F411880

General Info

Members Datasets Scaffolds Average Seq Length
334 190 668 226

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0233218|Ga0395900_0233218_900_1706
Length 268
Sequence LIPSSIGTTNGVATSEFTTPRYRPVPNGATDRVPFVDGEVAEATPERRAPYDPMPHGQPEVGVGPWPXXXXEGPGSEVYDEQLLREGDRRNVVDRYRYWSVEAIVADLDRRRHGFHVAIENWQHDFNIGTIVRSANAFLAAEVHIVGNRRWNRRGAMVTDRYQHVRHHPSVAELHAYLAAEGIPLLGIDNLPGSAHLETMQIPERVCFLFGQEGPGLSESAREACDGTFSIAQFGSTRSINASAAAAIAMHAWIRQHADLTGDTAWRG

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
62 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
79 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
80 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
83 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2643221576 Nocardioides sp. Root614 Isolate Unclassified
174 2643221590 Nocardioides sp. Root682 Isolate Unclassified
175 2643221604 Nocardioides sp. Root190 Isolate Unclassified
176 2643221615 Nocardioides sp. Root224 Isolate Unclassified
177 2643221617 Nocardioides sp. Root79 Isolate Unclassified
178 2643221620 Nocardioides sp. Root240 Isolate Unclassified
179 2643221641 Nocardioides sp. Root122 Isolate Unclassified
180 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
181 2738541305 Nocardioides sp. CF167 Isolate Unclassified
182 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
183 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
184 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
185 2919069694 Microbacterium sp. 1154 Isolate Unclassified
186 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
187 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
188 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
189 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
190 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 13.17
Nodule 0.3
Rhizoplane 13.47
Rhizosphere 66.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0233218 3300037418 Bacteria 1850
2 LJQas_1001054 3300000549 Bacteria 4203
3 JGI24735J21928_10016362 3300002067 Bacteria 2303
4 Ga0070658_10028093 3300005327 Bacteria 4516
5 Ga0070658_10033813 3300005327 Bacteria 4114
6 Ga0070683_100139008 3300005329 Bacteria 2301
7 Ga0070683_100234730 3300005329 Bacteria 1744
8 Ga0070682_100094615 3300005337 Bacteria 1960
9 Ga0070682_100166426 3300005337 Bacteria 1528
10 Ga0070700_100430709 3300005441 Bacteria 999
11 Ga0070678_100410206 3300005456 Bacteria 1179
12 Ga0070681_10114005 3300005458 Bacteria 2642
13 Ga0070698_100001048 3300005471 Bacteria 30448
14 Ga0070679_100258922 3300005530 Bacteria 1695
15 Ga0070684_100085098 3300005535 Bacteria 2804
16 Ga0070684_100483840 3300005535 Bacteria 1146
17 Ga0070665_100001394 3300005548 Bacteria 28474
18 Ga0068860_100000955 3300005843 Bacteria 31984
19 Ga0081539_10030893 3300005985 Bacteria 3313
20 Ga0081539_10083246 3300005985 Bacteria 1675
21 Ga0075365_10001978 3300006038 Bacteria 9687
22 Ga0075365_10033392 3300006038 Bacteria 3315
23 Ga0075365_10039925 3300006038 Bacteria 3059
24 Ga0075365_10041626 3300006038 Bacteria 3002
25 Ga0075365_10043224 3300006038 Bacteria 2950
26 Ga0075365_10058771 3300006038 Bacteria 2561
27 Ga0075365_10191777 3300006038 Bacteria 1430
28 Ga0075365_10196217 3300006038 Bacteria 1413
29 Ga0075365_10228894 3300006038 Bacteria 1305
30 Ga0075365_10272140 3300006038 Bacteria 1191
31 Ga0075365_10331106 3300006038 Bacteria 1073
32 Ga0075368_10103023 3300006042 Bacteria 1173
33 Ga0075363_100003066 3300006048 Bacteria 7007
34 Ga0075363_100015539 3300006048 Bacteria 3744
35 Ga0075363_100199225 3300006048 Bacteria 1143
36 Ga0075364_10038921 3300006051 Bacteria 3082
37 Ga0075364_10138749 3300006051 Bacteria 1634
38 Ga0075362_10241445 3300006177 Bacteria 887
39 Ga0075362_10275136 3300006177 Bacteria 832
40 Ga0075367_10007878 3300006178 Bacteria 5484
41 Ga0075367_10011779 3300006178 Bacteria 4641
42 Ga0075370_10006196 3300006353 Bacteria 6002
43 Ga0075434_100185017 3300006871 Bacteria 2104
44 Ga0068865_100438127 3300006881 Bacteria 1078
45 Ga0105245_10096650 3300009098 Bacteria 2726
46 Ga0114129_10005782 3300009147 Bacteria 17514
47 Ga0105243_10119934 3300009148 Bacteria 2216
48 Ga0105243_10801426 3300009148 Bacteria 928
49 Ga0105248_10177174 3300009177 Bacteria 2403
50 Ga0105248_10282228 3300009177 Bacteria 1870
51 Ga0105239_10059493 3300010375 Bacteria 4193
52 Ga0105239_10384719 3300010375 Bacteria 1586
53 Ga0105246_10068510 3300011119 Bacteria 2489
54 Ga0163162_10444493 3300013306 Bacteria 1429
55 Ga0163162_11073855 3300013306 Bacteria 912
56 Ga0163162_11206043 3300013306 Bacteria 859
57 Ga0157372_10305322 3300013307 Bacteria 1851
58 Ga0157372_11000538 3300013307 Bacteria 968
59 Ga0157375_10127841 3300013308 Bacteria 2658
60 Ga0157375_10389851 3300013308 Bacteria 1560
61 Ga0157380_11186753 3300014326 Bacteria 806
62 Ga0182008_10031686 3300014497 Bacteria 2659
63 Ga0157376_10190495 3300014969 Bacteria 1880
64 Ga0163161_10020482 3300017792 Bacteria 4641
65 Ga0207688_10009541 3300025901 Bacteria 5282
66 Ga0207647_10006965 3300025904 Bacteria 8192
67 Ga0207647_10157918 3300025904 Bacteria 1324
68 Ga0207705_10053722 3300025909 Bacteria 2903
69 Ga0207707_10063626 3300025912 Bacteria 3211
70 Ga0207657_10132465 3300025919 Bacteria 2042
71 Ga0207652_10469932 3300025921 Bacteria 1133
72 Ga0207669_10080953 3300025937 Bacteria 2079
73 Ga0207691_10084447 3300025940 Bacteria 2850
74 Ga0207711_10442621 3300025941 Bacteria 1209
75 Ga0207711_10517551 3300025941 Bacteria 1112
76 Ga0207661_10050490 3300025944 Bacteria 3314
77 Ga0207661_10074093 3300025944 Bacteria 2790
78 Ga0207661_10120570 3300025944 Bacteria 2232
79 Ga0207679_10303267 3300025945 Bacteria 1378
80 Ga0207668_10605268 3300025972 Bacteria 955
81 Ga0207658_10149446 3300025986 Bacteria 1901
82 Ga0207677_10675272 3300026023 Bacteria 914
83 Ga0207639_10798571 3300026041 Bacteria 879
84 Ga0207708_10030272 3300026075 Bacteria 4104
85 Ga0207708_10067887 3300026075 Bacteria 2728
86 Ga0207708_10388347 3300026075 Bacteria 1152
87 Ga0207674_10065596 3300026116 Bacteria 3658
88 Ga0207675_100076879 3300026118 Bacteria 3126
89 Ga0207683_10072311 3300026121 Bacteria 3050
90 Ga0207683_10176122 3300026121 Bacteria 1938
91 Ga0207698_10156203 3300026142 Bacteria 1988
92 Ga0209813_10006630 3300027866 Bacteria 2866
93 Ga0268266_10011544 3300028379 Bacteria 7669
94 Ga0268266_10110367 3300028379 Bacteria 2437
95 Ga0268266_10181467 3300028379 Bacteria 1917
96 Ga0268264_10000249 3300028381 Bacteria 101309
97 Ga0314311_1048161 3300030733 Bacteria 1266
98 Ga0316181_1093631 3300030744 Bacteria 964
99 Ga0307513_10353993 3300031456 Bacteria 1215
100 Ga0307413_10100667 3300031824 Bacteria 1909
101 Ga0307413_10375535 3300031824 Bacteria 1106
102 Ga0307410_10174757 3300031852 Bacteria 1622
103 Ga0307410_10304755 3300031852 Bacteria 1258
104 Ga0307406_10054992 3300031901 Bacteria 2543
105 Ga0307406_10103680 3300031901 Bacteria 1943
106 Ga0307407_10020592 3300031903 Bacteria 3384
107 Ga0307407_10133549 3300031903 Bacteria 1591
108 Ga0307407_10168333 3300031903 Bacteria 1441
109 Ga0307412_10084380 3300031911 Bacteria 2205
110 Ga0307412_10647743 3300031911 Bacteria 901
111 Ga0307409_100310717 3300031995 Bacteria 1471
112 Ga0307409_100580548 3300031995 Bacteria 1105
113 Ga0307409_100717092 3300031995 Bacteria 1001
114 Ga0307409_100748914 3300031995 Bacteria 980
115 Ga0307416_100034099 3300032002 Bacteria 3869
116 Ga0307414_10097243 3300032004 Bacteria 2205
117 Ga0307411_10143241 3300032005 Bacteria 1765
118 Ga0307411_10401942 3300032005 Bacteria 1133
119 Ga0307415_100174143 3300032126 Bacteria 1681
120 Ga0395900_0325517 3300037418 Bacteria 1516
121 Ga0395900_0528438 3300037418 Bacteria 1127
122 Ga0395900_0745806 3300037418 Bacteria 910
123 Ga0395898_0019731 3300037466 Bacteria 6855
124 Ga0395898_0074990 3300037466 Bacteria 3268
125 Ga0395898_0174722 3300037466 Bacteria 2053
126 Ga0395905_0035332 3300037471 Bacteria 4693
127 Ga0395901_0049565 3300038443 Bacteria 4364
128 Ga0395901_0138994 3300038443 Bacteria 2553
129 Ga0436365_1708981 3300039437 Bacteria 1806
130 Ga0439436_0104235 3300041404 Bacteria 791
131 Ga0451835_1171715 3300041492 Bacteria 768
132 Ga0451841_1217120 3300041498 Bacteria 1093
133 Ga0451853_1022616 3300041512 Bacteria 1782
134 Ga0439449_0190590 3300042007 Bacteria 767
135 Ga0439446_0013369 3300042156 Bacteria 2252
136 Ga0466972_0197805 3300044658 Bacteria 942
137 Ga0466965_0026853 3300044683 Bacteria 2792
138 Ga0466965_0066681 3300044683 Bacteria 1805
139 Ga0466966_0006911 3300044684 Bacteria 7518
140 Ga0466966_0027499 3300044684 Bacteria 3709
141 Ga0466966_0047182 3300044684 Bacteria 2748
142 Ga0466966_0093298 3300044684 Bacteria 1867
143 Ga0466966_0140533 3300044684 Bacteria 1476
144 Ga0466961_0007069 3300044693 Bacteria 7142
145 Ga0466961_0077402 3300044693 Bacteria 2107
146 Ga0466963_0019531 3300044694 Bacteria 4252
147 Ga0466963_0061348 3300044694 Bacteria 2513
148 Ga0466963_0065393 3300044694 Bacteria 2438
149 Ga0466963_0163707 3300044694 Bacteria 1549
150 Ga0466963_0338012 3300044694 Bacteria 1060
151 Ga0466964_0007558 3300044706 Bacteria 4066
152 Ga0466964_0377567 3300044706 Bacteria 735
153 Ga0466971_0023644 3300044719 Bacteria 2739
154 Ga0466971_0122392 3300044719 Bacteria 1205
155 Ga0466971_0184930 3300044719 Bacteria 980
156 Ga0466968_0099563 3300044735 Bacteria 1296
157 Ga0466970_0026233 3300044765 Bacteria 3054
158 Ga0466970_0037699 3300044765 Bacteria 2563
159 Ga0466970_0071009 3300044765 Bacteria 1872
160 Ga0466957_0017817 3300044842 Bacteria 4166
161 Ga0466957_0026927 3300044842 Bacteria 3413
162 Ga0466960_0000259 3300044901 Bacteria 18187
163 Ga0466960_0028504 3300044901 Bacteria 2555
164 Ga0466959_0469316 3300045049 Bacteria 852
165 Ga0466958_0091076 3300045836 Bacteria 1887
166 Ga0466967_0031925 3300045976 Bacteria 4440
167 Ga0466967_0049815 3300045976 Bacteria 3665
168 Ga0466967_0058974 3300045976 Bacteria 3395
169 Ga0466967_0088179 3300045976 Bacteria 2815
170 Ga0466967_0116715 3300045976 Bacteria 2459
171 Ga0466967_0156581 3300045976 Bacteria 2135
172 Ga0495641_0024406 3300046461 Bacteria 2985
173 Ga0495582_0047417 3300046473 Bacteria 2367
174 Ga0495664_0052525 3300046477 Bacteria 2422
175 Ga0495630_0251618 3300046517 Bacteria 1350
176 Ga0495668_0464480 3300046616 Bacteria 697
177 Ga0495658_0220589 3300046683 Bacteria 1187
178 Ga0495674_0686360 3300047319 Bacteria 805
179 Ga0496100_0125017 3300048903 Bacteria 1804
180 Ga0496101_0185775 3300048904 Bacteria 1602
181 Ga0496101_0445566 3300048904 Bacteria 1021
182 Ga0496101_0839569 3300048904 Bacteria 724
183 Ga0496102_0029991 3300048905 Bacteria 4867
184 Ga0496102_0038726 3300048905 Bacteria 4304
185 Ga0496102_0113894 3300048905 Bacteria 2523
186 Ga0496102_0164596 3300048905 Bacteria 2087
187 Ga0496102_0522074 3300048905 Bacteria 1110
188 Ga0496102_0629945 3300048905 Bacteria 996
189 Ga0496103_0035031 3300048906 Bacteria 3072
190 Ga0496103_0107693 3300048906 Bacteria 1768
191 Ga0496104_0016279 3300048907 Bacteria 6750
192 Ga0496104_0594739 3300048907 Bacteria 1017
193 Ga0496105_0025307 3300048908 Bacteria 4830
194 Ga0496106_0006036 3300048909 Bacteria 8966
195 Ga0496106_0041419 3300048909 Bacteria 3451
196 Ga0496106_0357467 3300048909 Bacteria 1173
197 Ga0496107_0054195 3300048910 Bacteria 2894
198 Ga0496107_0461635 3300048910 Bacteria 943
199 Ga0496108_0110197 3300048911 Bacteria 2353
200 Ga0496108_0218317 3300048911 Bacteria 1656
201 Ga0496108_0282701 3300048911 Bacteria 1444
202 Ga0496108_0482781 3300048911 Bacteria 1083
203 Ga0496109_0049486 3300048912 Bacteria 3826
204 Ga0496109_0266391 3300048912 Bacteria 1614
205 Ga0496109_0275159 3300048912 Bacteria 1586
206 Ga0496109_0713312 3300048912 Bacteria 940
207 Ga0496110_0029166 3300048913 Bacteria 4746
208 Ga0496110_0042199 3300048913 Bacteria 3981
209 Ga0496110_0162041 3300048913 Bacteria 2028
210 Ga0496110_0166698 3300048913 Bacteria 1998
211 Ga0496110_0249069 3300048913 Bacteria 1617
212 Ga0496111_0204168 3300048914 Bacteria 1469
213 Ga0496111_0328532 3300048914 Bacteria 1132
214 Ga0496111_0333202 3300048914 Bacteria 1124
215 Ga0496111_0377443 3300048914 Bacteria 1048
216 Ga0496112_0241564 3300048915 Bacteria 1759
217 Ga0496113_0223446 3300048916 Bacteria 1501
218 Ga0496114_0018447 3300048917 Bacteria 5640
219 Ga0496114_0117204 3300048917 Bacteria 2287
220 Ga0496114_0118086 3300048917 Bacteria 2279
221 Ga0496115_0056834 3300048918 Bacteria 3145
222 Ga0496115_0088177 3300048918 Bacteria 2533
223 Ga0496115_0362211 3300048918 Bacteria 1181
224 Ga0501031_0045239 3300049568 Bacteria 2872
225 Ga0501032_0132471 3300049569 Bacteria 1644
226 Ga0501033_0193875 3300049570 Bacteria 1453
227 Ga0501034_0095186 3300049571 Bacteria 2975
228 Ga0501036_0020006 3300049572 Bacteria 5619
229 Ga0501036_0065341 3300049572 Bacteria 3080
230 Ga0501036_0079085 3300049572 Bacteria 2782
231 Ga0501037_0033098 3300049573 Bacteria 3819
232 Ga0501038_0054764 3300049574 Bacteria 3429
233 Ga0501039_0019658 3300049575 Bacteria 5179
234 Ga0501039_0038815 3300049575 Bacteria 3677
235 Ga0501039_0077112 3300049575 Bacteria 2592
236 Ga0501039_0155270 3300049575 Bacteria 1798
237 Ga0501039_0397930 3300049575 Bacteria 1082
238 Ga0501041_0014585 3300049577 Bacteria 4666
239 Ga0501041_0301164 3300049577 Bacteria 1010
240 Ga0501042_0006911 3300049578 Bacteria 7405
241 Ga0501042_0112115 3300049578 Bacteria 1964
242 Ga0501042_0121330 3300049578 Bacteria 1882
243 Ga0501042_0247862 3300049578 Bacteria 1285
244 Ga0501043_0147931 3300049579 Bacteria 1839
245 Ga0501046_0008650 3300049580 Bacteria 8850
246 Ga0501046_0083857 3300049580 Bacteria 2459
247 Ga0501047_0000264 3300049581 Bacteria 61679
248 Ga0501047_0549328 3300049581 Bacteria 979
249 Ga0501048_0002842 3300049582 Bacteria 13220
250 Ga0501048_0068908 3300049582 Bacteria 2499
251 Ga0501067_0004003 3300049583 Bacteria 8135
252 Ga0501067_0138426 3300049583 Bacteria 1355
253 Ga0501069_0013496 3300049585 Bacteria 4357
254 Ga0501069_0035245 3300049585 Bacteria 2756
255 Ga0501069_0036028 3300049585 Bacteria 2727
256 Ga0501069_0049861 3300049585 Bacteria 2327
257 Ga0501069_0380937 3300049585 Bacteria 833
258 Ga0501070_0004128 3300049586 Bacteria 12497
259 Ga0501071_0592646 3300049587 Bacteria 852
260 Ga0501072_0059847 3300049588 Bacteria 3003
261 Ga0501072_0215974 3300049588 Bacteria 1528
262 Ga0501072_0365337 3300049588 Bacteria 1145
263 Ga0501073_0128571 3300049589 Bacteria 1756
264 Ga0501074_0064099 3300049590 Bacteria 2646
265 Ga0501074_0080868 3300049590 Bacteria 2331
266 Ga0501075_0019193 3300049591 Bacteria 4958
267 Ga0501076_0094651 3300049592 Bacteria 2405
268 Ga0501076_0140624 3300049592 Bacteria 1961
269 Ga0501079_0081063 3300049741 Bacteria 2509
270 Ga0501079_0280215 3300049741 Bacteria 1304
271 Ga0501080_0197431 3300049742 Bacteria 1848
272 Ga0501080_0254820 3300049742 Bacteria 1600
273 Ga0501083_0531589 3300049744 Bacteria 765
274 Ga0501035_0118089 3300049822 Bacteria 2320
275 Ga0501035_0159836 3300049822 Bacteria 1951
276 Ga0501044_0207778 3300049823 Bacteria 1913
277 Ga0501045_0015860 3300049824 Bacteria 5344
278 Ga0501045_0195159 3300049824 Bacteria 1509
279 Ga0501045_0472504 3300049824 Bacteria 932
280 nmdc:mga03683_269105_c1 3300050489 Bacteria 794
281 nmdc:mga03n38_21310_c1 3300050490 Bacteria 2606
282 nmdc:mga00v17_144004_c1 3300050491 Bacteria 1529
283 nmdc:mga00v17_51171_c1 3300050491 Bacteria 2512
284 nmdc:mga0yw44_151636_c1 3300050492 Bacteria 1512
285 nmdc:mga0yw44_18584_c1 3300050492 Bacteria 3812
286 nmdc:mga0yw44_1955_c1 3300050492 Bacteria 8542
287 nmdc:mga0yw44_34142_c1 3300050492 Bacteria 2978
288 nmdc:mga0yw44_435314_c1 3300050492 Bacteria 888
289 nmdc:mga0yw44_77034_c1 3300050492 Bacteria 2082
290 nmdc:mga06z11_23287_c1 3300050494 Bacteria 2907
291 nmdc:mga06z11_281357_c1 3300050494 Bacteria 985
292 nmdc:mga06z11_418226_c1 3300050494 Bacteria 808
293 nmdc:mga06z11_83961_c1 3300050494 Bacteria 1715
294 nmdc:mga04h51_63684_c1 3300050495 Bacteria 1270
295 nmdc:mga04h51_98888_c1 3300050495 Bacteria 1061
296 nmdc:mga07m45_13900_c1 3300050496 Bacteria 4279
297 nmdc:mga07m45_61932_c1 3300050496 Bacteria 1377
298 nmdc:mga05p37_157_c1 3300050507 Bacteria 65045
299 nmdc:mga09592_79_c1 3300050508 Bacteria 56100
300 nmdc:mga0qj67_24299_c2 3300050509 Bacteria 2095
301 nmdc:mga06r32_122_c1 3300050510 Bacteria 55812
302 nmdc:mga08y16_15987_c1 3300050511 Bacteria 7888
303 nmdc:mga08y16_40956_c1 3300050511 Bacteria 4853
304 nmdc:mga0n895_229806_c1 3300050512 Bacteria 1883
305 nmdc:mga0a205_111940_c1 3300050515 Bacteria 1129
306 Ga0495601_0025650 3300053077 Bacteria 3636
307 Ga0495655_0032570 3300053083 Bacteria 1276
308 Ga0500556_0000514 3300053104 Bacteria 26445
309 Ga0500593_000621 3300053117 Bacteria 13657
310 Ga0500573_0001246 3300053140 Bacteria 12009
311 Ga0501084_0032379 3300054114 Bacteria 4373
312 Ga0501084_0047176 3300054114 Bacteria 3608
313 Ga0501082_0080768 3300060353 Bacteria 2806
314 Ga0466962_0026882 3300061719 Bacteria 2762
315 Ga0530510_0025380 3300061734 Bacteria 4237
316 Ga0530510_0138347 3300061734 Bacteria 1793
317 2643890525 2643221576 Bacteria 5214352
318 2643959581 2643221590 Bacteria 5214697
319 2644032966 2643221604 Bacteria 5014917
320 2644092926 2643221615 Bacteria 5487866
321 2644100534 2643221617 Bacteria 5139111
322 2644116942 2643221620 Bacteria 5134593
323 2644228339 2643221641 Bacteria 4490190
324 2644322539 2643221657 Bacteria 5490246
325 2738871918 2738541305 Bacteria 4910150
326 2812330976 2811994874 Bacteria 5367947
327 2812347797 2811994878 Bacteria 5992952
328 2857486206 2857481737 Bacteria 4761446
329 2919069967 2919069694 Bacteria 3622919
330 2974324396 2974324384 Bacteria 3750535
331 2977229530 2977228692 Bacteria 3450105
332 2977238423 2977236895 Bacteria 3569373
333 2984543797 2984542743 Bacteria 3569378
334 8054609658 8054609563 Bacteria 5170090
335 Ga0395900_0233218
336 LJQas_1001054
337 JGI24735J21928_10016362
338 Ga0070658_10028093
339 Ga0070658_10033813
340 Ga0070683_100139008
341 Ga0070683_100234730
342 Ga0070682_100094615
343 Ga0070682_100166426
344 Ga0070700_100430709
345 Ga0070678_100410206
346 Ga0070681_10114005
347 Ga0070698_100001048
348 Ga0070679_100258922
349 Ga0070684_100085098
350 Ga0070684_100483840
351 Ga0070665_100001394
352 Ga0068860_100000955
353 Ga0081539_10030893
354 Ga0081539_10083246
355 Ga0075365_10001978
356 Ga0075365_10033392
357 Ga0075365_10039925
358 Ga0075365_10041626
359 Ga0075365_10043224
360 Ga0075365_10058771
361 Ga0075365_10191777
362 Ga0075365_10196217
363 Ga0075365_10228894
364 Ga0075365_10272140
365 Ga0075365_10331106
366 Ga0075368_10103023
367 Ga0075363_100003066
368 Ga0075363_100015539
369 Ga0075363_100199225
370 Ga0075364_10038921
371 Ga0075364_10138749
372 Ga0075362_10241445
373 Ga0075362_10275136
374 Ga0075367_10007878
375 Ga0075367_10011779
376 Ga0075370_10006196
377 Ga0075434_100185017
378 Ga0068865_100438127
379 Ga0105245_10096650
380 Ga0114129_10005782
381 Ga0105243_10119934
382 Ga0105243_10801426
383 Ga0105248_10177174
384 Ga0105248_10282228
385 Ga0105239_10059493
386 Ga0105239_10384719
387 Ga0105246_10068510
388 Ga0163162_10444493
389 Ga0163162_11073855
390 Ga0163162_11206043
391 Ga0157372_10305322
392 Ga0157372_11000538
393 Ga0157375_10127841
394 Ga0157375_10389851
395 Ga0157380_11186753
396 Ga0182008_10031686
397 Ga0157376_10190495
398 Ga0163161_10020482
399 Ga0207688_10009541
400 Ga0207647_10006965
401 Ga0207647_10157918
402 Ga0207705_10053722
403 Ga0207707_10063626
404 Ga0207657_10132465
405 Ga0207652_10469932
406 Ga0207669_10080953
407 Ga0207691_10084447
408 Ga0207711_10442621
409 Ga0207711_10517551
410 Ga0207661_10050490
411 Ga0207661_10074093
412 Ga0207661_10120570
413 Ga0207679_10303267
414 Ga0207668_10605268
415 Ga0207658_10149446
416 Ga0207677_10675272
417 Ga0207639_10798571
418 Ga0207708_10030272
419 Ga0207708_10067887
420 Ga0207708_10388347
421 Ga0207674_10065596
422 Ga0207675_100076879
423 Ga0207683_10072311
424 Ga0207683_10176122
425 Ga0207698_10156203
426 Ga0209813_10006630
427 Ga0268266_10011544
428 Ga0268266_10110367
429 Ga0268266_10181467
430 Ga0268264_10000249
431 Ga0314311_1048161
432 Ga0316181_1093631
433 Ga0307513_10353993
434 Ga0307413_10100667
435 Ga0307413_10375535
436 Ga0307410_10174757
437 Ga0307410_10304755
438 Ga0307406_10054992
439 Ga0307406_10103680
440 Ga0307407_10020592
441 Ga0307407_10133549
442 Ga0307407_10168333
443 Ga0307412_10084380
444 Ga0307412_10647743
445 Ga0307409_100310717
446 Ga0307409_100580548
447 Ga0307409_100717092
448 Ga0307409_100748914
449 Ga0307416_100034099
450 Ga0307414_10097243
451 Ga0307411_10143241
452 Ga0307411_10401942
453 Ga0307415_100174143
454 Ga0395900_0325517
455 Ga0395900_0528438
456 Ga0395900_0745806
457 Ga0395898_0019731
458 Ga0395898_0074990
459 Ga0395898_0174722
460 Ga0395905_0035332
461 Ga0395901_0049565
462 Ga0395901_0138994
463 Ga0436365_1708981
464 Ga0439436_0104235
465 Ga0451835_1171715
466 Ga0451841_1217120
467 Ga0451853_1022616
468 Ga0439449_0190590
469 Ga0439446_0013369
470 Ga0466972_0197805
471 Ga0466965_0026853
472 Ga0466965_0066681
473 Ga0466966_0006911
474 Ga0466966_0027499
475 Ga0466966_0047182
476 Ga0466966_0093298
477 Ga0466966_0140533
478 Ga0466961_0007069
479 Ga0466961_0077402
480 Ga0466963_0019531
481 Ga0466963_0061348
482 Ga0466963_0065393
483 Ga0466963_0163707
484 Ga0466963_0338012
485 Ga0466964_0007558
486 Ga0466964_0377567
487 Ga0466971_0023644
488 Ga0466971_0122392
489 Ga0466971_0184930
490 Ga0466968_0099563
491 Ga0466970_0026233
492 Ga0466970_0037699
493 Ga0466970_0071009
494 Ga0466957_0017817
495 Ga0466957_0026927
496 Ga0466960_0000259
497 Ga0466960_0028504
498 Ga0466959_0469316
499 Ga0466958_0091076
500 Ga0466967_0031925
501 Ga0466967_0049815
502 Ga0466967_0058974
503 Ga0466967_0088179
504 Ga0466967_0116715
505 Ga0466967_0156581
506 Ga0495641_0024406
507 Ga0495582_0047417
508 Ga0495664_0052525
509 Ga0495630_0251618
510 Ga0495668_0464480
511 Ga0495658_0220589
512 Ga0495674_0686360
513 Ga0496100_0125017
514 Ga0496101_0185775
515 Ga0496101_0445566
516 Ga0496101_0839569
517 Ga0496102_0029991
518 Ga0496102_0038726
519 Ga0496102_0113894
520 Ga0496102_0164596
521 Ga0496102_0522074
522 Ga0496102_0629945
523 Ga0496103_0035031
524 Ga0496103_0107693
525 Ga0496104_0016279
526 Ga0496104_0594739
527 Ga0496105_0025307
528 Ga0496106_0006036
529 Ga0496106_0041419
530 Ga0496106_0357467
531 Ga0496107_0054195
532 Ga0496107_0461635
533 Ga0496108_0110197
534 Ga0496108_0218317
535 Ga0496108_0282701
536 Ga0496108_0482781
537 Ga0496109_0049486
538 Ga0496109_0266391
539 Ga0496109_0275159
540 Ga0496109_0713312
541 Ga0496110_0029166
542 Ga0496110_0042199
543 Ga0496110_0162041
544 Ga0496110_0166698
545 Ga0496110_0249069
546 Ga0496111_0204168
547 Ga0496111_0328532
548 Ga0496111_0333202
549 Ga0496111_0377443
550 Ga0496112_0241564
551 Ga0496113_0223446
552 Ga0496114_0018447
553 Ga0496114_0117204
554 Ga0496114_0118086
555 Ga0496115_0056834
556 Ga0496115_0088177
557 Ga0496115_0362211
558 Ga0501031_0045239
559 Ga0501032_0132471
560 Ga0501033_0193875
561 Ga0501034_0095186
562 Ga0501036_0020006
563 Ga0501036_0065341
564 Ga0501036_0079085
565 Ga0501037_0033098
566 Ga0501038_0054764
567 Ga0501039_0019658
568 Ga0501039_0038815
569 Ga0501039_0077112
570 Ga0501039_0155270
571 Ga0501039_0397930
572 Ga0501041_0014585
573 Ga0501041_0301164
574 Ga0501042_0006911
575 Ga0501042_0112115
576 Ga0501042_0121330
577 Ga0501042_0247862
578 Ga0501043_0147931
579 Ga0501046_0008650
580 Ga0501046_0083857
581 Ga0501047_0000264
582 Ga0501047_0549328
583 Ga0501048_0002842
584 Ga0501048_0068908
585 Ga0501067_0004003
586 Ga0501067_0138426
587 Ga0501069_0013496
588 Ga0501069_0035245
589 Ga0501069_0036028
590 Ga0501069_0049861
591 Ga0501069_0380937
592 Ga0501070_0004128
593 Ga0501071_0592646
594 Ga0501072_0059847
595 Ga0501072_0215974
596 Ga0501072_0365337
597 Ga0501073_0128571
598 Ga0501074_0064099
599 Ga0501074_0080868
600 Ga0501075_0019193
601 Ga0501076_0094651
602 Ga0501076_0140624
603 Ga0501079_0081063
604 Ga0501079_0280215
605 Ga0501080_0197431
606 Ga0501080_0254820
607 Ga0501083_0531589
608 Ga0501035_0118089
609 Ga0501035_0159836
610 Ga0501044_0207778
611 Ga0501045_0015860
612 Ga0501045_0195159
613 Ga0501045_0472504
614 nmdc:mga03683_269105_c1
615 nmdc:mga03n38_21310_c1
616 nmdc:mga00v17_144004_c1
617 nmdc:mga00v17_51171_c1
618 nmdc:mga0yw44_151636_c1
619 nmdc:mga0yw44_18584_c1
620 nmdc:mga0yw44_1955_c1
621 nmdc:mga0yw44_34142_c1
622 nmdc:mga0yw44_435314_c1
623 nmdc:mga0yw44_77034_c1
624 nmdc:mga06z11_23287_c1
625 nmdc:mga06z11_281357_c1
626 nmdc:mga06z11_418226_c1
627 nmdc:mga06z11_83961_c1
628 nmdc:mga04h51_63684_c1
629 nmdc:mga04h51_98888_c1
630 nmdc:mga07m45_13900_c1
631 nmdc:mga07m45_61932_c1
632 nmdc:mga05p37_157_c1
633 nmdc:mga09592_79_c1
634 nmdc:mga0qj67_24299_c2
635 nmdc:mga06r32_122_c1
636 nmdc:mga08y16_15987_c1
637 nmdc:mga08y16_40956_c1
638 nmdc:mga0n895_229806_c1
639 nmdc:mga0a205_111940_c1
640 Ga0495601_0025650
641 Ga0495655_0032570
642 Ga0500556_0000514
643 Ga0500593_000621
644 Ga0500573_0001246
645 Ga0501084_0032379
646 Ga0501084_0047176
647 Ga0501082_0080768
648 Ga0466962_0026882
649 Ga0530510_0025380
650 Ga0530510_0138347
651 2643890525
652 2643959581
653 2644032966
654 2644092926
655 2644100534
656 2644116942
657 2644228339
658 2644322539
659 2738871918
660 2812330976
661 2812347797
662 2857486206
663 2919069967
664 2974324396
665 2977229530
666 2977238423
667 2984543797
668 8054609658

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

114

251

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.8354 96 240
6qkv-assembly1.cif.gz_A structure of yibk from p. aeruginosa 0.8327 94 240
6qh8-assembly2.cif.gz_B structure of knotted yibk from p. aeruginosa 0.8298 94 240
7e3s-assembly1.cif.gz_A crystal structure of trml from shewanella oneidensis 0.8247 95 250
4kgn-assembly1.cif.gz_A crystal structure of a trna (cytidine(34)-2'-o)-methyltransferase bound to s-adenosyl homocysteine 0.8247 96 240
ID Description Score Start End Superfamily
af_O53715_16_181_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.933 78 246 3.40.1280.10
af_O53715_16_181_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9276 78 246 3.40.1280.10
af_Q8GYT1_4_157_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8894 95 237 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8465 91 240 3.40.1280.10
1x7pB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8375 93 246 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A126ZX68-F1-model_v4 rRNA methylase 0.943 43 240 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A0T2L2F8-F1-model_v4 rRNA methyltransferase 0.9426 45 243 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A2G4FHV7-F1-model_v4 rRNA methyltransferase 0.9425 39 242 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-A0A0K8QB88-F1-model_v4 tRNA (Guanosine(18)-2'-O)-methyltransferase 0.9405 61 241 GO:0003723
GO:0006396
GO:0008173
GO:0032259
AF-M7MKP9-F1-model_v4 TrmH family RNA methyltransferase 0.9401 46 241 GO:0003723
GO:0006396
GO:0008173
GO:0032259

Map