F412231

General Info

Members Datasets Scaffolds Average Seq Length
335 208 670 138

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10804561|Ga0105238_108045613
Length 169
Sequence MARFWSFALELPLKRPFTSRSPLRYAQGREKTMTIFGGCLCGAVRYEAAAEPITARLYWCRTCQYLATGNAAVGVCFHSDKVTITGALRDYVSVADSGNRMHRRFCPTCGTHMFSEAEARPHLIFIRAGTLDDPEVAKPVATIWTASAPSWAHIHETMPHWEGQPPPPK

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
162 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
165 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
166 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
167 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
168 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
169 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
203 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
204 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
205 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
206 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
207 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
208 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.48
Nodule 2.09
Rhizoplane 3.58
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 28.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10804561 3300009551 Unclassified 956
2 LJNas_1004264 3300000546 Unclassified 1593
3 JGI24033J26618_1006160 3300002155 Unclassified 1340
4 JGI24034J26672_10012764 3300002239 Bacteria 1269
5 JGI25405J52794_10042390 3300003911 Bacteria 964
6 Ga0065712_10070404 3300005290 Bacteria 6040
7 Ga0065715_10114771 3300005293 Unclassified 2438
8 Ga0070676_10017334 3300005328 Bacteria 3987
9 Ga0070683_100044102 3300005329 Unclassified 4111
10 Ga0070690_100008118 3300005330 Bacteria 6032
11 Ga0070690_100695974 3300005330 Unclassified 780
12 Ga0070670_100025200 3300005331 Bacteria 5119
13 Ga0070670_100159446 3300005331 Unclassified 1955
14 Ga0070670_100954959 3300005331 Unclassified 778
15 Ga0070677_10012838 3300005333 Bacteria 2916
16 Ga0070666_10000649 3300005335 Bacteria 20972
17 Ga0070666_10042136 3300005335 Unclassified 3053
18 Ga0068868_100417342 3300005338 Bacteria 1161
19 Ga0070687_100201722 3300005343 Unclassified 1205
20 Ga0070687_100743335 3300005343 Bacteria 689
21 Ga0070661_100285188 3300005344 Unclassified 1282
22 Ga0070661_100839540 3300005344 Unclassified 755
23 Ga0070692_10215655 3300005345 Unclassified 1132
24 Ga0070668_100062105 3300005347 Bacteria 2894
25 Ga0070668_100188658 3300005347 Bacteria 1688
26 Ga0070669_100038052 3300005353 Bacteria 3491
27 Ga0070669_100304234 3300005353 Bacteria 1283
28 Ga0070675_100009650 3300005354 Bacteria 7513
29 Ga0070671_100048248 3300005355 Bacteria 3541
30 Ga0070671_100245101 3300005355 Unclassified 1521
31 Ga0070671_100568998 3300005355 Bacteria 978
32 Ga0070674_100002702 3300005356 Bacteria 9806
33 Ga0070674_100333439 3300005356 Bacteria 1220
34 Ga0070673_100000680 3300005364 Bacteria 18748
35 Ga0070673_100028804 3300005364 Bacteria 4135
36 Ga0070673_100083795 3300005364 Bacteria 2591
37 Ga0070673_100355275 3300005364 Unclassified 1301
38 Ga0070673_100792266 3300005364 Bacteria 875
39 Ga0070688_100258067 3300005365 Bacteria 1243
40 Ga0070659_100033423 3300005366 Bacteria 3994
41 Ga0070659_100038136 3300005366 Unclassified 3747
42 Ga0070659_100697930 3300005366 Bacteria 877
43 Ga0070667_100015853 3300005367 Bacteria 6235
44 Ga0070667_100446859 3300005367 Bacteria 1181
45 Ga0070714_100650672 3300005435 Unclassified 1014
46 Ga0070713_100379462 3300005436 Bacteria 1317
47 Ga0070710_10777797 3300005437 Unclassified 682
48 Ga0070701_10411288 3300005438 Bacteria 859
49 Ga0070700_100056360 3300005441 Bacteria 2463
50 Ga0070663_100004077 3300005455 Bacteria 8535
51 Ga0070663_100166455 3300005455 Bacteria 1701
52 Ga0070678_100053163 3300005456 Bacteria 2944
53 Ga0070678_100068164 3300005456 Unclassified 2651
54 Ga0070678_100269672 3300005456 Bacteria 1435
55 Ga0070662_100891172 3300005457 Bacteria 759
56 Ga0070681_10380993 3300005458 Bacteria 1321
57 Ga0068867_100003830 3300005459 Bacteria 10571
58 Ga0068867_100067115 3300005459 Bacteria 2673
59 Ga0070685_10003733 3300005466 Bacteria 7711
60 Ga0070685_10035203 3300005466 Bacteria 2824
61 Ga0070684_100043141 3300005535 Unclassified 3894
62 Ga0068853_100007441 3300005539 Bacteria 8762
63 Ga0070686_100070462 3300005544 Bacteria 2286
64 Ga0070686_100896889 3300005544 Bacteria 721
65 Ga0070695_100500602 3300005545 Bacteria 940
66 Ga0070665_100068667 3300005548 Bacteria 3554
67 Ga0070665_100137384 3300005548 Bacteria 2447
68 Ga0070665_100279103 3300005548 Unclassified 1672
69 Ga0070665_100313938 3300005548 Bacteria 1571
70 Ga0070665_100788850 3300005548 Bacteria 963
71 Ga0070665_101492620 3300005548 Unclassified 684
72 Ga0070704_100312185 3300005549 Bacteria 1314
73 Ga0068855_100445960 3300005563 Bacteria 1413
74 Ga0068855_101500908 3300005563 Bacteria 692
75 Ga0070664_100071296 3300005564 Unclassified 2977
76 Ga0070664_100120280 3300005564 Bacteria 2299
77 Ga0070664_100497528 3300005564 Bacteria 1123
78 Ga0070664_100643246 3300005564 Unclassified 985
79 Ga0068857_100058096 3300005577 Unclassified 3434
80 Ga0068854_100050656 3300005578 Plasmid 2972
81 Ga0068854_100304145 3300005578 Bacteria 1291
82 Ga0068854_101467799 3300005578 Bacteria 618
83 Ga0068856_100313569 3300005614 Bacteria 1586
84 Ga0068852_100005589 3300005616 Bacteria 9011
85 Ga0068852_100019229 3300005616 Bacteria 5399
86 Ga0068852_100049078 3300005616 Bacteria 3609
87 Ga0068859_100003193 3300005617 Bacteria 16684
88 Ga0068859_100086938 3300005617 Unclassified 3173
89 Ga0068859_100151996 3300005617 Bacteria 2390
90 Ga0068859_101390844 3300005617 Unclassified 774
91 Ga0068864_100020168 3300005618 Bacteria 5576
92 Ga0068864_100093767 3300005618 Unclassified 2652
93 Ga0068864_100273323 3300005618 Unclassified 1575
94 Ga0068864_101762234 3300005618 Bacteria 624
95 Ga0068866_10113386 3300005718 Unclassified 1516
96 Ga0068861_100248512 3300005719 Unclassified 1517
97 Ga0068861_101610035 3300005719 Unclassified 640
98 Ga0068851_10000594 3300005834 Bacteria 15667
99 Ga0068851_10001553 3300005834 Bacteria 10061
100 Ga0068870_10114017 3300005840 Bacteria 1547
101 Ga0068863_100010319 3300005841 Bacteria 9076
102 Ga0068863_100156449 3300005841 Bacteria 2182
103 Ga0068863_100575793 3300005841 Unclassified 1113
104 Ga0068863_101797771 3300005841 Bacteria 623
105 Ga0068860_100076202 3300005843 Bacteria 3190
106 Ga0068860_100385374 3300005843 Bacteria 1384
107 Ga0068860_101476169 3300005843 Unclassified 701
108 Ga0068862_102562725 3300005844 Unclassified 522
109 Ga0081455_10006363 3300005937 Bacteria 12676
110 Ga0081455_10090497 3300005937 Bacteria 2481
111 Ga0081539_10001955 3300005985 Bacteria 31430
112 Ga0075365_10127699 3300006038 Bacteria 1758
113 Ga0075365_10175530 3300006038 Bacteria 1497
114 Ga0075368_10104667 3300006042 Bacteria 1164
115 Ga0070712_100254975 3300006175 Unclassified 1403
116 Ga0075362_10285610 3300006177 Unclassified 817
117 Ga0075369_10064279 3300006186 Bacteria 1607
118 Ga0097621_100047270 3300006237 Bacteria 3487
119 Ga0075370_10208376 3300006353 Bacteria 1154
120 Ga0068871_100030967 3300006358 Bacteria 4216
121 Ga0068871_100043038 3300006358 Bacteria 3627
122 Ga0075431_100795248 3300006847 Bacteria 919
123 Ga0068865_100070238 3300006881 Bacteria 2481
124 Ga0068865_101654845 3300006881 Unclassified 576
125 Ga0075436_100504982 3300006914 Bacteria 885
126 Ga0097620_100003193 3300006931 Bacteria 16684
127 Ga0097620_100086941 3300006931 Unclassified 3173
128 Ga0097620_100152012 3300006931 Bacteria 2390
129 Ga0097620_101390290 3300006931 Unclassified 774
130 Ga0075435_100681867 3300007076 Unclassified 893
131 Ga0105240_10041475 3300009093 Bacteria 5874
132 Ga0111539_10033871 3300009094 Bacteria 6198
133 Ga0111539_10664897 3300009094 Unclassified 1213
134 Ga0105245_11211594 3300009098 Bacteria 803
135 Ga0114129_11922672 3300009147 Unclassified 717
136 Ga0105243_10160952 3300009148 Bacteria 1935
137 Ga0105241_10065355 3300009174 Unclassified 2811
138 Ga0105242_10654188 3300009176 Unclassified 1022
139 Ga0105242_12668329 3300009176 Bacteria 549
140 Ga0105248_10003515 3300009177 Bacteria 17382
141 Ga0105248_10984526 3300009177 Unclassified 953
142 Ga0105237_10055435 3300009545 Bacteria 3970
143 Ga0105237_10137374 3300009545 Bacteria 2439
144 Ga0105238_10253518 3300009551 Bacteria 1738
145 Ga0105238_11655942 3300009551 Unclassified 670
146 Ga0105249_10142289 3300009553 Bacteria 2301
147 Ga0105239_11946909 3300010375 Unclassified 682
148 Ga0105246_10787170 3300011119 Bacteria 842
149 Ga0157371_10307105 3300013102 Unclassified 1149
150 Ga0157369_10089682 3300013105 Bacteria 3283
151 Ga0157369_11041601 3300013105 Unclassified 837
152 Ga0157374_10006781 3300013296 Bacteria 9737
153 Ga0157378_10420779 3300013297 Bacteria 1320
154 Ga0157378_11221613 3300013297 Bacteria 791
155 Ga0163162_10546462 3300013306 Unclassified 1287
156 Ga0157375_10041512 3300013308 Bacteria 4443
157 Ga0157375_10134412 3300013308 Bacteria 2595
158 Ga0157375_12784366 3300013308 Bacteria 585
159 Ga0163163_10022457 3300014325 Bacteria 5975
160 Ga0163163_10213710 3300014325 Bacteria 1978
161 Ga0157377_10663191 3300014745 Bacteria 752
162 Ga0157379_10138949 3300014968 Bacteria 2190
163 Ga0157376_10186546 3300014969 Bacteria 1899
164 Ga0157376_11378067 3300014969 Unclassified 736
165 Ga0163161_10071781 3300017792 Bacteria 2534
166 Ga0207697_10007675 3300025315 Unclassified 4785
167 Ga0207697_10097917 3300025315 Bacteria 1248
168 Ga0207656_10062112 3300025321 Bacteria 1641
169 Ga0207656_10067944 3300025321 Unclassified 1578
170 Ga0207682_10001861 3300025893 Bacteria 9605
171 Ga0207682_10009937 3300025893 Unclassified 3738
172 Ga0207642_10291136 3300025899 Unclassified 943
173 Ga0207688_10002028 3300025901 Bacteria 10871
174 Ga0207680_10610894 3300025903 Unclassified 780
175 Ga0207645_10007626 3300025907 Bacteria 7625
176 Ga0207645_10011147 3300025907 Bacteria 6150
177 Ga0207645_10119430 3300025907 Bacteria 1711
178 Ga0207705_10058218 3300025909 Bacteria 2788
179 Ga0207705_10615472 3300025909 Bacteria 844
180 Ga0207707_10262064 3300025912 Bacteria 1500
181 Ga0207695_10054712 3300025913 Bacteria 4165
182 Ga0207695_10304645 3300025913 Bacteria 1484
183 Ga0207671_10265298 3300025914 Bacteria 1352
184 Ga0207671_10380222 3300025914 Unclassified 1122
185 Ga0207671_10828561 3300025914 Unclassified 733
186 Ga0207693_10061915 3300025915 Bacteria 2931
187 Ga0207662_10003648 3300025918 Bacteria 7972
188 Ga0207657_10059367 3300025919 Bacteria 3287
189 Ga0207649_10610928 3300025920 Unclassified 839
190 Ga0207652_11088028 3300025921 Bacteria 700
191 Ga0207681_10114858 3300025923 Bacteria 1965
192 Ga0207694_10359206 3300025924 Unclassified 1207
193 Ga0207650_10000694 3300025925 Bacteria 26312
194 Ga0207650_10047717 3300025925 Bacteria 3156
195 Ga0207659_10329226 3300025926 Bacteria 1262
196 Ga0207687_11130653 3300025927 Unclassified 673
197 Ga0207700_10387765 3300025928 Unclassified 1223
198 Ga0207664_10993359 3300025929 Unclassified 752
199 Ga0207644_10034085 3300025931 Unclassified 3562
200 Ga0207644_10371803 3300025931 Bacteria 1164
201 Ga0207644_10446282 3300025931 Bacteria 1062
202 Ga0207690_10230617 3300025932 Bacteria 1421
203 Ga0207706_10030270 3300025933 Bacteria 4830
204 Ga0207706_10600312 3300025933 Bacteria 945
205 Ga0207709_10597158 3300025935 Bacteria 874
206 Ga0207670_10177377 3300025936 Bacteria 1602
207 Ga0207669_10048775 3300025937 Bacteria 2518
208 Ga0207669_10065015 3300025937 Bacteria 2260
209 Ga0207704_10085583 3300025938 Bacteria 2053
210 Ga0207704_10241594 3300025938 Unclassified 1350
211 Ga0207704_10333541 3300025938 Bacteria 1175
212 Ga0207691_10000384 3300025940 Bacteria 44354
213 Ga0207691_10052892 3300025940 Unclassified 3708
214 Ga0207691_10059394 3300025940 Bacteria 3477
215 Ga0207691_11415477 3300025940 Bacteria 571
216 Ga0207711_10003520 3300025941 Bacteria 13554
217 Ga0207711_10053119 3300025941 Bacteria 3475
218 Ga0207689_10002210 3300025942 Bacteria 18240
219 Ga0207689_10158924 3300025942 Unclassified 1863
220 Ga0207661_10045034 3300025944 Unclassified 3489
221 Ga0207679_10179512 3300025945 Unclassified 1750
222 Ga0207679_10253556 3300025945 Bacteria 1497
223 Ga0207679_11168784 3300025945 Bacteria 706
224 Ga0207651_10049225 3300025960 Bacteria 2854
225 Ga0207651_10307002 3300025960 Bacteria 1321
226 Ga0207651_10310594 3300025960 Bacteria 1314
227 Ga0207651_12016967 3300025960 Bacteria 518
228 Ga0207712_10138401 3300025961 Bacteria 1865
229 Ga0207712_10888639 3300025961 Unclassified 787
230 Ga0207668_10022843 3300025972 Bacteria 4009
231 Ga0207668_10305470 3300025972 Bacteria 1314
232 Ga0207668_10714817 3300025972 Bacteria 881
233 Ga0207668_11192733 3300025972 Bacteria 684
234 Ga0207640_11312075 3300025981 Bacteria 646
235 Ga0207658_10132520 3300025986 Bacteria 2004
236 Ga0207677_10525084 3300026023 Unclassified 1027
237 Ga0207639_10262494 3300026041 Unclassified 1511
238 Ga0207639_10367861 3300026041 Bacteria 1288
239 Ga0207678_10023120 3300026067 Bacteria 5440
240 Ga0207708_10204724 3300026075 Bacteria 1575
241 Ga0207702_10216082 3300026078 Unclassified 1785
242 Ga0207702_10239599 3300026078 Bacteria 1699
243 Ga0207641_10230472 3300026088 Unclassified 1721
244 Ga0207641_11798962 3300026088 Unclassified 614
245 Ga0207648_10004895 3300026089 Bacteria 13651
246 Ga0207648_10015708 3300026089 Bacteria 6948
247 Ga0207676_10037475 3300026095 Unclassified 3695
248 Ga0207676_10106597 3300026095 Bacteria 2335
249 Ga0207676_11450619 3300026095 Bacteria 683
250 Ga0207674_10015106 3300026116 Bacteria 8499
251 Ga0207675_100010122 3300026118 Bacteria 8838
252 Ga0207675_100304633 3300026118 Bacteria 1553
253 Ga0207675_102431687 3300026118 Unclassified 536
254 Ga0207683_10000306 3300026121 Bacteria 44304
255 Ga0207683_10005789 3300026121 Bacteria 10597
256 Ga0207683_10259308 3300026121 Bacteria 1587
257 Ga0207683_10423398 3300026121 Bacteria 1226
258 Ga0207698_10077968 3300026142 Bacteria 2658
259 Ga0207698_10229489 3300026142 Unclassified 1684
260 Ga0207698_12170149 3300026142 Bacteria 568
261 Ga0268266_10007004 3300028379 Bacteria 10239
262 Ga0268266_10012669 3300028379 Bacteria 7288
263 Ga0268266_10099546 3300028379 Bacteria 2559
264 Ga0268266_10308319 3300028379 Unclassified 1478
265 Ga0268266_11396531 3300028379 Bacteria 676
266 Ga0268264_10269382 3300028381 Bacteria 1590
267 Ga0268264_10471560 3300028381 Bacteria 1219
268 Ga0265336_10005300 3300028666 Bacteria 4774
269 Ga0265332_10418151 3300031238 Bacteria 554
270 Ga0307513_10018551 3300031456 Bacteria 8309
271 Ga0307513_10068473 3300031456 Bacteria 3718
272 Ga0307516_10156656 3300031730 Bacteria 2031
273 Ga0307413_10828227 3300031824 Bacteria 780
274 Ga0307406_11170125 3300031901 Bacteria 667
275 Ga0373932_0073454 3300035112 Unclassified 1066
276 Ga0373945_0188594 3300035116 Unclassified 852
277 Ga0373931_0394228 3300035691 Bacteria 875
278 Ga0373925_0725792 3300037068 Bacteria 819
279 Ga0242420_029072 3300038996 Unclassified 1019
280 Ga0436360_0209143 3300039438 Bacteria 2256
281 Ga0436360_0723662 3300039438 Bacteria 559
282 Ga0436360_0947433 3300039438 Unclassified 566
283 Ga0436363_0024628 3300039450 Bacteria 887
284 Ga0436363_1416763 3300039450 Bacteria 991
285 Ga0451787_580733 3300041441 Unclassified 898
286 Ga0451789_0829222 3300041443 Unclassified 702
287 Ga0451793_1920011 3300041452 Unclassified 1079
288 Ga0451797_1420546 3300041453 Bacteria 1872
289 Ga0451795_0562446 3300041456 Unclassified 743
290 Ga0451798_0876204 3300041458 Bacteria 511
291 Ga0451807_1600373 3300041486 Unclassified 625
292 Ga0451807_2657983 3300041486 Unclassified 2219
293 Ga0451833_0323487 3300041491 Bacteria 2162
294 Ga0451853_0594901 3300041512 Unclassified 1100
295 Ga0439448_0004734 3300042005 Bacteria 3852
296 Ga0439455_0019172 3300042012 Bacteria 1611
297 Ga0450898_019477 3300042134 Bacteria 1184
298 Ga0453684_2440626 3300044712 Bacteria 517
299 Ga0466957_0739520 3300044842 Bacteria 696
300 Ga0451576_1300629 3300045051 Bacteria 758
301 Ga0495638_0035934 3300046460 Bacteria 3156
302 Ga0495620_0415890 3300046515 Bacteria 509
303 Ga0495652_0323216 3300046529 Bacteria 1114
304 Ga0495668_0232007 3300046616 Bacteria 1011
305 Ga0495687_027247 3300047443 Bacteria 2677
306 Ga0495686_0017004 3300047472 Bacteria 4912
307 Ga0495686_0269944 3300047472 Bacteria 949
308 Ga0496107_0735796 3300048910 Unclassified 724
309 Ga0496109_0717798 3300048912 Unclassified 937
310 Ga0496110_0720259 3300048913 Bacteria 900
311 Ga0496115_0703709 3300048918 Unclassified 794
312 Ga0496126_0234540 3300048929 Bacteria 1536
313 Ga0501031_0672423 3300049568 Unclassified 665
314 Ga0501039_1019218 3300049575 Bacteria 643
315 Ga0501069_0475954 3300049585 Bacteria 744
316 Ga0501080_1368552 3300049742 Bacteria 604
317 Ga0501083_0362862 3300049744 Bacteria 942
318 nmdc:mga0yw44_150393_c1 3300050492 Unclassified 1518
319 nmdc:mga0yw44_266249_c1 3300050492 Bacteria 1143
320 nmdc:mga0yw44_686209_c1 3300050492 Bacteria 696
321 nmdc:mga08x19_587821_c1 3300050514 Unclassified 789
322 Ga0500568_0003093 3300053139 Bacteria 9495
323 Ga0500604_0081544 3300053151 Bacteria 1046
324 Ga0500616_0020171 3300053153 Bacteria 3747
325 Ga0500627_0014767 3300053158 Bacteria 2999
326 Ga0500627_0060735 3300053158 Bacteria 1662
327 Ga0500627_0160117 3300053158 Bacteria 1016
328 Ga0530510_0703919 3300061734 Bacteria 770
329 2958169639 2958165035 Bacteria 6906348
330 2961168099 2961163497 Bacteria 6901077
331 2965022918 2965018300 Bacteria 6883036
332 2968176499 2968171901 Bacteria 6894245
333 2970559438 2970554993 Bacteria 6814252
334 2987664113 2987659509 Bacteria 6966464
335 3004193168 3004188549 Bacteria 6952365
336 Ga0105238_10804561
337 LJNas_1004264
338 JGI24033J26618_1006160
339 JGI24034J26672_10012764
340 JGI25405J52794_10042390
341 Ga0065712_10070404
342 Ga0065715_10114771
343 Ga0070676_10017334
344 Ga0070683_100044102
345 Ga0070690_100008118
346 Ga0070690_100695974
347 Ga0070670_100025200
348 Ga0070670_100159446
349 Ga0070670_100954959
350 Ga0070677_10012838
351 Ga0070666_10000649
352 Ga0070666_10042136
353 Ga0068868_100417342
354 Ga0070687_100201722
355 Ga0070687_100743335
356 Ga0070661_100285188
357 Ga0070661_100839540
358 Ga0070692_10215655
359 Ga0070668_100062105
360 Ga0070668_100188658
361 Ga0070669_100038052
362 Ga0070669_100304234
363 Ga0070675_100009650
364 Ga0070671_100048248
365 Ga0070671_100245101
366 Ga0070671_100568998
367 Ga0070674_100002702
368 Ga0070674_100333439
369 Ga0070673_100000680
370 Ga0070673_100028804
371 Ga0070673_100083795
372 Ga0070673_100355275
373 Ga0070673_100792266
374 Ga0070688_100258067
375 Ga0070659_100033423
376 Ga0070659_100038136
377 Ga0070659_100697930
378 Ga0070667_100015853
379 Ga0070667_100446859
380 Ga0070714_100650672
381 Ga0070713_100379462
382 Ga0070710_10777797
383 Ga0070701_10411288
384 Ga0070700_100056360
385 Ga0070663_100004077
386 Ga0070663_100166455
387 Ga0070678_100053163
388 Ga0070678_100068164
389 Ga0070678_100269672
390 Ga0070662_100891172
391 Ga0070681_10380993
392 Ga0068867_100003830
393 Ga0068867_100067115
394 Ga0070685_10003733
395 Ga0070685_10035203
396 Ga0070684_100043141
397 Ga0068853_100007441
398 Ga0070686_100070462
399 Ga0070686_100896889
400 Ga0070695_100500602
401 Ga0070665_100068667
402 Ga0070665_100137384
403 Ga0070665_100279103
404 Ga0070665_100313938
405 Ga0070665_100788850
406 Ga0070665_101492620
407 Ga0070704_100312185
408 Ga0068855_100445960
409 Ga0068855_101500908
410 Ga0070664_100071296
411 Ga0070664_100120280
412 Ga0070664_100497528
413 Ga0070664_100643246
414 Ga0068857_100058096
415 Ga0068854_100050656
416 Ga0068854_100304145
417 Ga0068854_101467799
418 Ga0068856_100313569
419 Ga0068852_100005589
420 Ga0068852_100019229
421 Ga0068852_100049078
422 Ga0068859_100003193
423 Ga0068859_100086938
424 Ga0068859_100151996
425 Ga0068859_101390844
426 Ga0068864_100020168
427 Ga0068864_100093767
428 Ga0068864_100273323
429 Ga0068864_101762234
430 Ga0068866_10113386
431 Ga0068861_100248512
432 Ga0068861_101610035
433 Ga0068851_10000594
434 Ga0068851_10001553
435 Ga0068870_10114017
436 Ga0068863_100010319
437 Ga0068863_100156449
438 Ga0068863_100575793
439 Ga0068863_101797771
440 Ga0068860_100076202
441 Ga0068860_100385374
442 Ga0068860_101476169
443 Ga0068862_102562725
444 Ga0081455_10006363
445 Ga0081455_10090497
446 Ga0081539_10001955
447 Ga0075365_10127699
448 Ga0075365_10175530
449 Ga0075368_10104667
450 Ga0070712_100254975
451 Ga0075362_10285610
452 Ga0075369_10064279
453 Ga0097621_100047270
454 Ga0075370_10208376
455 Ga0068871_100030967
456 Ga0068871_100043038
457 Ga0075431_100795248
458 Ga0068865_100070238
459 Ga0068865_101654845
460 Ga0075436_100504982
461 Ga0097620_100003193
462 Ga0097620_100086941
463 Ga0097620_100152012
464 Ga0097620_101390290
465 Ga0075435_100681867
466 Ga0105240_10041475
467 Ga0111539_10033871
468 Ga0111539_10664897
469 Ga0105245_11211594
470 Ga0114129_11922672
471 Ga0105243_10160952
472 Ga0105241_10065355
473 Ga0105242_10654188
474 Ga0105242_12668329
475 Ga0105248_10003515
476 Ga0105248_10984526
477 Ga0105237_10055435
478 Ga0105237_10137374
479 Ga0105238_10253518
480 Ga0105238_11655942
481 Ga0105249_10142289
482 Ga0105239_11946909
483 Ga0105246_10787170
484 Ga0157371_10307105
485 Ga0157369_10089682
486 Ga0157369_11041601
487 Ga0157374_10006781
488 Ga0157378_10420779
489 Ga0157378_11221613
490 Ga0163162_10546462
491 Ga0157375_10041512
492 Ga0157375_10134412
493 Ga0157375_12784366
494 Ga0163163_10022457
495 Ga0163163_10213710
496 Ga0157377_10663191
497 Ga0157379_10138949
498 Ga0157376_10186546
499 Ga0157376_11378067
500 Ga0163161_10071781
501 Ga0207697_10007675
502 Ga0207697_10097917
503 Ga0207656_10062112
504 Ga0207656_10067944
505 Ga0207682_10001861
506 Ga0207682_10009937
507 Ga0207642_10291136
508 Ga0207688_10002028
509 Ga0207680_10610894
510 Ga0207645_10007626
511 Ga0207645_10011147
512 Ga0207645_10119430
513 Ga0207705_10058218
514 Ga0207705_10615472
515 Ga0207707_10262064
516 Ga0207695_10054712
517 Ga0207695_10304645
518 Ga0207671_10265298
519 Ga0207671_10380222
520 Ga0207671_10828561
521 Ga0207693_10061915
522 Ga0207662_10003648
523 Ga0207657_10059367
524 Ga0207649_10610928
525 Ga0207652_11088028
526 Ga0207681_10114858
527 Ga0207694_10359206
528 Ga0207650_10000694
529 Ga0207650_10047717
530 Ga0207659_10329226
531 Ga0207687_11130653
532 Ga0207700_10387765
533 Ga0207664_10993359
534 Ga0207644_10034085
535 Ga0207644_10371803
536 Ga0207644_10446282
537 Ga0207690_10230617
538 Ga0207706_10030270
539 Ga0207706_10600312
540 Ga0207709_10597158
541 Ga0207670_10177377
542 Ga0207669_10048775
543 Ga0207669_10065015
544 Ga0207704_10085583
545 Ga0207704_10241594
546 Ga0207704_10333541
547 Ga0207691_10000384
548 Ga0207691_10052892
549 Ga0207691_10059394
550 Ga0207691_11415477
551 Ga0207711_10003520
552 Ga0207711_10053119
553 Ga0207689_10002210
554 Ga0207689_10158924
555 Ga0207661_10045034
556 Ga0207679_10179512
557 Ga0207679_10253556
558 Ga0207679_11168784
559 Ga0207651_10049225
560 Ga0207651_10307002
561 Ga0207651_10310594
562 Ga0207651_12016967
563 Ga0207712_10138401
564 Ga0207712_10888639
565 Ga0207668_10022843
566 Ga0207668_10305470
567 Ga0207668_10714817
568 Ga0207668_11192733
569 Ga0207640_11312075
570 Ga0207658_10132520
571 Ga0207677_10525084
572 Ga0207639_10262494
573 Ga0207639_10367861
574 Ga0207678_10023120
575 Ga0207708_10204724
576 Ga0207702_10216082
577 Ga0207702_10239599
578 Ga0207641_10230472
579 Ga0207641_11798962
580 Ga0207648_10004895
581 Ga0207648_10015708
582 Ga0207676_10037475
583 Ga0207676_10106597
584 Ga0207676_11450619
585 Ga0207674_10015106
586 Ga0207675_100010122
587 Ga0207675_100304633
588 Ga0207675_102431687
589 Ga0207683_10000306
590 Ga0207683_10005789
591 Ga0207683_10259308
592 Ga0207683_10423398
593 Ga0207698_10077968
594 Ga0207698_10229489
595 Ga0207698_12170149
596 Ga0268266_10007004
597 Ga0268266_10012669
598 Ga0268266_10099546
599 Ga0268266_10308319
600 Ga0268266_11396531
601 Ga0268264_10269382
602 Ga0268264_10471560
603 Ga0265336_10005300
604 Ga0265332_10418151
605 Ga0307513_10018551
606 Ga0307513_10068473
607 Ga0307516_10156656
608 Ga0307413_10828227
609 Ga0307406_11170125
610 Ga0373932_0073454
611 Ga0373945_0188594
612 Ga0373931_0394228
613 Ga0373925_0725792
614 Ga0242420_029072
615 Ga0436360_0209143
616 Ga0436360_0723662
617 Ga0436360_0947433
618 Ga0436363_0024628
619 Ga0436363_1416763
620 Ga0451787_580733
621 Ga0451789_0829222
622 Ga0451793_1920011
623 Ga0451797_1420546
624 Ga0451795_0562446
625 Ga0451798_0876204
626 Ga0451807_1600373
627 Ga0451807_2657983
628 Ga0451833_0323487
629 Ga0451853_0594901
630 Ga0439448_0004734
631 Ga0439455_0019172
632 Ga0450898_019477
633 Ga0453684_2440626
634 Ga0466957_0739520
635 Ga0451576_1300629
636 Ga0495638_0035934
637 Ga0495620_0415890
638 Ga0495652_0323216
639 Ga0495668_0232007
640 Ga0495687_027247
641 Ga0495686_0017004
642 Ga0495686_0269944
643 Ga0496107_0735796
644 Ga0496109_0717798
645 Ga0496110_0720259
646 Ga0496115_0703709
647 Ga0496126_0234540
648 Ga0501031_0672423
649 Ga0501039_1019218
650 Ga0501069_0475954
651 Ga0501080_1368552
652 Ga0501083_0362862
653 nmdc:mga0yw44_150393_c1
654 nmdc:mga0yw44_266249_c1
655 nmdc:mga0yw44_686209_c1
656 nmdc:mga08x19_587821_c1
657 Ga0500568_0003093
658 Ga0500604_0081544
659 Ga0500616_0020171
660 Ga0500627_0014767
661 Ga0500627_0060735
662 Ga0500627_0160117
663 Ga0530510_0703919
664 2958169639
665 2961168099
666 2965022918
667 2968176499
668 2970559438
669 2987664113
670 3004193168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

56

147

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8946 1 137
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8439 1 137
4hr6-assembly1.cif.gz_B crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips 0.8205 56 86
2k7i-assembly1.cif.gz_B solution nmr structure of protein atu0232 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg) target att3. ontario center for structural proteomics target atc0223. 0.818 55 84
5y42-assembly2.cif.gz_E native-crystal structure of three chain non-toxic type ii ribosome inactivating protein purified from the seeds of trichosanthes anguina 0.8168 56 86
ID Description Score Start End Superfamily
2gu3A02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9273 56 85 3.10.450.40
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8341 1 129 3.90.1590.10
4hr6B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.8205 56 86 3.40.420.10
2k7iB01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;YegP-like 0.818 55 84 3.30.160.160
3ku0B01 Alpha Beta;3-Layer(aba) Sandwich;Ricin (A subunit); domain 1;Ricin (A subunit), domain 1 0.797 56 86 3.40.420.10
ID Description Score Start End GO Terms
AF-A0A3S3RGJ6-F1-model_v4 GFA family protein 0.9849 3 113 GO:0016846
GO:0046872
AF-A0A4Q3V2P8-F1-model_v4 CENP-V/GFA domain-containing protein 0.982 1 118 GO:0016846
GO:0046872
AF-A0A7X1FPX9-F1-model_v4 GFA family protein 0.9805 1 133 GO:0016846
GO:0046872
AF-A0A081RB91-F1-model_v4 Glutathione-dependent formaldehyde-activating GFA 0.9788 1 137 GO:0016846
GO:0046872
AF-A0A1Z9TUP9-F1-model_v4 CENP-V/GFA domain-containing protein 0.977 7 132 GO:0016846
GO:0046872

Map