209257_10046433 318
282 3300025728 Ga0207655_1011354 Ga0207655_10113542 318
283 3300025735 Ga0207713_1013800 Ga0207713_10138003 318
284 3300025935 Ga0207709_10000819 Ga0207709_100008191 318
285 3300025972 Ga0207668_10000753 Ga0207668_1000075313 318
286 3300025981 Ga0207640_10065139 Ga0207640_100651392 318
287 3300027312 Ga0209371_1000031 Ga0209371_1000031314 318
288 3300030500 Ga0268256_1000034 Ga0268256_100003437 318
289 3300030733 Ga0314311_1167891 Ga0314311_11678913 318
290 3300030742 Ga0316183_1032423 Ga0316183_103242313 318
291 3300031901 Ga0307406_10001984 Ga0307406_100019844 318
292 3300032005 Ga0307411_10145064 Ga0307411_101450642 318
293 3300041404 Ga0439436_0013424 Ga0439436_0013424_1107_2231 318
294 3300041451 Ga0451791_0144645 Ga0451791_0144645_377_1372 318
295 3300041498 Ga0451841_0888238 Ga0451841_0888238_244_1200 318
296 3300044712 Ga0453684_0304414 Ga0453684_0304414_145_1110 318
297 3300045051 Ga0451576_0092266 Ga0451576_0092266_679_1644 318
298 3300046501 Ga0495607_0035328 Ga0495607_0035328_2048_3007 318
299 3300046522 Ga0495643_0000708 Ga0495643_0000708_5912_6868 318
300 3300046660 Ga0495625_0156228 Ga0495625_0156228_371_1327 318
301 3300047320 Ga0495672_0000408 Ga0495672_0000408_43450_44406 318
302 3300047470 Ga0495681_0039203 Ga0495681_0039203_639_1598 318
303 3300048920 Ga0496117_0031004 Ga0496117_0031004_2390_3346 318
304 3300048921 Ga0496118_0069332 Ga0496118_0069332_1344_2300 318
305 3300048922 Ga0496119_0000301 Ga0496119_0000301_66690_67649 318
306 3300048923 Ga0496120_0000402 Ga0496120_0000402_66695_67654 318
307 3300048925 Ga0496122_0000879 Ga0496122_0000879_43036_43995 318
308 3300048925 Ga0496122_0021021 Ga0496122_0021021_914_1873 318
309 3300048926 Ga0496123_0000676 Ga0496123_0000676_43036_43995 318
310 3300048926 Ga0496123_0005214 Ga0496123_0005214_1340_2305 318
311 3300048927 Ga0496124_0000020 Ga0496124_0000020_398097_399080 318
312 3300048927 Ga0496124_0002389 Ga0496124_0002389_4815_5774 318
313 3300048927 Ga0496124_0006814 Ga0496124_0006814_3605_4561 318
314 3300048927 Ga0496124_0011751 Ga0496124_0011751_7759_8715 318
315 3300048927 Ga0496124_0059260 Ga0496124_0059260_2052_3011 318
316 3300048928 Ga0496125_0010496 Ga0496125_0010496_7639_8595 318
317 3300048928 Ga0496125_0016354 Ga0496125_0016354_4201_5163 318
318 3300048928 Ga0496125_0016355 Ga0496125_0016355_3927_4886 318
319 3300048928 Ga0496125_0030766 Ga0496125_0030766_136_1095 318
320 3300048929 Ga0496126_0021517 Ga0496126_0021517_4020_4979 318
321 3300049523 Ga0501300_015037 Ga0501300_015037_97_1059 318
322 3300049571 Ga0501034_0075067 Ga0501034_0075067_2020_2991 318
323 3300049574 Ga0501038_0130485 Ga0501038_0130485_673_1650 318
324 3300049576 Ga0501040_0263951 Ga0501040_0263951_192_1169 318
325 3300049578 Ga0501042_0071333 Ga0501042_0071333_131_1108 318
326 3300049587 Ga0501071_0107426 Ga0501071_0107426_220_1197 318
327 3300049588 Ga0501072_0130981 Ga0501072_0130981_44_1021 318
328 3300049591 Ga0501075_0007474 Ga0501075_0007474_2528_3505 318
329 3300049741 Ga0501079_0132594 Ga0501079_0132594_321_1298 318
330 3300049772 Ga0501275_000058 Ga0501275_000058_624_1586 318
331 3300049822 Ga0501035_0155552 Ga0501035_0155552_271_1248 318
332 3300049824 Ga0501045_0020377 Ga0501045_0020377_3148_4125 318
333 3300050496 nmdc:mga07m45_7679_c1 nmdc:mga07m45_7679_c1_3646_4650 318
334 3300053161 Ga0500634_0007748 Ga0500634_0007748_3284_4243 318
335 3300054114 Ga0501084_0241843 Ga0501084_0241843_328_1305 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03741

TerC

Integral membrane protein TerC family

129

333

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.4117 70 282
6exs-assembly1.cif.gz_A crystal structure of a pot family transporter in complex with thioalcohol conjugated peptide. 0.4031 10 284
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.3991 78 283
5ayn-assembly1.cif.gz_A crystal structure of a bacterial homologue of iron transporter ferroportin in outward-facing state 0.3917 74 280
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.3853 74 282
ID Description Score Start End Superfamily
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5428 81 282 1.20.1250.20
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5427 73 281 1.20.1250.20
af_P67127_16_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5323 81 282 1.20.1250.20
af_Q2FVN1_194_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4946 73 286 1.20.1250.20
af_Q2FVN1_194_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4718 73 286 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1A8XWA5-F1-model_v4 TerC family protein 0.9896 1 310 GO:0016020
AF-A0A357N1H6-F1-model_v4 TerC family protein 0.987 1 278 GO:0016020
AF-C9YDF5-F1-model_v4 Inner membrane protein alx 0.9859 1 310 GO:0016020
AF-A0A2U1C819-F1-model_v4 TerC family integral membrane protein 0.9855 1 310 GO:0016020
AF-A0A846UNC6-F1-model_v4 deleted 0.9819 1 310

Feature Viewer

pLDDT pTM Quality
85.57 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map