F411967

General Info

Members Datasets Scaffolds Average Seq Length
334 200 668 114

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0024094|Ga0496126_0024094_1595_1996
Length 133
Sequence LRKNFAALERWRNLTVEQGMKATIWHNPNCGTSRKTLAILQETPGVDVTVVEYLKNPPSADKLAQLYRDAGLTPQQGLRTRGTDAVERALPDADDATVLAAMAAEPILIERPLVETDKGVRLCRPQEKVHEIL

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
106 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
117 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
118 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
150 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
177 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
182 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
187 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
188 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
189 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
198 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
199 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
200 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.56
Nodule 0
Rhizoplane 1.5
Rhizosphere 70.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0024094 3300048929 Bacteria 5880
2 SwRhRL2b_contig_2139679 2162886007 Bacteria 32324
3 JGI24740J21852_10007723 3300001979 Bacteria 4349
4 JGI24739J22299_10006039 3300001989 Bacteria 4584
5 JGI24739J22299_10015785 3300001989 Bacteria 2743
6 JGI24737J22298_10018925 3300001990 Bacteria 2204
7 JGI24751J29686_10093544 3300002459 Bacteria 626
8 Ga0065704_10070184 3300005289 Bacteria 119655
9 Ga0065704_10091329 3300005289 Bacteria 2724
10 Ga0065707_10095751 3300005295 Bacteria 3342
11 Ga0065707_10483252 3300005295 Bacteria 772
12 Ga0070670_100230570 3300005331 Bacteria 1611
13 Ga0070670_100594498 3300005331 Bacteria 990
14 Ga0070666_10362584 3300005335 Bacteria 1038
15 Ga0070660_100051814 3300005339 Bacteria 3162
16 Ga0070660_101163637 3300005339 Bacteria 653
17 Ga0070668_100004671 3300005347 Bacteria 10151
18 Ga0070668_100007677 3300005347 Bacteria 8005
19 Ga0070668_100035236 3300005347 Bacteria 3816
20 Ga0070668_100839402 3300005347 Bacteria 818
21 Ga0070668_101486562 3300005347 Bacteria 619
22 Ga0070669_100000470 3300005353 Bacteria 30618
23 Ga0070669_100054642 3300005353 Bacteria 2925
24 Ga0070669_100580750 3300005353 Bacteria 937
25 Ga0070671_100027935 3300005355 Bacteria 4645
26 Ga0070671_100847291 3300005355 Bacteria 797
27 Ga0070667_100000361 3300005367 Bacteria 49412
28 Ga0070667_100004988 3300005367 Bacteria 11124
29 Ga0070667_100074931 3300005367 Bacteria 2888
30 Ga0070667_101855598 3300005367 Bacteria 567
31 Ga0070667_101941361 3300005367 Bacteria 554
32 Ga0070663_100274868 3300005455 Bacteria 1340
33 Ga0070662_100031601 3300005457 Bacteria 3717
34 Ga0070706_100525396 3300005467 Bacteria 1101
35 Ga0070707_100625153 3300005468 Bacteria 1039
36 Ga0068853_100016030 3300005539 Bacteria 6161
37 Ga0070665_100000079 3300005548 Bacteria 186925
38 Ga0070665_100002115 3300005548 Bacteria 22199
39 Ga0068855_100135496 3300005563 Bacteria 2810
40 Ga0068855_100689714 3300005563 Bacteria 1094
41 Ga0068855_101218939 3300005563 Bacteria 782
42 Ga0068857_100130170 3300005577 Bacteria 2269
43 Ga0068857_100302289 3300005577 Bacteria 1475
44 Ga0068857_100406839 3300005577 Bacteria 1267
45 Ga0068857_100574969 3300005577 Bacteria 1063
46 Ga0068854_100002482 3300005578 Bacteria 11417
47 Ga0068854_100046755 3300005578 Bacteria 3082
48 Ga0068854_100302054 3300005578 Bacteria 1295
49 Ga0068856_100584502 3300005614 Bacteria 1138
50 Ga0068852_100048891 3300005616 Bacteria 3616
51 Ga0068852_100373413 3300005616 Bacteria 1397
52 Ga0068852_100461561 3300005616 Bacteria 1259
53 Ga0068852_100738676 3300005616 Bacteria 996
54 Ga0068852_101331214 3300005616 Bacteria 740
55 Ga0068859_100489480 3300005617 Bacteria 1325
56 Ga0068864_100083785 3300005618 Bacteria 2800
57 Ga0068863_100000052 3300005841 Bacteria 125430
58 Ga0068863_100031745 3300005841 Bacteria 5040
59 Ga0068863_100829113 3300005841 Bacteria 923
60 Ga0068858_100013942 3300005842 Bacteria 7582
61 Ga0068860_100000007 3300005843 Bacteria 429329
62 Ga0068860_100026003 3300005843 Bacteria 5646
63 Ga0068860_100187933 3300005843 Bacteria 1998
64 Ga0068862_100004597 3300005844 Bacteria 11629
65 Ga0068862_100020390 3300005844 Bacteria 5538
66 Ga0068862_100111124 3300005844 Bacteria 2405
67 Ga0075365_10180159 3300006038 Bacteria 1477
68 Ga0075368_10005996 3300006042 Bacteria 4216
69 Ga0075363_100061212 3300006048 Bacteria 2028
70 Ga0075364_10010170 3300006051 Bacteria 5674
71 Ga0075364_10025657 3300006051 Bacteria 3753
72 Ga0075364_10152530 3300006051 Bacteria 1557
73 Ga0075364_10153695 3300006051 Bacteria 1551
74 Ga0075432_10002998 3300006058 Bacteria 5686
75 Ga0075432_10090532 3300006058 Bacteria 1119
76 Ga0075362_10000026 3300006177 Bacteria 58544
77 Ga0075362_10001144 3300006177 Bacteria 8286
78 Ga0075367_10002649 3300006178 Bacteria 8240
79 Ga0075367_10325390 3300006178 Bacteria 969
80 Ga0075369_10000639 3300006186 Bacteria 11123
81 Ga0075369_10006377 3300006186 Bacteria 4459
82 Ga0075369_10027164 3300006186 Bacteria 2391
83 Ga0075366_10000156 3300006195 Bacteria 28915
84 Ga0075366_10011959 3300006195 Bacteria 4915
85 Ga0075366_10150292 3300006195 Bacteria 1410
86 Ga0075370_10000033 3300006353 Bacteria 44344
87 Ga0075370_10262124 3300006353 Bacteria 1025
88 Ga0075370_10360354 3300006353 Bacteria 869
89 Ga0075436_100681779 3300006914 Bacteria 761
90 Ga0097620_100489490 3300006931 Bacteria 1325
91 Ga0105251_10000232 3300009011 Bacteria 56006
92 Ga0105251_10208613 3300009011 Bacteria 880
93 Ga0111539_10945551 3300009094 Bacteria 1002
94 Ga0105247_10335487 3300009101 Bacteria 1059
95 Ga0105248_10129158 3300009177 Bacteria 2851
96 Ga0105248_10265393 3300009177 Bacteria 1933
97 Ga0105238_10187296 3300009551 Bacteria 2046
98 Ga0105249_10491709 3300009553 Bacteria 1271
99 Ga0157371_10029643 3300013102 Bacteria 3954
100 Ga0157371_10536584 3300013102 Bacteria 866
101 Ga0157369_10443195 3300013105 Bacteria 1345
102 Ga0163162_10780183 3300013306 Bacteria 1074
103 Ga0157372_10224794 3300013307 Bacteria 2176
104 Ga0157375_10348721 3300013308 Bacteria 1646
105 Ga0163161_10005548 3300017792 Bacteria 8740
106 Ga0207713_1022603 3300025735 Bacteria 2980
107 Ga0207710_10750217 3300025900 Bacteria 513
108 Ga0207680_10084120 3300025903 Bacteria 2007
109 Ga0207705_10002600 3300025909 Bacteria 13873
110 Ga0207705_10128424 3300025909 Bacteria 1885
111 Ga0207705_10274557 3300025909 Bacteria 1289
112 Ga0207657_10631220 3300025919 Bacteria 835
113 Ga0207657_10988840 3300025919 Bacteria 646
114 Ga0207646_10523053 3300025922 Bacteria 1068
115 Ga0207681_10001640 3300025923 Bacteria 14420
116 Ga0207681_10374132 3300025923 Bacteria 1145
117 Ga0207681_10904732 3300025923 Bacteria 739
118 Ga0207694_10176241 3300025924 Bacteria 1732
119 Ga0207650_10414828 3300025925 Bacteria 1116
120 Ga0207650_10426786 3300025925 Bacteria 1101
121 Ga0207644_10000301 3300025931 Bacteria 32173
122 Ga0207644_10007717 3300025931 Bacteria 7022
123 Ga0207706_10040385 3300025933 Bacteria 4135
124 Ga0207711_10003527 3300025941 Bacteria 13542
125 Ga0207711_10603000 3300025941 Bacteria 1024
126 Ga0207679_10329728 3300025945 Bacteria 1324
127 Ga0207667_10167283 3300025949 Bacteria 2260
128 Ga0207667_11030557 3300025949 Bacteria 809
129 Ga0207712_10857301 3300025961 Bacteria 801
130 Ga0207668_10005163 3300025972 Bacteria 7682
131 Ga0207668_11759465 3300025972 Bacteria 559
132 Ga0207640_10001764 3300025981 Bacteria 11618
133 Ga0207640_10027132 3300025981 Bacteria 3487
134 Ga0207640_10258502 3300025981 Bacteria 1356
135 Ga0207658_10002164 3300025986 Bacteria 14602
136 Ga0207658_10002795 3300025986 Bacteria 12557
137 Ga0207658_10006034 3300025986 Bacteria 8273
138 Ga0207658_11893773 3300025986 Bacteria 543
139 Ga0207703_10009721 3300026035 Bacteria 7547
140 Ga0207703_10036151 3300026035 Bacteria 3929
141 Ga0207639_10028642 3300026041 Bacteria 4069
142 Ga0207639_11499786 3300026041 Bacteria 633
143 Ga0207678_10169745 3300026067 Bacteria 1863
144 Ga0207702_10264385 3300026078 Bacteria 1621
145 Ga0207641_10000042 3300026088 Bacteria 186384
146 Ga0207641_10002483 3300026088 Bacteria 17018
147 Ga0207641_10009181 3300026088 Bacteria 8162
148 Ga0207641_10440177 3300026088 Bacteria 1258
149 Ga0207676_10003074 3300026095 Bacteria 11910
150 Ga0207674_10275696 3300026116 Bacteria 1630
151 Ga0207674_10347554 3300026116 Bacteria 1434
152 Ga0207674_10648300 3300026116 Bacteria 1020
153 Ga0207698_10091494 3300026142 Bacteria 2490
154 Ga0207698_10492629 3300026142 Bacteria 1191
155 Ga0207698_10537869 3300026142 Bacteria 1143
156 Ga0207698_10859098 3300026142 Bacteria 913
157 Ga0207698_11273778 3300026142 Bacteria 750
158 Ga0209371_1018849 3300027312 Bacteria 1740
159 Ga0209983_1033705 3300027665 Bacteria 1096
160 Ga0209813_10000060 3300027866 Bacteria 44068
161 Ga0209974_10017694 3300027876 Bacteria 2363
162 Ga0207428_10208715 3300027907 Bacteria 1468
163 Ga0268266_10000175 3300028379 Bacteria 115897
164 Ga0268266_10123791 3300028379 Bacteria 2304
165 Ga0268265_10001670 3300028380 Bacteria 18127
166 Ga0268265_10023931 3300028380 Bacteria 4313
167 Ga0268265_10081784 3300028380 Bacteria 2551
168 Ga0268264_10000134 3300028381 Bacteria 179475
169 Ga0268264_10001327 3300028381 Bacteria 23270
170 Ga0268256_1021114 3300030500 Bacteria 1740
171 Ga0307408_100102864 3300031548 Bacteria 2179
172 Ga0307408_100521979 3300031548 Bacteria 1043
173 Ga0307408_100526141 3300031548 Bacteria 1039
174 Ga0307508_10006626 3300031616 Bacteria 10875
175 Ga0316579_10029677 3300031691 Bacteria 2496
176 Ga0307405_10139980 3300031731 Bacteria 1685
177 Ga0307413_10964327 3300031824 Bacteria 728
178 Ga0307410_10064487 3300031852 Bacteria 2517
179 Ga0307410_10144217 3300031852 Bacteria 1765
180 Ga0307406_10134319 3300031901 Bacteria 1741
181 Ga0307406_10440824 3300031901 Bacteria 1042
182 Ga0307406_10557700 3300031901 Bacteria 938
183 Ga0307406_11008351 3300031901 Bacteria 715
184 Ga0307406_11237320 3300031901 Bacteria 649
185 Ga0307407_10432047 3300031903 Bacteria 952
186 Ga0307407_11482502 3300031903 Bacteria 536
187 Ga0307412_10009408 3300031911 Bacteria 5606
188 Ga0307412_10363307 3300031911 Bacteria 1166
189 Ga0307409_100121099 3300031995 Bacteria 2216
190 Ga0307409_100477402 3300031995 Bacteria 1209
191 Ga0307409_101506201 3300031995 Bacteria 700
192 Ga0307416_100401395 3300032002 Bacteria 1408
193 Ga0307414_10021612 3300032004 Bacteria 4043
194 Ga0307414_10243909 3300032004 Bacteria 1489
195 Ga0307414_10983919 3300032004 Bacteria 776
196 Ga0307411_10026273 3300032005 Bacteria 3504
197 Ga0307411_10174709 3300032005 Bacteria 1624
198 Ga0307411_10278336 3300032005 Bacteria 1330
199 Ga0307411_11391375 3300032005 Bacteria 642
200 Ga0373948_0024597 3300034817 Bacteria 1176
201 Ga0373951_0026572 3300035091 Bacteria 1349
202 Ga0373932_0028330 3300035112 Bacteria 1539
203 Ga0373932_0078030 3300035112 Bacteria 1041
204 Ga0373946_0072817 3300035171 Bacteria 1488
205 Ga0373931_0009733 3300035691 Bacteria 4602
206 Ga0316582_0001804 3300036647 Bacteria 9669
207 Ga0373925_0815504 3300037068 Bacteria 769
208 Ga0395900_1503880 3300037418 Bacteria 585
209 Ga0395905_0368918 3300037471 Bacteria 1329
210 Ga0316581_0119451 3300037588 Bacteria 812
211 Ga0395901_0540749 3300038443 Bacteria 1182
212 Ga0451841_1261334 3300041498 Bacteria 732
213 Ga0451847_0054085 3300041503 Bacteria 1066
214 Ga0451855_0648019 3300041511 Bacteria 1056
215 Ga0451853_1231575 3300041512 Bacteria 603
216 Ga0453684_0431866 3300044712 Bacteria 1469
217 Ga0451576_0000393 3300045051 Bacteria 101814
218 Ga0495627_000278 3300046453 Bacteria 51546
219 Ga0495650_0019051 3300046471 Bacteria 3391
220 Ga0495607_0007897 3300046501 Bacteria 7319
221 Ga0495583_0141245 3300046506 Bacteria 1002
222 Ga0495583_0217848 3300046506 Bacteria 772
223 Ga0495606_0020711 3300046507 Bacteria 4839
224 Ga0495610_0000022 3300046512 Bacteria 317107
225 Ga0495610_0000116 3300046512 Bacteria 90702
226 Ga0495620_0007739 3300046515 Bacteria 5804
227 Ga0495620_0104710 3300046515 Bacteria 1125
228 Ga0495632_0001423 3300046519 Bacteria 19923
229 Ga0495632_0099806 3300046519 Bacteria 1369
230 Ga0495637_0075598 3300046520 Bacteria 1351
231 Ga0495643_0000048 3300046522 Bacteria 212788
232 Ga0495643_0010895 3300046522 Bacteria 5569
233 Ga0495643_0045605 3300046522 Bacteria 2379
234 Ga0495654_0019330 3300046530 Bacteria 3563
235 Ga0495609_0009557 3300046538 Bacteria 4689
236 Ga0495609_0286232 3300046538 Bacteria 673
237 Ga0495597_0209340 3300046542 Bacteria 778
238 Ga0495633_0236865 3300046558 Bacteria 834
239 Ga0495668_0147933 3300046616 Bacteria 1286
240 Ga0495668_0390408 3300046616 Bacteria 765
241 Ga0495611_0278768 3300046648 Bacteria 772
242 Ga0495625_0036497 3300046660 Bacteria 3612
243 Ga0495669_0044136 3300046684 Bacteria 1985
244 Ga0495671_0111545 3300046692 Bacteria 1335
245 Ga0495673_0020031 3300047469 Bacteria 3338
246 Ga0495681_0000974 3300047470 Bacteria 21885
247 Ga0495686_0001246 3300047472 Bacteria 29040
248 Ga0496102_0265930 3300048905 Bacteria 1617
249 Ga0496103_0057430 3300048906 Bacteria 2416
250 Ga0496104_0006304 3300048907 Bacteria 10433
251 Ga0496105_0000786 3300048908 Bacteria 21442
252 Ga0496106_0401950 3300048909 Bacteria 1101
253 Ga0496116_0190261 3300048919 Bacteria 1087
254 Ga0496117_0041107 3300048920 Bacteria 3392
255 Ga0496117_0061697 3300048920 Bacteria 2575
256 Ga0496118_0036083 3300048921 Bacteria 4003
257 Ga0496118_0100461 3300048921 Bacteria 1957
258 Ga0496118_0330382 3300048921 Bacteria 822
259 Ga0496119_0036762 3300048922 Bacteria 3191
260 Ga0496119_0094685 3300048922 Bacteria 1689
261 Ga0496119_0188591 3300048922 Bacteria 1076
262 Ga0496120_0067501 3300048923 Bacteria 1975
263 Ga0496120_0099033 3300048923 Bacteria 1544
264 Ga0496120_0511092 3300048923 Bacteria 515
265 Ga0496121_0000274 3300048924 Bacteria 107140
266 Ga0496121_0001542 3300048924 Bacteria 38556
267 Ga0496121_0026104 3300048924 Bacteria 5518
268 Ga0496122_0300540 3300048925 Bacteria 866
269 Ga0496123_0237656 3300048926 Bacteria 907
270 Ga0496124_0004428 3300048927 Bacteria 16380
271 Ga0496124_0670130 3300048927 Bacteria 662
272 Ga0496125_0066493 3300048928 Bacteria 2847
273 Ga0496125_0327713 3300048928 Bacteria 925
274 Ga0496126_0188805 3300048929 Bacteria 1746
275 Ga0496126_0523696 3300048929 Bacteria 944
276 Ga0501033_0483360 3300049570 Bacteria 858
277 Ga0501034_0086244 3300049571 Bacteria 3141
278 Ga0501037_0933054 3300049573 Bacteria 568
279 Ga0501042_0879000 3300049578 Bacteria 653
280 Ga0501043_0647596 3300049579 Bacteria 776
281 Ga0501047_0310052 3300049581 Bacteria 1419
282 Ga0501073_0498586 3300049589 Bacteria 842
283 Ga0501074_0313712 3300049590 Bacteria 1114
284 Ga0501080_0097493 3300049742 Bacteria 2730
285 Ga0501035_1133225 3300049822 Bacteria 610
286 Ga0501044_0443805 3300049823 Bacteria 1205
287 Ga0501044_0537103 3300049823 Bacteria 1068
288 nmdc:mga03683_393_c1 3300050489 Bacteria 12561
289 nmdc:mga03683_54_c1 3300050489 Bacteria 47475
290 nmdc:mga03n38_17905_c1 3300050490 Bacteria 2784
291 nmdc:mga00v17_26625_c1 3300050491 Bacteria 3372
292 nmdc:mga00v17_50992_c1 3300050491 Bacteria 2516
293 nmdc:mga00v17_86123_c1 3300050491 Bacteria 1969
294 nmdc:mga0yw44_75993_c1 3300050492 Bacteria 2096
295 nmdc:mga0k408_144648_c1 3300050493 Bacteria 1415
296 nmdc:mga0k408_288125_c1 3300050493 Bacteria 980
297 nmdc:mga0k408_30_c1 3300050493 Bacteria 89511
298 nmdc:mga0k408_9440_c1 3300050493 Bacteria 5257
299 nmdc:mga06z11_12161_c1 3300050494 Bacteria 3736
300 nmdc:mga06z11_8750_c1 3300050494 Bacteria 4239
301 nmdc:mga04h51_73_c1 3300050495 Bacteria 32039
302 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
303 nmdc:mga07m45_356356_c1 3300050496 Bacteria 850
304 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
305 nmdc:mga08y16_1185242_c1 3300050511 Bacteria 735
306 nmdc:mga08x19_590237_c1 3300050514 Bacteria 787
307 nmdc:mga0sz30_209_c1 3300050516 Bacteria 21984
308 nmdc:mga0sz30_26143_c1 3300050516 Bacteria 2391
309 nmdc:mga0sz30_285_c1 3300050516 Bacteria 19408
310 Ga0500647_0056076 3300053091 Bacteria 1895
311 Ga0500651_0045361 3300053093 Bacteria 2765
312 Ga0500641_0217791 3300053096 Bacteria 810
313 Ga0500556_0224086 3300053104 Bacteria 742
314 Ga0500592_009899 3300053116 Bacteria 1517
315 Ga0500592_016440 3300053116 Bacteria 1187
316 Ga0500618_002176 3300053125 Bacteria 7686
317 Ga0500642_0002658 3300053130 Bacteria 5279
318 Ga0500642_0281237 3300053130 Bacteria 756
319 Ga0500655_000247 3300053133 Bacteria 12687
320 Ga0500559_0172601 3300053136 Bacteria 1017
321 Ga0500559_0570247 3300053136 Bacteria 515
322 Ga0500568_0030918 3300053139 Bacteria 2214
323 Ga0500590_003221 3300053148 Bacteria 7468
324 Ga0500590_043015 3300053148 Bacteria 2318
325 Ga0500622_0013951 3300053156 Bacteria 4322
326 Ga0500639_122391 3300053163 Bacteria 1247
327 Ga0500636_0387351 3300053177 Bacteria 653
328 Ga0500570_021671 3300053724 Bacteria 3574
329 Ga0500645_027564 3300053730 Bacteria 1722
330 Ga0500645_079964 3300053730 Bacteria 933
331 2819552220 2818991438 Bacteria 5793701
332 2896186634 2896184354 Bacteria 3258548
333 2896254401 2896253425 Bacteria 3418029
334 2919139211 2919138771 Bacteria 5281312
335 Ga0496126_0024094
336 SwRhRL2b_contig_2139679
337 JGI24740J21852_10007723
338 JGI24739J22299_10006039
339 JGI24739J22299_10015785
340 JGI24737J22298_10018925
341 JGI24751J29686_10093544
342 Ga0065704_10070184
343 Ga0065704_10091329
344 Ga0065707_10095751
345 Ga0065707_10483252
346 Ga0070670_100230570
347 Ga0070670_100594498
348 Ga0070666_10362584
349 Ga0070660_100051814
350 Ga0070660_101163637
351 Ga0070668_100004671
352 Ga0070668_100007677
353 Ga0070668_100035236
354 Ga0070668_100839402
355 Ga0070668_101486562
356 Ga0070669_100000470
357 Ga0070669_100054642
358 Ga0070669_100580750
359 Ga0070671_100027935
360 Ga0070671_100847291
361 Ga0070667_100000361
362 Ga0070667_100004988
363 Ga0070667_100074931
364 Ga0070667_101855598
365 Ga0070667_101941361
366 Ga0070663_100274868
367 Ga0070662_100031601
368 Ga0070706_100525396
369 Ga0070707_100625153
370 Ga0068853_100016030
371 Ga0070665_100000079
372 Ga0070665_100002115
373 Ga0068855_100135496
374 Ga0068855_100689714
375 Ga0068855_101218939
376 Ga0068857_100130170
377 Ga0068857_100302289
378 Ga0068857_100406839
379 Ga0068857_100574969
380 Ga0068854_100002482
381 Ga0068854_100046755
382 Ga0068854_100302054
383 Ga0068856_100584502
384 Ga0068852_100048891
385 Ga0068852_100373413
386 Ga0068852_100461561
387 Ga0068852_100738676
388 Ga0068852_101331214
389 Ga0068859_100489480
390 Ga0068864_100083785
391 Ga0068863_100000052
392 Ga0068863_100031745
393 Ga0068863_100829113
394 Ga0068858_100013942
395 Ga0068860_100000007
396 Ga0068860_100026003
397 Ga0068860_100187933
398 Ga0068862_100004597
399 Ga0068862_100020390
400 Ga0068862_100111124
401 Ga0075365_10180159
402 Ga0075368_10005996
403 Ga0075363_100061212
404 Ga0075364_10010170
405 Ga0075364_10025657
406 Ga0075364_10152530
407 Ga0075364_10153695
408 Ga0075432_10002998
409 Ga0075432_10090532
410 Ga0075362_10000026
411 Ga0075362_10001144
412 Ga0075367_10002649
413 Ga0075367_10325390
414 Ga0075369_10000639
415 Ga0075369_10006377
416 Ga0075369_10027164
417 Ga0075366_10000156
418 Ga0075366_10011959
419 Ga0075366_10150292
420 Ga0075370_10000033
421 Ga0075370_10262124
422 Ga0075370_10360354
423 Ga0075436_100681779
424 Ga0097620_100489490
425 Ga0105251_10000232
426 Ga0105251_10208613
427 Ga0111539_10945551
428 Ga0105247_10335487
429 Ga0105248_10129158
430 Ga0105248_10265393
431 Ga0105238_10187296
432 Ga0105249_10491709
433 Ga0157371_10029643
434 Ga0157371_10536584
435 Ga0157369_10443195
436 Ga0163162_10780183
437 Ga0157372_10224794
438 Ga0157375_10348721
439 Ga0163161_10005548
440 Ga0207713_1022603
441 Ga0207710_10750217
442 Ga0207680_10084120
443 Ga0207705_10002600
444 Ga0207705_10128424
445 Ga0207705_10274557
446 Ga0207657_10631220
447 Ga0207657_10988840
448 Ga0207646_10523053
449 Ga0207681_10001640
450 Ga0207681_10374132
451 Ga0207681_10904732
452 Ga0207694_10176241
453 Ga0207650_10414828
454 Ga0207650_10426786
455 Ga0207644_10000301
456 Ga0207644_10007717
457 Ga0207706_10040385
458 Ga0207711_10003527
459 Ga0207711_10603000
460 Ga0207679_10329728
461 Ga0207667_10167283
462 Ga0207667_11030557
463 Ga0207712_10857301
464 Ga0207668_10005163
465 Ga0207668_11759465
466 Ga0207640_10001764
467 Ga0207640_10027132
468 Ga0207640_10258502
469 Ga0207658_10002164
470 Ga0207658_10002795
471 Ga0207658_10006034
472 Ga0207658_11893773
473 Ga0207703_10009721
474 Ga0207703_10036151
475 Ga0207639_10028642
476 Ga0207639_11499786
477 Ga0207678_10169745
478 Ga0207702_10264385
479 Ga0207641_10000042
480 Ga0207641_10002483
481 Ga0207641_10009181
482 Ga0207641_10440177
483 Ga0207676_10003074
484 Ga0207674_10275696
485 Ga0207674_10347554
486 Ga0207674_10648300
487 Ga0207698_10091494
488 Ga0207698_10492629
489 Ga0207698_10537869
490 Ga0207698_10859098
491 Ga0207698_11273778
492 Ga0209371_1018849
493 Ga0209983_1033705
494 Ga0209813_10000060
495 Ga0209974_10017694
496 Ga0207428_10208715
497 Ga0268266_10000175
498 Ga0268266_10123791
499 Ga0268265_10001670
500 Ga0268265_10023931
501 Ga0268265_10081784
502 Ga0268264_10000134
503 Ga0268264_10001327
504 Ga0268256_1021114
505 Ga0307408_100102864
506 Ga0307408_100521979
507 Ga0307408_100526141
508 Ga0307508_10006626
509 Ga0316579_10029677
510 Ga0307405_10139980
511 Ga0307413_10964327
512 Ga0307410_10064487
513 Ga0307410_10144217
514 Ga0307406_10134319
515 Ga0307406_10440824
516 Ga0307406_10557700
517 Ga0307406_11008351
518 Ga0307406_11237320
519 Ga0307407_10432047
520 Ga0307407_11482502
521 Ga0307412_10009408
522 Ga0307412_10363307
523 Ga0307409_100121099
524 Ga0307409_100477402
525 Ga0307409_101506201
526 Ga0307416_100401395
527 Ga0307414_10021612
528 Ga0307414_10243909
529 Ga0307414_10983919
530 Ga0307411_10026273
531 Ga0307411_10174709
532 Ga0307411_10278336
533 Ga0307411_11391375
534 Ga0373948_0024597
535 Ga0373951_0026572
536 Ga0373932_0028330
537 Ga0373932_0078030
538 Ga0373946_0072817
539 Ga0373931_0009733
540 Ga0316582_0001804
541 Ga0373925_0815504
542 Ga0395900_1503880
543 Ga0395905_0368918
544 Ga0316581_0119451
545 Ga0395901_0540749
546 Ga0451841_1261334
547 Ga0451847_0054085
548 Ga0451855_0648019
549 Ga0451853_1231575
550 Ga0453684_0431866
551 Ga0451576_0000393
552 Ga0495627_000278
553 Ga0495650_0019051
554 Ga0495607_0007897
555 Ga0495583_0141245
556 Ga0495583_0217848
557 Ga0495606_0020711
558 Ga0495610_0000022
559 Ga0495610_0000116
560 Ga0495620_0007739
561 Ga0495620_0104710
562 Ga0495632_0001423
563 Ga0495632_0099806
564 Ga0495637_0075598
565 Ga0495643_0000048
566 Ga0495643_0010895
567 Ga0495643_0045605
568 Ga0495654_0019330
569 Ga0495609_0009557
570 Ga0495609_0286232
571 Ga0495597_0209340
572 Ga0495633_0236865
573 Ga0495668_0147933
574 Ga0495668_0390408
575 Ga0495611_0278768
576 Ga0495625_0036497
577 Ga0495669_0044136
578 Ga0495671_0111545
579 Ga0495673_0020031
580 Ga0495681_0000974
581 Ga0495686_0001246
582 Ga0496102_0265930
583 Ga0496103_0057430
584 Ga0496104_0006304
585 Ga0496105_0000786
586 Ga0496106_0401950
587 Ga0496116_0190261
588 Ga0496117_0041107
589 Ga0496117_0061697
590 Ga0496118_0036083
591 Ga0496118_0100461
592 Ga0496118_0330382
593 Ga0496119_0036762
594 Ga0496119_0094685
595 Ga0496119_0188591
596 Ga0496120_0067501
597 Ga0496120_0099033
598 Ga0496120_0511092
599 Ga0496121_0000274
600 Ga0496121_0001542
601 Ga0496121_0026104
602 Ga0496122_0300540
603 Ga0496123_0237656
604 Ga0496124_0004428
605 Ga0496124_0670130
606 Ga0496125_0066493
607 Ga0496125_0327713
608 Ga0496126_0188805
609 Ga0496126_0523696
610 Ga0501033_0483360
611 Ga0501034_0086244
612 Ga0501037_0933054
613 Ga0501042_0879000
614 Ga0501043_0647596
615 Ga0501047_0310052
616 Ga0501073_0498586
617 Ga0501074_0313712
618 Ga0501080_0097493
619 Ga0501035_1133225
620 Ga0501044_0443805
621 Ga0501044_0537103
622 nmdc:mga03683_393_c1
623 nmdc:mga03683_54_c1
624 nmdc:mga03n38_17905_c1
625 nmdc:mga00v17_26625_c1
626 nmdc:mga00v17_50992_c1
627 nmdc:mga00v17_86123_c1
628 nmdc:mga0yw44_75993_c1
629 nmdc:mga0k408_144648_c1
630 nmdc:mga0k408_288125_c1
631 nmdc:mga0k408_30_c1
632 nmdc:mga0k408_9440_c1
633 nmdc:mga06z11_12161_c1
634 nmdc:mga06z11_8750_c1
635 nmdc:mga04h51_73_c1
636 nmdc:mga07m45_14_c1
637 nmdc:mga07m45_356356_c1
638 nmdc:mga07m45_5_c2
639 nmdc:mga08y16_1185242_c1
640 nmdc:mga08x19_590237_c1
641 nmdc:mga0sz30_209_c1
642 nmdc:mga0sz30_26143_c1
643 nmdc:mga0sz30_285_c1
644 Ga0500647_0056076
645 Ga0500651_0045361
646 Ga0500641_0217791
647 Ga0500556_0224086
648 Ga0500592_009899
649 Ga0500592_016440
650 Ga0500618_002176
651 Ga0500642_0002658
652 Ga0500642_0281237
653 Ga0500655_000247
654 Ga0500559_0172601
655 Ga0500559_0570247
656 Ga0500568_0030918
657 Ga0500590_003221
658 Ga0500590_043015
659 Ga0500622_0013951
660 Ga0500639_122391
661 Ga0500636_0387351
662 Ga0500570_021671
663 Ga0500645_027564
664 Ga0500645_079964
665 2819552220
666 2896186634
667 2896254401
668 2919139211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

25

132

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s3d-assembly1.cif.gz_A arsenate reductase r60a mutant from e. coli 0.9316 3 114
1s3c-assembly1.cif.gz_A arsenate reductase c12s mutant from e. coli 0.9307 3 114
1i9d-assembly1.cif.gz_A arsenate reductase from e. coli 0.9303 3 114
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.9301 3 114
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.9217 1 114
ID Description Score Start End Superfamily
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9207 3 114 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9053 3 113 3.40.30.10
1j9bA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8977 3 114 3.40.30.10
3gkxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8356 3 111 3.40.30.10
3fz4A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8233 4 98 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Z0BWA4-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.004 1 114 GO:0008794
GO:0046685
AF-A0A844X9V8-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.004 1 114 GO:0008794
GO:0046685
AF-F6IK14-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.003 1 114 GO:0008794
GO:0046685
AF-A0A5B8S250-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.002 1 114 GO:0008794
GO:0046685
AF-A0A418NQR2-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 1.001 1 114 GO:0008794
GO:0046685

Map