F411745

General Info

Members Datasets Scaffolds Average Seq Length
334 243 328 219

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100576514|Ga0075436_1005765141
Length 247
Sequence MILRDVTASVGRTPMVELNIDRSVSMRKLIVSTFASLDGIMQAPGGPEEDPTGGFTLGGWMFSYWDEGMDISPAGFDGKDRELVLGRRTYQIFEAYWPYQPEDDPIAKTLNAAKKHVASRTLTMLHWNNSTLLHGDVVSAIIALKAQPGPDLQIIGSGNLIQTLQAEPVIDEYNVWAFPVVLGRGKRLFSETAKPTALRLVRSQVSATGVVMSTYVPAGDVQPGSFPSLEPSKKELARRKMIANETW

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2791355267 Rhizobium sp. L18 Isolate Nodule
3 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
4 2884411467 Dyella sp. AD56 Isolate Rhizosphere
5 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
176 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
177 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
223 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
224 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
228 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
241 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.3
Isolates 1.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.17
Nodule 0.6
Rhizoplane 1.8
Rhizosphere 82.63
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000905 3300002773 Bacteria 14528
2 JGI25150J39212_1023310 3300002774 Bacteria 921
3 JGI25153J46596_10000393 3300003215 Bacteria 29527
4 rootL2_10264288 3300003322 Bacteria 2884
5 Ga0055526_1002422 3300003771 Bacteria 12637
6 Ga0055528_1021216 3300003790 Bacteria 2070
7 Ga0055540_1000235 3300003792 Bacteria 50448
8 Ga0055531_10000704 3300003794 Bacteria 28474
9 Ga0065707_10084718 3300005295 Bacteria 6855
10 Ga0065707_10262232 3300005295 Bacteria 1094
11 Ga0070658_10051469 3300005327 Unclassified 3338
12 Ga0070676_10001968 3300005328 Bacteria 10433
13 Ga0070676_10020931 3300005328 Bacteria 3658
14 Ga0070690_100002088 3300005330 Bacteria 10675
15 Ga0070670_100019319 3300005331 Bacteria 5847
16 Ga0068869_100080328 3300005334 Bacteria 2432
17 Ga0070680_100448531 3300005336 Bacteria 1102
18 Ga0068868_100020067 3300005338 Bacteria 5016
19 Ga0070689_100017716 3300005340 Bacteria 5237
20 Ga0070661_100014346 3300005344 Bacteria 5581
21 Ga0070692_10021389 3300005345 Bacteria 3146
22 Ga0070668_100054135 3300005347 Bacteria 3095
23 Ga0070675_100221824 3300005354 Bacteria 1646
24 Ga0070671_100368480 3300005355 Bacteria 1227
25 Ga0070674_100160812 3300005356 Bacteria 1704
26 Ga0070659_100000877 3300005366 Bacteria 21982
27 Ga0070709_10187813 3300005434 Bacteria 1455
28 Ga0070710_10061584 3300005437 Bacteria 2137
29 Ga0070701_10001145 3300005438 Bacteria 9687
30 Ga0070705_100038382 3300005440 Bacteria 2709
31 Ga0070705_100261297 3300005440 Bacteria 1221
32 Ga0070700_100060867 3300005441 Bacteria 2381
33 Ga0070694_100173500 3300005444 Bacteria 1590
34 Ga0070708_100015430 3300005445 Bacteria 6310
35 Ga0070708_100022812 3300005445 Bacteria 5314
36 Ga0070708_100083961 3300005445 Bacteria 2889
37 Ga0070678_100007754 3300005456 Bacteria 6384
38 Ga0070662_100342222 3300005457 Bacteria 1224
39 Ga0068867_100048997 3300005459 Bacteria 3109
40 Ga0068867_100065017 3300005459 Bacteria 2713
41 Ga0068867_100080969 3300005459 Bacteria 2447
42 Ga0070706_100072817 3300005467 Bacteria 3179
43 Ga0070706_100325474 3300005467 Bacteria 1433
44 Ga0070707_100027501 3300005468 Archaea 5411
45 Ga0070707_100111894 3300005468 Bacteria 2648
46 Ga0070707_100306055 3300005468 Bacteria 1544
47 Ga0070698_100000606 3300005471 Bacteria 38432
48 Ga0070698_100000754 3300005471 Bacteria 34978
49 Ga0070698_100237291 3300005471 Bacteria 1756
50 Ga0070698_100387483 3300005471 Bacteria 1330
51 Ga0070698_100453231 3300005471 Bacteria 1218
52 Ga0070699_100223480 3300005518 Bacteria 1678
53 Ga0070699_101167024 3300005518 Bacteria 706
54 Ga0070684_100141030 3300005535 Bacteria 2179
55 Ga0070697_100017852 3300005536 Bacteria 5588
56 Ga0070697_100062602 3300005536 Bacteria 3037
57 Ga0070697_100136059 3300005536 Bacteria 2063
58 Ga0068853_100167059 3300005539 Bacteria 1989
59 Ga0070686_100070395 3300005544 Bacteria 2287
60 Ga0070695_100251443 3300005545 Bacteria 1287
61 Ga0070696_100064277 3300005546 Bacteria 2571
62 Ga0070693_100139906 3300005547 Bacteria 1522
63 Ga0070693_100145358 3300005547 Bacteria 1497
64 Ga0070665_100559922 3300005548 Bacteria 1155
65 Ga0070704_100082838 3300005549 Bacteria 2366
66 Ga0068855_100818818 3300005563 Bacteria 988
67 Ga0070664_100009920 3300005564 Bacteria 7719
68 Ga0070664_100217063 3300005564 Bacteria 1710
69 Ga0070702_100007221 3300005615 Bacteria 5309
70 Ga0068852_100702827 3300005616 Bacteria 1021
71 Ga0068859_100010898 3300005617 Bacteria 9151
72 Ga0068859_100138502 3300005617 Bacteria 2507
73 Ga0068864_100803850 3300005618 Bacteria 924
74 Ga0068866_10002842 3300005718 Bacteria 7136
75 Ga0068861_100333669 3300005719 Bacteria 1325
76 Ga0068861_100997818 3300005719 Bacteria 799
77 Ga0068870_10023154 3300005840 Bacteria 3061
78 Ga0068870_10411149 3300005840 Bacteria 883
79 Ga0068863_100047720 3300005841 Bacteria 4062
80 Ga0068858_100208893 3300005842 Bacteria 1847
81 Ga0068860_100268128 3300005843 Bacteria 1666
82 Ga0068862_100445410 3300005844 Bacteria 1220
83 Ga0068862_100653632 3300005844 Bacteria 1014
84 Ga0068862_100831332 3300005844 Bacteria 904
85 Ga0081538_10000237 3300005981 Bacteria 62261
86 Ga0070717_10137829 3300006028 Bacteria 2103
87 Ga0075365_10120854 3300006038 Bacteria 1807
88 Ga0075363_100041626 3300006048 Bacteria 2424
89 Ga0075363_100482152 3300006048 Bacteria 735
90 Ga0070716_100565837 3300006173 Bacteria 850
91 Ga0075362_10028888 3300006177 Bacteria 2385
92 Ga0075367_10066185 3300006178 Bacteria 2165
93 Ga0075369_10000052 3300006186 Bacteria 29737
94 Ga0075366_10003055 3300006195 Bacteria 8739
95 Ga0097621_100006574 3300006237 Bacteria 8256
96 Ga0097621_100157541 3300006237 Bacteria 1950
97 Ga0075370_10004854 3300006353 Bacteria 6594
98 Ga0075370_10005949 3300006353 Bacteria 6106
99 Ga0068871_100756849 3300006358 Bacteria 893
100 Ga0075428_101419976 3300006844 Bacteria 728
101 Ga0075430_100087591 3300006846 Bacteria 2606
102 Ga0075429_100000795 3300006880 Bacteria 24809
103 Ga0075429_100199997 3300006880 Bacteria 1751
104 Ga0068865_100100828 3300006881 Bacteria 2113
105 Ga0075436_100576514 3300006914 Bacteria 827
106 Ga0097620_100010897 3300006931 Bacteria 9151
107 Ga0097620_100138489 3300006931 Bacteria 2507
108 Ga0075435_100586703 3300007076 Bacteria 966
109 Ga0105240_10001378 3300009093 Bacteria 41800
110 Ga0105240_10008467 3300009093 Bacteria 14712
111 Ga0114129_10105262 3300009147 Bacteria 3899
112 Ga0114129_10944039 3300009147 Archaea 1090
113 Ga0114129_11522947 3300009147 Bacteria 821
114 Ga0114129_11577408 3300009147 Bacteria 804
115 Ga0105241_10195288 3300009174 Bacteria 1687
116 Ga0105241_10428153 3300009174 Bacteria 1166
117 Ga0105248_10046330 3300009177 Bacteria 4873
118 Ga0105237_10003089 3300009545 Bacteria 20060
119 Ga0105237_10058956 3300009545 Bacteria 3841
120 Ga0105237_10154318 3300009545 Bacteria 2293
121 Ga0105238_10002997 3300009551 Bacteria 16866
122 Ga0105238_10164511 3300009551 Bacteria 2194
123 Ga0105238_10442460 3300009551 Bacteria 1296
124 Ga0105249_10019013 3300009553 Bacteria 6127
125 Ga0105249_10126411 3300009553 Bacteria 2435
126 Ga0105239_10001251 3300010375 Bacteria 34516
127 Ga0105239_10874058 3300010375 Bacteria 1031
128 Ga0157378_11027644 3300013297 Bacteria 859
129 Ga0163162_10378150 3300013306 Bacteria 1549
130 Ga0163162_10480605 3300013306 Bacteria 1374
131 Ga0157380_10003515 3300014326 Bacteria 10768
132 Ga0157380_10028006 3300014326 Bacteria 4292
133 Ga0157380_10587087 3300014326 Bacteria 1100
134 Ga0157379_10396441 3300014968 Bacteria 1268
135 Ga0157376_10000316 3300014969 Bacteria 32419
136 Ga0183362_10015 3300015683 Bacteria 36270
137 Ga0163161_10069203 3300017792 Bacteria 2580
138 Ga0207425_1000203 3300025245 Bacteria 47325
139 Ga0209129_1000012 3300025258 Bacteria 541516
140 Ga0209565_1010153 3300025263 Bacteria 2347
141 Ga0209673_1001457 3300025273 Bacteria 22376
142 Ga0209673_1006934 3300025273 Bacteria 5356
143 Ga0209675_1000535 3300025291 Bacteria 27799
144 Ga0209676_1020648 3300025292 Bacteria 2231
145 Ga0209025_1000764 3300025294 Bacteria 53509
146 Ga0209564_1000022 3300025295 Bacteria 555109
147 Ga0209758_1000233 3300025297 Bacteria 116640
148 Ga0209050_1003703 3300025298 Bacteria 11004
149 Ga0209256_1000432 3300025299 Bacteria 65073
150 Ga0209256_1015693 3300025299 Bacteria 2632
151 Ga0209051_1000097 3300025303 Bacteria 167378
152 Ga0209051_1000353 3300025303 Bacteria 68321
153 Ga0209051_1002689 3300025303 Bacteria 12390
154 Ga0209257_1000022 3300025304 Bacteria 765258
155 Ga0207692_10387185 3300025898 Bacteria 869
156 Ga0207643_10047168 3300025908 Bacteria 2436
157 Ga0207643_10161081 3300025908 Bacteria 1350
158 Ga0207684_10484929 3300025910 Bacteria 1060
159 Ga0207654_10075080 3300025911 Bacteria 2019
160 Ga0207654_10154980 3300025911 Bacteria 1474
161 Ga0207695_10010279 3300025913 Bacteria 11465
162 Ga0207695_10111976 3300025913 Bacteria 2708
163 Ga0207693_10470821 3300025915 Bacteria 981
164 Ga0207660_10487425 3300025917 Bacteria 999
165 Ga0207649_10003248 3300025920 Bacteria 8892
166 Ga0207652_10048221 3300025921 Bacteria 3641
167 Ga0207681_10458283 3300025923 Bacteria 1038
168 Ga0207650_10014324 3300025925 Bacteria 5511
169 Ga0207687_10002826 3300025927 Bacteria 11777
170 Ga0207644_10012409 3300025931 Bacteria 5659
171 Ga0207690_10151261 3300025932 Bacteria 1721
172 Ga0207706_10361432 3300025933 Bacteria 1261
173 Ga0207686_10038826 3300025934 Bacteria 2884
174 Ga0207709_10121114 3300025935 Bacteria 1766
175 Ga0207709_10129761 3300025935 Bacteria 1716
176 Ga0207670_10377070 3300025936 Bacteria 1129
177 Ga0207669_10459215 3300025937 Bacteria 1011
178 Ga0207704_10115384 3300025938 Bacteria 1825
179 Ga0207691_10048785 3300025940 Bacteria 3880
180 Ga0207691_10135870 3300025940 Bacteria 2168
181 Ga0207711_10141032 3300025941 Bacteria 2168
182 Ga0207689_10000326 3300025942 Bacteria 44274
183 Ga0207661_10246862 3300025944 Archaea 1585
184 Ga0207679_10004446 3300025945 Bacteria 8734
185 Ga0207679_10067152 3300025945 Bacteria 2689
186 Ga0207667_10713045 3300025949 Bacteria 1005
187 Ga0207651_10232800 3300025960 Bacteria 1497
188 Ga0207668_10121080 3300025972 Bacteria 1982
189 Ga0207668_10224698 3300025972 Bacteria 1510
190 Ga0207658_10929016 3300025986 Bacteria 793
191 Ga0207703_10057348 3300026035 Bacteria 3175
192 Ga0207639_10024732 3300026041 Bacteria 4350
193 Ga0207639_10138450 3300026041 Bacteria 2025
194 Ga0207708_10000871 3300026075 Bacteria 22704
195 Ga0207641_10062479 3300026088 Bacteria 3179
196 Ga0207641_10124578 3300026088 Bacteria 2305
197 Ga0207648_10000213 3300026089 Bacteria 62371
198 Ga0207675_100000472 3300026118 Bacteria 39079
199 Ga0207675_100931506 3300026118 Bacteria 886
200 Ga0207683_10004691 3300026121 Bacteria 11782
201 Ga0207683_10046509 3300026121 Bacteria 3798
202 Ga0268265_10445112 3300028380 Bacteria 1208
203 Ga0268265_10630396 3300028380 Bacteria 1028
204 Ga0268264_10433410 3300028381 Unclassified 1270
205 Ga0268264_10581985 3300028381 Bacteria 1101
206 Ga0268264_10674973 3300028381 Bacteria 1024
207 Ga0265319_1006020 3300028563 Bacteria 5698
208 Ga0265318_10009406 3300028577 Bacteria 4298
209 Ga0265320_10004014 3300031240 Bacteria 9684
210 Ga0265327_10001211 3300031251 Bacteria 34800
211 Ga0307513_10000895 3300031456 Bacteria 43051
212 Ga0307408_100558139 3300031548 Bacteria 1011
213 Ga0307516_10061104 3300031730 Bacteria 3657
214 Ga0307405_10326925 3300031731 Bacteria 1174
215 Ga0307410_10158361 3300031852 Bacteria 1694
216 Ga0307410_10172750 3300031852 Bacteria 1630
217 Ga0307406_10743796 3300031901 Bacteria 823
218 Ga0307510_10061206 3300033180 Bacteria 3863
219 Ga0316587_1011305 3300033529 Bacteria 1439
220 Ga0373929_0000006 3300035085 Bacteria 324796
221 Ga0373946_0350659 3300035171 Bacteria 738
222 Ga0373933_0318722 3300035724 Bacteria 1008
223 Ga0316584_0172247 3300036712 Bacteria 1605
224 Ga0395900_0051584 3300037418 Bacteria 4237
225 Ga0395900_0458388 3300037418 Bacteria 1230
226 Ga0395900_0883578 3300037418 Bacteria 818
227 Ga0395898_0106149 3300037466 Bacteria 2694
228 Ga0395905_0047280 3300037471 Bacteria 4033
229 Ga0395905_0076213 3300037471 Bacteria 3143
230 Ga0395905_0544793 3300037471 Bacteria 1061
231 Ga0395901_0672607 3300038443 Bacteria 1036
232 Ga0436361_0714544 3300039447 Bacteria 3352
233 Ga0439465_0173590 3300041413 Bacteria 778
234 Ga0451804_0597544 3300041463 Bacteria 1204
235 Ga0451853_0704546 3300041512 Bacteria 1302
236 Ga0439437_018034 3300042000 Bacteria 842
237 Ga0450919_001671 3300042121 Bacteria 2906
238 Ga0450918_000277 3300042531 Bacteria 11581
239 Ga0451577_0000192 3300042876 Bacteria 128752
240 Ga0451577_0000530 3300042876 Bacteria 63316
241 Ga0451577_0003120 3300042876 Bacteria 18694
242 Ga0451577_0037057 3300042876 Bacteria 4391
243 Ga0451577_0054331 3300042876 Bacteria 3575
244 Ga0453683_0002376 3300044673 Bacteria 14708
245 Ga0453683_0010632 3300044673 Bacteria 6092
246 Ga0453683_0017917 3300044673 Bacteria 4551
247 Ga0453683_0131112 3300044673 Bacteria 1580
248 Ga0453683_0190036 3300044673 Bacteria 1303
249 Ga0466965_0051651 3300044683 Bacteria 2040
250 Ga0453684_0003303 3300044712 Bacteria 36762
251 Ga0453684_0009424 3300044712 Bacteria 17076
252 Ga0453684_0017821 3300044712 Bacteria 10957
253 Ga0453684_0022294 3300044712 Bacteria 9404
254 Ga0453684_0051216 3300044712 Bacteria 5416
255 Ga0453684_0064185 3300044712 Bacteria 4692
256 Ga0453684_0185159 3300044712 Bacteria 2441
257 Ga0453684_0349961 3300044712 Bacteria 1666
258 Ga0466960_0063023 3300044901 Bacteria 1824
259 Ga0451576_0000006 3300045051 Bacteria 949698
260 Ga0451576_0015432 3300045051 Bacteria 8461
261 Ga0451576_0108737 3300045051 Bacteria 2885
262 Ga0451576_0885280 3300045051 Bacteria 937
263 Ga0466967_0093032 3300045976 Bacteria 2743
264 Ga0495590_0052486 3300046457 Bacteria 1424
265 Ga0495651_0221720 3300046462 Bacteria 1308
266 Ga0495580_0221230 3300046472 Bacteria 1301
267 Ga0495583_0142542 3300046506 Bacteria 997
268 Ga0495632_0001413 3300046519 Bacteria 20041
269 Ga0495621_0017496 3300046539 Bacteria 2318
270 Ga0495597_0010220 3300046542 Bacteria 4597
271 Ga0495597_0081334 3300046542 Bacteria 1385
272 Ga0495656_0000335 3300046615 Bacteria 16138
273 Ga0495611_0039924 3300046648 Bacteria 2091
274 Ga0495625_0006941 3300046660 Bacteria 9989
275 Ga0495625_0025954 3300046660 Bacteria 4434
276 Ga0495659_0127422 3300046664 Bacteria 1008
277 Ga0495647_0024154 3300046681 Bacteria 2211
278 Ga0495658_0156196 3300046683 Bacteria 1404
279 Ga0495613_0316980 3300046689 Bacteria 1077
280 Ga0495670_0023432 3300046691 Bacteria 3047
281 Ga0495649_0008342 3300046694 Bacteria 6236
282 Ga0495660_0136717 3300046810 Bacteria 1224
283 Ga0495680_0132167 3300047322 Bacteria 1833
284 Ga0495687_000723 3300047443 Bacteria 36581
285 Ga0495684_0058859 3300047471 Bacteria 2926
286 Ga0495615_0001144 3300048090 Bacteria 3819
287 Ga0496107_0046628 3300048910 Bacteria 3119
288 Ga0496108_0620222 3300048911 Bacteria 942
289 Ga0496109_0929235 3300048912 Bacteria 808
290 Ga0496112_0019743 3300048915 Bacteria 6370
291 Ga0496113_0563016 3300048916 Bacteria 914
292 Ga0501292_006336 3300049515 Bacteria 1678
293 Ga0501298_027003 3300049521 Bacteria 1108
294 Ga0501033_0042280 3300049570 Bacteria 3398
295 Ga0501036_0221125 3300049572 Bacteria 1590
296 Ga0501036_0428439 3300049572 Bacteria 1103
297 Ga0501037_0101020 3300049573 Bacteria 2082
298 Ga0501043_0000101 3300049579 Bacteria 78983
299 Ga0501046_0000135 3300049580 Bacteria 79084
300 Ga0501047_0000173 3300049581 Bacteria 79071
301 Ga0501048_0000452 3300049582 Bacteria 28741
302 Ga0501075_0183298 3300049591 Bacteria 1597
303 Ga0501076_0027025 3300049592 Bacteria 4450
304 Ga0501077_0087479 3300049593 Bacteria 1975
305 Ga0501222_012858 3300049662 Bacteria 1103
306 Ga0501257_012727 3300049686 Bacteria 1927
307 Ga0501079_0068081 3300049741 Bacteria 2748
308 Ga0501080_0378633 3300049742 Bacteria 1275
309 Ga0501265_035425 3300049762 Bacteria 735
310 Ga0501281_01838 3300049777 Bacteria 1606
311 Ga0501044_0000592 3300049823 Bacteria 44003
312 Ga0501044_0775920 3300049823 Bacteria 839
313 Ga0501045_0002898 3300049824 Bacteria 11719
314 nmdc:mga03683_9955_c1 3300050489 Bacteria 2582
315 nmdc:mga0yw44_157645_c1 3300050492 Bacteria 1484
316 nmdc:mga0k408_165152_c1 3300050493 Bacteria 1319
317 nmdc:mga0k408_210998_c1 3300050493 Bacteria 1159
318 nmdc:mga0k408_25558_c1 3300050493 Bacteria 3345
319 nmdc:mga07m45_121445_c1 3300050496 Bacteria 1509
320 nmdc:mga07m45_1435_c1 3300050496 Bacteria 10928
321 nmdc:mga05p37_249504_c1 3300050507 Archaea 2130
322 nmdc:mga09592_1079_c1 3300050508 Bacteria 21703
323 nmdc:mga0qj67_19249_c2 3300050509 Bacteria 2621
324 nmdc:mga0sz30_894_c1 3300050516 Bacteria 10753
325 Ga0495601_0367205 3300053077 Bacteria 935
326 Ga0500635_0032079 3300053080 Bacteria 1705
327 Ga0500658_0006825 3300053134 Bacteria 4223
328 Ga0500627_0172434 3300053158 Bacteria 974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0042280 Ga0501033_0042280_2004_2489 155
2 3300039447 Ga0436361_0714544 Ga0436361_0714544_1476_2228 187
3 3300049573 Ga0501037_0101020 Ga0501037_0101020_232_900 197
4 3300049823 Ga0501044_0000592 Ga0501044_0000592_15358_16026 197
5 iso_pu_bacteria 2881927736 2881929096 198
6 3300009545 Ga0105237_10058956 Ga0105237_100589562 200
7 3300005445 Ga0070708_100015430 Ga0070708_1000154305 202
8 3300005547 Ga0070693_100139906 Ga0070693_1001399062 202
9 3300005547 Ga0070693_100145358 Ga0070693_1001453582 202
10 3300006844 Ga0075428_101419976 Ga0075428_1014199761 202
11 3300007076 Ga0075435_100586703 Ga0075435_1005867031 202
12 3300025911 Ga0207654_10075080 Ga0207654_100750802 202
13 3300025915 Ga0207693_10470821 Ga0207693_104708211 202
14 3300025917 Ga0207660_10487425 Ga0207660_104874252 202
15 3300025921 Ga0207652_10048221 Ga0207652_100482215 202
16 3300026118 Ga0207675_100931506 Ga0207675_1009315062 202
17 3300049572 Ga0501036_0221125 Ga0501036_0221125_642_1250 202
18 3300049741 Ga0501079_0068081 Ga0501079_0068081_488_1096 202
19 3300005295 Ga0065707_10262232 Ga0065707_102622322 204
20 3300005467 Ga0070706_100325474 Ga0070706_1003254743 204
21 3300005471 Ga0070698_100000754 Ga0070698_10000075412 204
22 3300005471 Ga0070698_100453231 Ga0070698_1004532312 204
23 3300005518 Ga0070699_101167024 Ga0070699_1011670241 204
24 3300005536 Ga0070697_100017852 Ga0070697_1000178525 204
25 3300005617 Ga0068859_100010898 Ga0068859_1000108986 204
26 3300006931 Ga0097620_100010897 Ga0097620_1000108975 204
27 3300009553 Ga0105249_10126411 Ga0105249_101264114 204
28 3300025911 Ga0207654_10154980 Ga0207654_101549802 204
29 3300025936 Ga0207670_10377070 Ga0207670_103770701 204
30 3300035171 Ga0373946_0350659 Ga0373946_0350659_66_680 204
31 3300044673 Ga0453683_0017917 Ga0453683_0017917_2232_2846 204
32 3300005437 Ga0070710_10061584 Ga0070710_100615842 205
33 3300005535 Ga0070684_100141030 Ga0070684_1001410302 205
34 3300025944 Ga0207661_10246862 Ga0207661_102468621 205
35 3300005434 Ga0070709_10187813 Ga0070709_101878132 206
36 3300005471 Ga0070698_100387483 Ga0070698_1003874832 206
37 3300009147 Ga0114129_11577408 Ga0114129_115774081 206
38 3300010375 Ga0105239_10874058 Ga0105239_108740582 206
39 3300014326 Ga0157380_10587087 Ga0157380_105870872 206
40 3300037418 Ga0395900_0883578 Ga0395900_0883578_29_652 206
41 3300037471 Ga0395905_0544793 Ga0395905_0544793_223_846 206
42 3300044673 Ga0453683_0010632 Ga0453683_0010632_23_646 206
43 3300044712 Ga0453684_0349961 Ga0453684_0349961_536_1159 206
44 3300035085 Ga0373929_0000006 Ga0373929_0000006_24443_25072 208
45 iso_pu_bacteria 2884411467 2884415346 208
46 3300005471 Ga0070698_100000606 Ga0070698_10000060642 209
47 3300005347 Ga0070668_100054135 Ga0070668_1000541351 210
48 3300005719 Ga0068861_100997818 Ga0068861_1009978181 210
49 3300025972 Ga0207668_10121080 Ga0207668_101210802 210
50 3300006353 Ga0075370_10004854 Ga0075370_100048541 211
51 3300050493 nmdc:mga0k408_165152_c1 nmdc:mga0k408_165152_c1_324_992 211
52 3300050496 nmdc:mga07m45_1435_c1 nmdc:mga07m45_1435_c1_8107_8775 211
53 3300005459 Ga0068867_100080969 Ga0068867_1000809691 212
54 3300005618 Ga0068864_100803850 Ga0068864_1008038502 212
55 3300006237 Ga0097621_100157541 Ga0097621_1001575413 212
56 3300042000 Ga0439437_018034 Ga0439437_018034_52_720 212
57 3300005328 Ga0070676_10001968 Ga0070676_100019684 213
58 3300005539 Ga0068853_100167059 Ga0068853_1001670593 213
59 3300013297 Ga0157378_11027644 Ga0157378_110276442 213
60 3300026041 Ga0207639_10138450 Ga0207639_101384501 213
61 3300044683 Ga0466965_0051651 Ga0466965_0051651_312_980 213
62 3300044712 Ga0453684_0064185 Ga0453684_0064185_833_1501 213
63 3300045051 Ga0451576_0015432 Ga0451576_0015432_3486_4154 213
64 3300005981 Ga0081538_10000237 Ga0081538_1000023716 216
65 3300046457 Ga0495590_0052486 Ga0495590_0052486_230_880 216
66 3300046506 Ga0495583_0142542 Ga0495583_0142542_220_870 216
67 3300046519 Ga0495632_0001413 Ga0495632_0001413_6973_7623 216
68 3300046542 Ga0495597_0081334 Ga0495597_0081334_42_692 216
69 3300046660 Ga0495625_0025954 Ga0495625_0025954_2428_3078 216
70 3300046694 Ga0495649_0008342 Ga0495649_0008342_3496_4146 216
71 3300053134 Ga0500658_0006825 Ga0500658_0006825_3229_3879 216
72 3300049572 Ga0501036_0428439 Ga0501036_0428439_360_1025 217
73 iso_pu_bacteria 2643221644 2644246286 217
74 iso_pu_bacteria 2791355267 2793368908 217
75 iso_pu_bacteria 2887375801 2887380234 217
76 iso_pu_bacteria 8056375014 8056375896 217
77 3300005468 Ga0070707_100027501 Ga0070707_1000275016 218
78 3300005548 Ga0070665_100559922 Ga0070665_1005599222 218
79 3300006177 Ga0075362_10028888 Ga0075362_100288882 218
80 3300006178 Ga0075367_10066185 Ga0075367_100661853 218
81 3300006186 Ga0075369_10000052 Ga0075369_1000005211 218
82 3300009147 Ga0114129_10944039 Ga0114129_109440392 218
83 3300025910 Ga0207684_10484929 Ga0207684_104849292 218
84 3300050489 nmdc:mga03683_9955_c1 nmdc:mga03683_9955_c1_1059_1718 218
85 3300050507 nmdc:mga05p37_249504_c1 nmdc:mga05p37_249504_c1_375_1037 218
86 3300050516 nmdc:mga0sz30_894_c1 nmdc:mga0sz30_894_c1_6212_6871 218
87 3300053080 Ga0500635_0032079 Ga0500635_0032079_312_968 218
88 3300009147 Ga0114129_10105262 Ga0114129_101052623 219
89 3300005563 Ga0068855_100818818 Ga0068855_1008188182 220
90 3300009174 Ga0105241_10428153 Ga0105241_104281531 220
91 3300025949 Ga0207667_10713045 Ga0207667_107130451 220
92 3300031852 Ga0307410_10172750 Ga0307410_101727502 220
93 3300033180 Ga0307510_10061206 Ga0307510_100612062 220
94 3300037471 Ga0395905_0047280 Ga0395905_0047280_289_963 220
95 3300042876 Ga0451577_0000530 Ga0451577_0000530_60383_61045 220
96 3300044712 Ga0453684_0003303 Ga0453684_0003303_780_1442 220
97 3300053158 Ga0500627_0172434 Ga0500627_0172434_295_957 220
98 3300003322 rootL2_10264288 rootL2_102642883 221
99 3300003790 Ga0055528_1021216 Ga0055528_10212162 221
100 3300003792 Ga0055540_1000235 Ga0055540_100023516 221
101 3300003794 Ga0055531_10000704 Ga0055531_1000070422 221
102 3300005295 Ga0065707_10084718 Ga0065707_100847184 221
103 3300005327 Ga0070658_10051469 Ga0070658_100514693 221
104 3300005328 Ga0070676_10020931 Ga0070676_100209313 221
105 3300005330 Ga0070690_100002088 Ga0070690_10000208812 221
106 3300005331 Ga0070670_100019319 Ga0070670_1000193195 221
107 3300005334 Ga0068869_100080328 Ga0068869_1000803283 221
108 3300005336 Ga0070680_100448531 Ga0070680_1004485312 221
109 3300005338 Ga0068868_100020067 Ga0068868_1000200675 221
110 3300005340 Ga0070689_100017716 Ga0070689_1000177162 221
111 3300005344 Ga0070661_100014346 Ga0070661_1000143465 221
112 3300005345 Ga0070692_10021389 Ga0070692_100213895 221
113 3300005354 Ga0070675_100221824 Ga0070675_1002218241 221
114 3300005355 Ga0070671_100368480 Ga0070671_1003684801 221
115 3300005356 Ga0070674_100160812 Ga0070674_1001608122 221
116 3300005366 Ga0070659_100000877 Ga0070659_10000087710 221
117 3300005438 Ga0070701_10001145 Ga0070701_100011453 221
118 3300005440 Ga0070705_100038382 Ga0070705_1000383822 221
119 3300005440 Ga0070705_100261297 Ga0070705_1002612972 221
120 3300005441 Ga0070700_100060867 Ga0070700_1000608672 221
121 3300005444 Ga0070694_100173500 Ga0070694_1001735001 221
122 3300005445 Ga0070708_100022812 Ga0070708_10002281211 221
123 3300005445 Ga0070708_100083961 Ga0070708_1000839612 221
124 3300005456 Ga0070678_100007754 Ga0070678_1000077541 221
125 3300005457 Ga0070662_100342222 Ga0070662_1003422221 221
126 3300005459 Ga0068867_100048997 Ga0068867_1000489975 221
127 3300005459 Ga0068867_100065017 Ga0068867_1000650173 221
128 3300005467 Ga0070706_100072817 Ga0070706_1000728173 221
129 3300005468 Ga0070707_100111894 Ga0070707_1001118942 221
130 3300005468 Ga0070707_100306055 Ga0070707_1003060552 221
131 3300005471 Ga0070698_100237291 Ga0070698_1002372912 221
132 3300005518 Ga0070699_100223480 Ga0070699_1002234802 221
133 3300005536 Ga0070697_100062602 Ga0070697_1000626023 221
134 3300005536 Ga0070697_100136059 Ga0070697_1001360592 221
135 3300005544 Ga0070686_100070395 Ga0070686_1000703951 221
136 3300005545 Ga0070695_100251443 Ga0070695_1002514431 221
137 3300005546 Ga0070696_100064277 Ga0070696_1000642772 221
138 3300005549 Ga0070704_100082838 Ga0070704_1000828382 221
139 3300005564 Ga0070664_100009920 Ga0070664_1000099203 221
140 3300005564 Ga0070664_100217063 Ga0070664_1002170632 221
141 3300005615 Ga0070702_100007221 Ga0070702_1000072217 221
142 3300005616 Ga0068852_100702827 Ga0068852_1007028271 221
143 3300005617 Ga0068859_100138502 Ga0068859_1001385022 221
144 3300005718 Ga0068866_10002842 Ga0068866_100028422 221
145 3300005719 Ga0068861_100333669 Ga0068861_1003336692 221
146 3300005840 Ga0068870_10023154 Ga0068870_100231544 221
147 3300005840 Ga0068870_10411149 Ga0068870_104111491 221
148 3300005841 Ga0068863_100047720 Ga0068863_1000477204 221
149 3300005842 Ga0068858_100208893 Ga0068858_1002088933 221
150 3300005843 Ga0068860_100268128 Ga0068860_1002681282 221
151 3300005844 Ga0068862_100445410 Ga0068862_1004454102 221
152 3300005844 Ga0068862_100653632 Ga0068862_1006536322 221
153 3300005844 Ga0068862_100831332 Ga0068862_1008313321 221
154 3300006028 Ga0070717_10137829 Ga0070717_101378293 221
155 3300006038 Ga0075365_10120854 Ga0075365_101208543 221
156 3300006048 Ga0075363_100041626 Ga0075363_1000416263 221
157 3300006048 Ga0075363_100482152 Ga0075363_1004821521 221
158 3300006173 Ga0070716_100565837 Ga0070716_1005658371 221
159 3300006195 Ga0075366_10003055 Ga0075366_100030555 221
160 3300006237 Ga0097621_100006574 Ga0097621_1000065749 221
161 3300006353 Ga0075370_10005949 Ga0075370_100059494 221
162 3300006358 Ga0068871_100756849 Ga0068871_1007568491 221
163 3300006846 Ga0075430_100087591 Ga0075430_1000875912 221
164 3300006880 Ga0075429_100000795 Ga0075429_10000079517 221
165 3300006880 Ga0075429_100199997 Ga0075429_1001999972 221
166 3300006881 Ga0068865_100100828 Ga0068865_1001008284 221
167 3300006914 Ga0075436_100576514 Ga0075436_1005765141 221
168 3300006931 Ga0097620_100138489 Ga0097620_1001384892 221
169 3300009093 Ga0105240_10001378 Ga0105240_1000137820 221
170 3300009093 Ga0105240_10008467 Ga0105240_100084675 221
171 3300009147 Ga0114129_11522947 Ga0114129_115229471 221
172 3300009174 Ga0105241_10195288 Ga0105241_101952882 221
173 3300009177 Ga0105248_10046330 Ga0105248_100463302 221
174 3300009545 Ga0105237_10003089 Ga0105237_100030899 221
175 3300009545 Ga0105237_10154318 Ga0105237_101543183 221
176 3300009551 Ga0105238_10002997 Ga0105238_100029979 221
177 3300009551 Ga0105238_10164511 Ga0105238_101645113 221
178 3300009551 Ga0105238_10442460 Ga0105238_104424602 221
179 3300009553 Ga0105249_10019013 Ga0105249_100190132 221
180 3300010375 Ga0105239_10001251 Ga0105239_1000125120 221
181 3300013306 Ga0163162_10378150 Ga0163162_103781502 221
182 3300013306 Ga0163162_10480605 Ga0163162_104806051 221
183 3300014326 Ga0157380_10003515 Ga0157380_100035151 221
184 3300014968 Ga0157379_10396441 Ga0157379_103964411 221
185 3300014969 Ga0157376_10000316 Ga0157376_1000031642 221
186 3300015683 Ga0183362_10015 Ga0183362_1001527 221
187 3300017792 Ga0163161_10069203 Ga0163161_100692032 221
188 3300025263 Ga0209565_1010153 Ga0209565_10101533 221
189 3300025273 Ga0209673_1001457 Ga0209673_100145719 221
190 3300025291 Ga0209675_1000535 Ga0209675_100053516 221
191 3300025292 Ga0209676_1020648 Ga0209676_10206482 221
192 3300025294 Ga0209025_1000764 Ga0209025_100076439 221
193 3300025298 Ga0209050_1003703 Ga0209050_10037038 221
194 3300025299 Ga0209256_1000432 Ga0209256_100043255 221
195 3300025303 Ga0209051_1000097 Ga0209051_100009729 221
196 3300025303 Ga0209051_1000353 Ga0209051_100035335 221
197 3300025303 Ga0209051_1002689 Ga0209051_10026892 221
198 3300025304 Ga0209257_1000022 Ga0209257_1000022470 221
199 3300025898 Ga0207692_10387185 Ga0207692_103871851 221
200 3300025908 Ga0207643_10047168 Ga0207643_100471684 221
201 3300025908 Ga0207643_10161081 Ga0207643_101610812 221
202 3300025913 Ga0207695_10010279 Ga0207695_100102791 221
203 3300025913 Ga0207695_10111976 Ga0207695_101119762 221
204 3300025920 Ga0207649_10003248 Ga0207649_100032486 221
205 3300025923 Ga0207681_10458283 Ga0207681_104582831 221
206 3300025925 Ga0207650_10014324 Ga0207650_100143244 221
207 3300025927 Ga0207687_10002826 Ga0207687_1000282613 221
208 3300025931 Ga0207644_10012409 Ga0207644_100124093 221
209 3300025932 Ga0207690_10151261 Ga0207690_101512612 221
210 3300025933 Ga0207706_10361432 Ga0207706_103614321 221
211 3300025934 Ga0207686_10038826 Ga0207686_100388262 221
212 3300025935 Ga0207709_10121114 Ga0207709_101211142 221
213 3300025935 Ga0207709_10129761 Ga0207709_101297613 221
214 3300025937 Ga0207669_10459215 Ga0207669_104592152 221
215 3300025938 Ga0207704_10115384 Ga0207704_101153843 221
216 3300025940 Ga0207691_10048785 Ga0207691_100487853 221
217 3300025940 Ga0207691_10135870 Ga0207691_101358704 221
218 3300025941 Ga0207711_10141032 Ga0207711_101410322 221
219 3300025942 Ga0207689_10000326 Ga0207689_1000032616 221
220 3300025945 Ga0207679_10004446 Ga0207679_100044463 221
221 3300025945 Ga0207679_10067152 Ga0207679_100671521 221
222 3300025960 Ga0207651_10232800 Ga0207651_102328002 221
223 3300025972 Ga0207668_10224698 Ga0207668_102246981 221
224 3300025986 Ga0207658_10929016 Ga0207658_109290161 221
225 3300026035 Ga0207703_10057348 Ga0207703_100573482 221
226 3300026041 Ga0207639_10024732 Ga0207639_100247324 221
227 3300026075 Ga0207708_10000871 Ga0207708_1000087116 221
228 3300026088 Ga0207641_10062479 Ga0207641_100624796 221
229 3300026088 Ga0207641_10124578 Ga0207641_101245782 221
230 3300026089 Ga0207648_10000213 Ga0207648_1000021316 221
231 3300026118 Ga0207675_100000472 Ga0207675_1000004722 221
232 3300026121 Ga0207683_10004691 Ga0207683_100046918 221
233 3300026121 Ga0207683_10046509 Ga0207683_100465092 221
234 3300028380 Ga0268265_10445112 Ga0268265_104451121 221
235 3300028380 Ga0268265_10630396 Ga0268265_106303961 221
236 3300028381 Ga0268264_10433410 Ga0268264_104334101 221
237 3300028381 Ga0268264_10581985 Ga0268264_105819852 221
238 3300028381 Ga0268264_10674973 Ga0268264_106749731 221
239 3300028563 Ga0265319_1006020 Ga0265319_10060204 221
240 3300028577 Ga0265318_10009406 Ga0265318_100094066 221
241 3300031240 Ga0265320_10004014 Ga0265320_1000401413 221
242 3300031251 Ga0265327_10001211 Ga0265327_1000121122 221
243 3300031456 Ga0307513_10000895 Ga0307513_1000089521 221
244 3300031548 Ga0307408_100558139 Ga0307408_1005581392 221
245 3300031730 Ga0307516_10061104 Ga0307516_100611044 221
246 3300031731 Ga0307405_10326925 Ga0307405_103269252 221
247 3300031852 Ga0307410_10158361 Ga0307410_101583613 221
248 3300031901 Ga0307406_10743796 Ga0307406_107437962 221
249 3300033529 Ga0316587_1011305 Ga0316587_10113051 221
250 3300035724 Ga0373933_0318722 Ga0373933_0318722_284_952 221
251 3300036712 Ga0316584_0172247 Ga0316584_0172247_532_1200 221
252 3300037418 Ga0395900_0051584 Ga0395900_0051584_1251_1925 221
253 3300037418 Ga0395900_0458388 Ga0395900_0458388_154_822 221
254 3300037466 Ga0395898_0106149 Ga0395898_0106149_146_814 221
255 3300037471 Ga0395905_0076213 Ga0395905_0076213_1866_2534 221
256 3300038443 Ga0395901_0672607 Ga0395901_0672607_73_741 221
257 3300041413 Ga0439465_0173590 Ga0439465_0173590_62_730 221
258 3300041463 Ga0451804_0597544 Ga0451804_0597544_55_789 221
259 3300041512 Ga0451853_0704546 Ga0451853_0704546_28_693 221
260 3300042121 Ga0450919_001671 Ga0450919_001671_1310_1978 221
261 3300042531 Ga0450918_000277 Ga0450918_000277_4328_4996 221
262 3300042876 Ga0451577_0000192 Ga0451577_0000192_99243_99911 221
263 3300042876 Ga0451577_0003120 Ga0451577_0003120_585_1253 221
264 3300042876 Ga0451577_0037057 Ga0451577_0037057_1815_2483 221
265 3300042876 Ga0451577_0054331 Ga0451577_0054331_1342_2016 221
266 3300044673 Ga0453683_0002376 Ga0453683_0002376_11521_12189 221
267 3300044673 Ga0453683_0131112 Ga0453683_0131112_486_1154 221
268 3300044673 Ga0453683_0190036 Ga0453683_0190036_68_736 221
269 3300044712 Ga0453684_0009424 Ga0453684_0009424_14167_14835 221
270 3300044712 Ga0453684_0017821 Ga0453684_0017821_9704_10372 221
271 3300044712 Ga0453684_0022294 Ga0453684_0022294_630_1298 221
272 3300044712 Ga0453684_0051216 Ga0453684_0051216_2241_2909 221
273 3300044712 Ga0453684_0185159 Ga0453684_0185159_1656_2324 221
274 3300045051 Ga0451576_0000006 Ga0451576_0000006_401301_401987 221
275 3300045051 Ga0451576_0108737 Ga0451576_0108737_1647_2315 221
276 3300045051 Ga0451576_0885280 Ga0451576_0885280_73_741 221
277 3300045976 Ga0466967_0093032 Ga0466967_0093032_1682_2350 221
278 3300046462 Ga0495651_0221720 Ga0495651_0221720_373_1041 221
279 3300046472 Ga0495580_0221230 Ga0495580_0221230_536_1204 221
280 3300046539 Ga0495621_0017496 Ga0495621_0017496_724_1392 221
281 3300046542 Ga0495597_0010220 Ga0495597_0010220_3381_4049 221
282 3300046615 Ga0495656_0000335 Ga0495656_0000335_1966_2634 221
283 3300046648 Ga0495611_0039924 Ga0495611_0039924_1222_1890 221
284 3300046660 Ga0495625_0006941 Ga0495625_0006941_2222_2890 221
285 3300046664 Ga0495659_0127422 Ga0495659_0127422_128_799 221
286 3300046681 Ga0495647_0024154 Ga0495647_0024154_1218_1886 221
287 3300046683 Ga0495658_0156196 Ga0495658_0156196_317_985 221
288 3300046689 Ga0495613_0316980 Ga0495613_0316980_116_784 221
289 3300046691 Ga0495670_0023432 Ga0495670_0023432_1654_2322 221
290 3300046810 Ga0495660_0136717 Ga0495660_0136717_476_1147 221
291 3300047322 Ga0495680_0132167 Ga0495680_0132167_466_1134 221
292 3300047443 Ga0495687_000723 Ga0495687_000723_8596_9264 221
293 3300047471 Ga0495684_0058859 Ga0495684_0058859_808_1476 221
294 3300048090 Ga0495615_0001144 Ga0495615_0001144_3012_3680 221
295 3300048910 Ga0496107_0046628 Ga0496107_0046628_1043_1708 221
296 3300048911 Ga0496108_0620222 Ga0496108_0620222_39_707 221
297 3300048912 Ga0496109_0929235 Ga0496109_0929235_30_740 221
298 3300048915 Ga0496112_0019743 Ga0496112_0019743_2284_2952 221
299 3300048916 Ga0496113_0563016 Ga0496113_0563016_150_818 221
300 3300049515 Ga0501292_006336 Ga0501292_006336_701_1366 221
301 3300049521 Ga0501298_027003 Ga0501298_027003_270_935 221
302 3300049579 Ga0501043_0000101 Ga0501043_0000101_30880_31551 221
303 3300049580 Ga0501046_0000135 Ga0501046_0000135_47413_48084 221
304 3300049581 Ga0501047_0000173 Ga0501047_0000173_30987_31658 221
305 3300049582 Ga0501048_0000452 Ga0501048_0000452_13842_14513 221
306 3300049591 Ga0501075_0183298 Ga0501075_0183298_184_852 221
307 3300049592 Ga0501076_0027025 Ga0501076_0027025_3335_4003 221
308 3300049593 Ga0501077_0087479 Ga0501077_0087479_617_1285 221
309 3300049662 Ga0501222_012858 Ga0501222_012858_185_850 221
310 3300049686 Ga0501257_012727 Ga0501257_012727_785_1450 221
311 3300049742 Ga0501080_0378633 Ga0501080_0378633_505_1173 221
312 3300049762 Ga0501265_035425 Ga0501265_035425_33_698 221
313 3300049777 Ga0501281_01838 Ga0501281_01838_416_1081 221
314 3300049823 Ga0501044_0775920 Ga0501044_0775920_116_787 221
315 3300049824 Ga0501045_0002898 Ga0501045_0002898_7053_7724 221
316 3300050492 nmdc:mga0yw44_157645_c1 nmdc:mga0yw44_157645_c1_85_753 221
317 3300050493 nmdc:mga0k408_210998_c1 nmdc:mga0k408_210998_c1_169_837 221
318 3300050493 nmdc:mga0k408_25558_c1 nmdc:mga0k408_25558_c1_123_791 221
319 3300050496 nmdc:mga07m45_121445_c1 nmdc:mga07m45_121445_c1_292_960 221
320 3300050508 nmdc:mga09592_1079_c1 nmdc:mga09592_1079_c1_19000_19668 221
321 3300050509 nmdc:mga0qj67_19249_c2 nmdc:mga0qj67_19249_c2_1087_1755 221
322 3300053077 Ga0495601_0367205 Ga0495601_0367205_168_836 221
323 3300002773 JGI25152J39213_1000905 JGI25152J39213_100090515 222
324 3300002774 JGI25150J39212_1023310 JGI25150J39212_10233102 222
325 3300003215 JGI25153J46596_10000393 JGI25153J46596_100003935 222
326 3300003771 Ga0055526_1002422 Ga0055526_10024222 222
327 3300014326 Ga0157380_10028006 Ga0157380_100280064 222
328 3300025245 Ga0207425_1000203 Ga0207425_100020333 222
329 3300025258 Ga0209129_1000012 Ga0209129_1000012420 222
330 3300025273 Ga0209673_1006934 Ga0209673_10069347 222
331 3300025295 Ga0209564_1000022 Ga0209564_100002294 222
332 3300025297 Ga0209758_1000233 Ga0209758_100023393 222
333 3300025299 Ga0209256_1015693 Ga0209256_10156933 222
334 3300044901 Ga0466960_0063023 Ga0466960_0063023_632_1306 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

27

212

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8337 1 192
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8325 1 194
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8281 1 194
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8251 1 192
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8169 2 192
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8323 1 194 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8278 1 194 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8236 2 191 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8188 2 191 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8033 1 193 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.9742 57 191 GO:0008703
GO:0009231
AF-A0A1G2VXK8-F1-model_v4 Riboflavin biosynthesis protein RibD 0.9575 71 193 GO:0008703
GO:0009231
AF-A0A535L0T2-F1-model_v4 Dihydrofolate reductase 0.9553 96 194 GO:0008703
GO:0009231
AF-A0A1S6RUW9-F1-model_v4 deleted 0.947 54 193
AF-A0A537J602-F1-model_v4 Deaminase 0.9414 97 194 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
88.13 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map