F411708

General Info

Members Datasets Scaffolds Average Seq Length
334 217 668 90

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100948611|Ga0068861_1009486112
Length 89
Sequence VPHIRPLHNFEPPAPSEVAAAALQYVRKISGYTKPSQANQEAFDRAVEEVAAASARLLDALETNAPPKNRETEAEKRRARSADRYARAS

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
187 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
188 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
189 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
190 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
195 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
211 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0
Rhizoplane 4.49
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 5.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100948611 3300005719 Bacteria 818
2 JGI24737J22298_10060280 3300001990 Bacteria 1143
3 Ga0065707_10250848 3300005295 Unclassified 1126
4 Ga0070658_10021333 3300005327 Bacteria 5191
5 Ga0070670_100166285 3300005331 Bacteria 1912
6 Ga0070677_10005447 3300005333 Bacteria 4195
7 Ga0070666_10119988 3300005335 Bacteria 1823
8 Ga0070666_10181166 3300005335 Bacteria 1478
9 Ga0070666_11142416 3300005335 Bacteria 579
10 Ga0070661_100017063 3300005344 Bacteria 5145
11 Ga0070661_100084738 3300005344 Bacteria 2341
12 Ga0070692_10784135 3300005345 Bacteria 649
13 Ga0070692_10895120 3300005345 Bacteria 613
14 Ga0070692_11158058 3300005345 Bacteria 549
15 Ga0070675_100327634 3300005354 Bacteria 1354
16 Ga0070675_100359690 3300005354 Bacteria 1292
17 Ga0070675_100961275 3300005354 Unclassified 784
18 Ga0070671_100327825 3300005355 Bacteria 1305
19 Ga0070671_100692697 3300005355 Bacteria 884
20 Ga0070674_100222397 3300005356 Bacteria 1469
21 Ga0070674_100403825 3300005356 Unclassified 1117
22 Ga0070674_101095801 3300005356 Bacteria 703
23 Ga0070674_101140762 3300005356 Bacteria 690
24 Ga0070673_100374792 3300005364 Bacteria 1268
25 Ga0070673_100951321 3300005364 Bacteria 798
26 Ga0070667_100711461 3300005367 Bacteria 930
27 Ga0070703_10484732 3300005406 Bacteria 554
28 Ga0070713_102079336 3300005436 Bacteria 551
29 Ga0070711_101392575 3300005439 Bacteria 610
30 Ga0070700_100066701 3300005441 Bacteria 2285
31 Ga0070663_100796956 3300005455 Unclassified 810
32 Ga0070678_100168727 3300005456 Bacteria 1780
33 Ga0070678_100287978 3300005456 Bacteria 1391
34 Ga0070678_100301257 3300005456 Bacteria 1362
35 Ga0070678_100447554 3300005456 Bacteria 1131
36 Ga0070662_100047955 3300005457 Bacteria 3076
37 Ga0070662_100914636 3300005457 Bacteria 749
38 Ga0068867_100506935 3300005459 Bacteria 1038
39 Ga0070685_10805556 3300005466 Bacteria 693
40 Ga0070707_101899276 3300005468 Bacteria 563
41 Ga0070679_100351373 3300005530 Bacteria 1422
42 Ga0070684_100003382 3300005535 Bacteria 11958
43 Ga0068853_100020896 3300005539 Bacteria 5446
44 Ga0068853_100102265 3300005539 Bacteria 2535
45 Ga0068853_100144263 3300005539 Bacteria 2139
46 Ga0070672_100180285 3300005543 Bacteria 1760
47 Ga0070672_101950276 3300005543 Bacteria 529
48 Ga0070693_100973950 3300005547 Bacteria 640
49 Ga0070665_100033178 3300005548 Bacteria 5194
50 Ga0068855_100385411 3300005563 Bacteria 1538
51 Ga0068855_101110830 3300005563 Bacteria 826
52 Ga0070664_100014280 3300005564 Bacteria 6477
53 Ga0070664_100135220 3300005564 Bacteria 2167
54 Ga0070664_100442223 3300005564 Bacteria 1193
55 Ga0068857_100005028 3300005577 Bacteria 11240
56 Ga0068857_100133985 3300005577 Bacteria 2237
57 Ga0068852_100012089 3300005616 Bacteria 6536
58 Ga0068852_101061333 3300005616 Bacteria 830
59 Ga0068864_100030031 3300005618 Bacteria 4606
60 Ga0068864_100913828 3300005618 Unclassified 867
61 Ga0068866_10545223 3300005718 Bacteria 775
62 Ga0068866_10604137 3300005718 Bacteria 741
63 Ga0068861_100458405 3300005719 Bacteria 1144
64 Ga0068851_10042008 3300005834 Bacteria 2301
65 Ga0068851_10445032 3300005834 Bacteria 769
66 Ga0068851_10663841 3300005834 Bacteria 639
67 Ga0068870_10352213 3300005840 Bacteria 945
68 Ga0068863_100252216 3300005841 Bacteria 1705
69 Ga0068863_100367754 3300005841 Bacteria 1403
70 Ga0070715_10162470 3300006163 Bacteria 1105
71 Ga0070716_100045434 3300006173 Bacteria 2466
72 Ga0070716_101621247 3300006173 Bacteria 532
73 Ga0097621_100003730 3300006237 Bacteria 10551
74 Ga0097621_100816367 3300006237 Bacteria 865
75 Ga0097621_100855644 3300006237 Bacteria 845
76 Ga0075370_10165166 3300006353 Bacteria 1300
77 Ga0068871_100008309 3300006358 Bacteria 7459
78 Ga0068871_100031260 3300006358 Bacteria 4197
79 Ga0068871_102255260 3300006358 Bacteria 519
80 Ga0075428_101016702 3300006844 Bacteria 877
81 Ga0075430_100081421 3300006846 Bacteria 2712
82 Ga0075431_100011674 3300006847 Bacteria 8863
83 Ga0075431_100345126 3300006847 Bacteria 1498
84 Ga0075433_10124437 3300006852 Bacteria 2290
85 Ga0068865_100007733 3300006881 Bacteria 6625
86 Ga0068865_100426899 3300006881 Bacteria 1091
87 Ga0097620_100815461 3300006931 Bacteria 1020
88 Ga0099794_10006295 3300007265 Bacteria 4796
89 Ga0099795_10080697 3300007788 Unclassified 1244
90 Ga0099795_10296810 3300007788 Bacteria 709
91 Ga0105240_10034070 3300009093 Bacteria 6573
92 Ga0105240_10423159 3300009093 Bacteria 1496
93 Ga0105245_10629349 3300009098 Bacteria 1102
94 Ga0105245_11310995 3300009098 Bacteria 773
95 Ga0114129_10001432 3300009147 Bacteria 32213
96 Ga0114129_12126748 3300009147 Unclassified 677
97 Ga0105243_10651147 3300009148 Bacteria 1021
98 Ga0105243_12429223 3300009148 Bacteria 563
99 Ga0105242_10033362 3300009176 Bacteria 4121
100 Ga0105248_10266964 3300009177 Bacteria 1927
101 Ga0105237_10393598 3300009545 Bacteria 1390
102 Ga0105237_11058757 3300009545 Unclassified 818
103 Ga0105237_12340452 3300009545 Bacteria 544
104 Ga0105030_104792 3300009987 Bacteria 1145
105 Ga0105239_10110270 3300010375 Bacteria 3050
106 Ga0105239_10744703 3300010375 Bacteria 1121
107 Ga0157373_10338786 3300013100 Bacteria 1072
108 Ga0157370_10634689 3300013104 Bacteria 977
109 Ga0157369_10103672 3300013105 Bacteria 3030
110 Ga0157374_10404646 3300013296 Bacteria 1362
111 Ga0157374_11945392 3300013296 Bacteria 614
112 Ga0157378_10000006 3300013297 Bacteria 192683
113 Ga0157378_10067973 3300013297 Bacteria 3194
114 Ga0163162_10496816 3300013306 Bacteria 1351
115 Ga0163162_10719885 3300013306 Bacteria 1119
116 Ga0157372_10139800 3300013307 Bacteria 2789
117 Ga0157372_10255405 3300013307 Bacteria 2035
118 Ga0157372_10544608 3300013307 Bacteria 1353
119 Ga0157372_12562958 3300013307 Bacteria 585
120 Ga0163163_10224939 3300014325 Bacteria 1925
121 Ga0157380_10255045 3300014326 Bacteria 1590
122 Ga0157380_11263797 3300014326 Bacteria 784
123 Ga0157380_13207981 3300014326 Bacteria 522
124 Ga0157380_13524739 3300014326 Bacteria 501
125 Ga0157379_10794375 3300014968 Bacteria 893
126 Ga0157379_11448710 3300014968 Bacteria 667
127 Ga0157376_10303402 3300014969 Bacteria 1512
128 Ga0157376_11443105 3300014969 Unclassified 720
129 Ga0209675_1002402 3300025291 Bacteria 9667
130 Ga0207697_10295348 3300025315 Bacteria 719
131 Ga0207656_10725139 3300025321 Bacteria 509
132 Ga0207682_10015231 3300025893 Bacteria 2993
133 Ga0207642_10687605 3300025899 Bacteria 644
134 Ga0207647_10560381 3300025904 Bacteria 633
135 Ga0207705_10260452 3300025909 Bacteria 1324
136 Ga0207671_10302807 3300025914 Bacteria 1263
137 Ga0207693_10531925 3300025915 Bacteria 917
138 Ga0207662_10614808 3300025918 Bacteria 757
139 Ga0207662_10732520 3300025918 Unclassified 694
140 Ga0207657_10049299 3300025919 Bacteria 3670
141 Ga0207649_10113733 3300025920 Bacteria 1813
142 Ga0207649_10308475 3300025920 Bacteria 1159
143 Ga0207694_10002776 3300025924 Bacteria 14137
144 Ga0207650_10264700 3300025925 Bacteria 1396
145 Ga0207650_10265572 3300025925 Bacteria 1393
146 Ga0207650_11480314 3300025925 Bacteria 577
147 Ga0207659_10221461 3300025926 Bacteria 1522
148 Ga0207659_10282745 3300025926 Bacteria 1357
149 Ga0207659_10364584 3300025926 Bacteria 1202
150 Ga0207664_11433041 3300025929 Unclassified 612
151 Ga0207644_10707292 3300025931 Bacteria 840
152 Ga0207644_11174734 3300025931 Bacteria 645
153 Ga0207690_10253949 3300025932 Bacteria 1359
154 Ga0207706_10279124 3300025933 Bacteria 1457
155 Ga0207706_10319900 3300025933 Bacteria 1350
156 Ga0207686_10013294 3300025934 Bacteria 4552
157 Ga0207670_10388918 3300025936 Bacteria 1113
158 Ga0207670_10647678 3300025936 Bacteria 871
159 Ga0207669_10239098 3300025937 Bacteria 1345
160 Ga0207669_11944917 3300025937 Bacteria 503
161 Ga0207704_10010360 3300025938 Bacteria 4545
162 Ga0207704_10365635 3300025938 Bacteria 1128
163 Ga0207704_10588070 3300025938 Bacteria 910
164 Ga0207665_10182941 3300025939 Bacteria 1519
165 Ga0207665_10622251 3300025939 Bacteria 844
166 Ga0207691_10132530 3300025940 Bacteria 2200
167 Ga0207691_10218460 3300025940 Bacteria 1653
168 Ga0207691_10612201 3300025940 Bacteria 922
169 Ga0207711_12145708 3300025941 Bacteria 501
170 Ga0207661_10260173 3300025944 Bacteria 1545
171 Ga0207661_11083990 3300025944 Bacteria 738
172 Ga0207679_10080099 3300025945 Bacteria 2493
173 Ga0207679_10232257 3300025945 Bacteria 1558
174 Ga0207667_10847549 3300025949 Bacteria 908
175 Ga0207667_12015462 3300025949 Bacteria 537
176 Ga0207651_10160118 3300025960 Bacteria 1764
177 Ga0207651_10780398 3300025960 Bacteria 846
178 Ga0207651_10874861 3300025960 Bacteria 799
179 Ga0207651_11028885 3300025960 Bacteria 737
180 Ga0207640_10382336 3300025981 Bacteria 1141
181 Ga0207640_11773695 3300025981 Bacteria 558
182 Ga0207703_11211520 3300026035 Bacteria 726
183 Ga0207639_10242860 3300026041 Bacteria 1567
184 Ga0207639_10429841 3300026041 Bacteria 1195
185 Ga0207639_10881499 3300026041 Bacteria 836
186 Ga0207639_10883336 3300026041 Bacteria 835
187 Ga0207678_10997134 3300026067 Unclassified 741
188 Ga0207702_11882079 3300026078 Bacteria 590
189 Ga0207641_10235888 3300026088 Bacteria 1702
190 Ga0207648_10118458 3300026089 Bacteria 2327
191 Ga0207648_10978821 3300026089 Bacteria 792
192 Ga0207676_10044762 3300026095 Bacteria 3416
193 Ga0207676_11152518 3300026095 Bacteria 767
194 Ga0207674_10008765 3300026116 Bacteria 11646
195 Ga0207674_10099346 3300026116 Bacteria 2893
196 Ga0207675_100306239 3300026118 Bacteria 1548
197 Ga0207675_102065681 3300026118 Bacteria 587
198 Ga0207683_10154046 3300026121 Bacteria 2075
199 Ga0207683_10185354 3300026121 Bacteria 1888
200 Ga0207683_10209936 3300026121 Bacteria 1772
201 Ga0207683_10670744 3300026121 Bacteria 961
202 Ga0207683_11907307 3300026121 Bacteria 543
203 Ga0207698_10139722 3300026142 Bacteria 2084
204 Ga0207698_10417370 3300026142 Bacteria 1287
205 Ga0207698_11124513 3300026142 Bacteria 798
206 Ga0209588_1026773 3300027671 Bacteria 1832
207 Ga0209971_1060050 3300027682 Bacteria 920
208 Ga0209966_1064070 3300027695 Viruses 798
209 Ga0268266_10009083 3300028379 Bacteria 8777
210 Ga0307517_10001511 3300028786 Bacteria 38826
211 Ga0265338_10790824 3300028800 Bacteria 650
212 Ga0316180_1140089 3300030736 Unclassified 884
213 Ga0265327_10143344 3300031251 Bacteria 1115
214 Ga0307513_10057757 3300031456 Bacteria 4130
215 Ga0307408_100320564 3300031548 Bacteria 1305
216 Ga0307408_101079402 3300031548 Bacteria 744
217 Ga0307508_10002731 3300031616 Bacteria 18438
218 Ga0307508_10135395 3300031616 Bacteria 2067
219 Ga0307405_10982555 3300031731 Bacteria 719
220 Ga0307410_10502443 3300031852 Bacteria 998
221 Ga0307406_10281421 3300031901 Bacteria 1269
222 Ga0307412_10307895 3300031911 Bacteria 1255
223 Ga0307409_100063931 3300031995 Bacteria 2888
224 Ga0307416_101243307 3300032002 Unclassified 850
225 Ga0307411_10601268 3300032005 Bacteria 946
226 Ga0307411_11096608 3300032005 Bacteria 717
227 Ga0307415_101235945 3300032126 Bacteria 705
228 Ga0307507_10356325 3300033179 Bacteria 857
229 Ga0373944_0088396 3300035089 Bacteria 1033
230 Ga0373936_0038598 3300035113 Bacteria 1910
231 Ga0373945_0030658 3300035116 Bacteria 1896
232 Ga0373946_0250116 3300035171 Bacteria 864
233 Ga0373946_0353548 3300035171 Bacteria 735
234 Ga0373955_0154825 3300035172 Bacteria 1350
235 Ga0373947_0464121 3300035725 Bacteria 858
236 Ga0373947_1219415 3300035725 Bacteria 512
237 Ga0373937_0001204 3300036401 Bacteria 21755
238 Ga0373937_0684570 3300036401 Bacteria 972
239 Ga0373925_0019043 3300037068 Bacteria 4991
240 Ga0373925_0287453 3300037068 Bacteria 1325
241 Ga0373925_1176361 3300037068 Unclassified 630
242 Ga0436365_0367130 3300039437 Bacteria 2086
243 Ga0451851_0051979 3300041507 Bacteria 1738
244 Ga0451853_0859566 3300041512 Bacteria 609
245 Ga0451853_1677925 3300041512 Bacteria 3151
246 Ga0466972_0419149 3300044658 Bacteria 628
247 Ga0466965_0555371 3300044683 Bacteria 649
248 Ga0466967_0025467 3300045976 Bacteria 4880
249 Ga0495592_0182938 3300046454 Bacteria 1426
250 Ga0495592_0643562 3300046454 Bacteria 643
251 Ga0495603_0262109 3300046455 Bacteria 995
252 Ga0495638_0032495 3300046460 Bacteria 3345
253 Ga0495594_0203923 3300046499 Unclassified 1127
254 Ga0495618_0308608 3300046514 Bacteria 982
255 Ga0495632_0057569 3300046519 Bacteria 1897
256 Ga0495648_0143459 3300046524 Unclassified 1254
257 Ga0495642_0401939 3300046528 Bacteria 604
258 Ga0495647_0187129 3300046681 Bacteria 903
259 Ga0495658_0128583 3300046683 Bacteria 1540
260 Ga0495658_0429628 3300046683 Bacteria 843
261 Ga0495613_0818087 3300046689 Bacteria 607
262 Ga0495613_0861536 3300046689 Bacteria 588
263 Ga0495674_1355038 3300047319 Bacteria 532
264 Ga0495672_0037575 3300047320 Bacteria 2961
265 Ga0495672_0047696 3300047320 Bacteria 2546
266 Ga0496101_0632586 3300048904 Bacteria 846
267 Ga0496104_0328257 3300048907 Bacteria 1443
268 Ga0496104_1043960 3300048907 Bacteria 721
269 Ga0496105_0027666 3300048908 Bacteria 4635
270 Ga0496105_0050593 3300048908 Bacteria 3432
271 Ga0496105_0105564 3300048908 Bacteria 2326
272 Ga0496106_0640469 3300048909 Bacteria 850
273 Ga0496108_0154705 3300048911 Bacteria 1980
274 Ga0496109_1708925 3300048912 Bacteria 563
275 Ga0496110_0353846 3300048913 Bacteria 1338
276 Ga0496110_0503387 3300048913 Bacteria 1103
277 Ga0496111_0345199 3300048914 Bacteria 1102
278 Ga0496112_0394947 3300048915 Bacteria 1323
279 Ga0496114_0448515 3300048917 Bacteria 1143
280 Ga0496115_0262805 3300048918 Bacteria 1419
281 Ga0496124_0420763 3300048927 Bacteria 921
282 Ga0501031_0301060 3300049568 Bacteria 1039
283 Ga0501033_0231254 3300049570 Bacteria 1313
284 Ga0501034_0006202 3300049571 Bacteria 12874
285 Ga0501037_0636849 3300049573 Bacteria 713
286 Ga0501038_0018377 3300049574 Bacteria 6311
287 Ga0501041_0812148 3300049577 Unclassified 600
288 Ga0501042_0593690 3300049578 Bacteria 805
289 Ga0501046_0001887 3300049580 Bacteria 19928
290 Ga0501047_0181399 3300049581 Bacteria 1972
291 Ga0501047_0300577 3300049581 Bacteria 1447
292 Ga0501047_1367734 3300049581 Bacteria 523
293 Ga0501067_0447166 3300049583 Bacteria 722
294 Ga0501071_0449303 3300049587 Bacteria 986
295 Ga0501071_1181249 3300049587 Bacteria 591
296 Ga0501073_0581629 3300049589 Bacteria 773
297 Ga0501223_043729 3300049663 Bacteria 869
298 Ga0501239_000916 3300049672 Bacteria 2406
299 Ga0501239_021436 3300049672 Bacteria 795
300 Ga0501242_047281 3300049674 Bacteria 623
301 Ga0501250_005968 3300049680 Bacteria 1271
302 Ga0501257_023473 3300049686 Bacteria 1463
303 Ga0501079_1173971 3300049741 Bacteria 605
304 Ga0501080_0251228 3300049742 Bacteria 1612
305 Ga0501081_1024931 3300049743 Bacteria 624
306 Ga0501265_106851 3300049762 Bacteria 518
307 Ga0501270_031287 3300049767 Bacteria 880
308 Ga0501035_0070124 3300049822 Bacteria 3105
309 Ga0501044_0031415 3300049823 Bacteria 5590
310 nmdc:mga0k408_6461_c1 3300050493 Bacteria 6248
311 nmdc:mga05p37_1333_c1 3300050507 Bacteria 28686
312 nmdc:mga05p37_1815511_c1 3300050507 Unclassified 587
313 nmdc:mga05p37_209704_c1 3300050507 Bacteria 2356
314 nmdc:mga09592_575823_c1 3300050508 Bacteria 966
315 nmdc:mga0qj67_1573292_c1 3300050509 Bacteria 505
316 nmdc:mga06r32_128490_c1 3300050510 Bacteria 2504
317 nmdc:mga06r32_182961_c1 3300050510 Bacteria 2082
318 Ga0500635_0273241 3300053080 Bacteria 665
319 Ga0495619_0089706 3300053085 Bacteria 2080
320 Ga0500646_0135157 3300053090 Bacteria 805
321 Ga0500583_0021316 3300053092 Bacteria 2693
322 Ga0500583_0070790 3300053092 Bacteria 1667
323 Ga0500641_0291488 3300053096 Bacteria 673
324 Ga0500650_0042126 3300053098 Bacteria 2109
325 Ga0500556_0313815 3300053104 Bacteria 611
326 Ga0500617_072428 3300053124 Bacteria 1507
327 Ga0500642_0168715 3300053130 Bacteria 1025
328 Ga0500658_0147577 3300053134 Bacteria 1059
329 Ga0500588_0241019 3300053146 Bacteria 677
330 Ga0500637_0024788 3300053178 Bacteria 3289
331 Ga0501084_0225386 3300054114 Bacteria 1582
332 Ga0501084_0248789 3300054114 Bacteria 1501
333 Ga0466962_0007762 3300061719 Bacteria 5140
334 8004183579 8004182704 Bacteria 3391155
335 Ga0068861_100948611
336 JGI24737J22298_10060280
337 Ga0065707_10250848
338 Ga0070658_10021333
339 Ga0070670_100166285
340 Ga0070677_10005447
341 Ga0070666_10119988
342 Ga0070666_10181166
343 Ga0070666_11142416
344 Ga0070661_100017063
345 Ga0070661_100084738
346 Ga0070692_10784135
347 Ga0070692_10895120
348 Ga0070692_11158058
349 Ga0070675_100327634
350 Ga0070675_100359690
351 Ga0070675_100961275
352 Ga0070671_100327825
353 Ga0070671_100692697
354 Ga0070674_100222397
355 Ga0070674_100403825
356 Ga0070674_101095801
357 Ga0070674_101140762
358 Ga0070673_100374792
359 Ga0070673_100951321
360 Ga0070667_100711461
361 Ga0070703_10484732
362 Ga0070713_102079336
363 Ga0070711_101392575
364 Ga0070700_100066701
365 Ga0070663_100796956
366 Ga0070678_100168727
367 Ga0070678_100287978
368 Ga0070678_100301257
369 Ga0070678_100447554
370 Ga0070662_100047955
371 Ga0070662_100914636
372 Ga0068867_100506935
373 Ga0070685_10805556
374 Ga0070707_101899276
375 Ga0070679_100351373
376 Ga0070684_100003382
377 Ga0068853_100020896
378 Ga0068853_100102265
379 Ga0068853_100144263
380 Ga0070672_100180285
381 Ga0070672_101950276
382 Ga0070693_100973950
383 Ga0070665_100033178
384 Ga0068855_100385411
385 Ga0068855_101110830
386 Ga0070664_100014280
387 Ga0070664_100135220
388 Ga0070664_100442223
389 Ga0068857_100005028
390 Ga0068857_100133985
391 Ga0068852_100012089
392 Ga0068852_101061333
393 Ga0068864_100030031
394 Ga0068864_100913828
395 Ga0068866_10545223
396 Ga0068866_10604137
397 Ga0068861_100458405
398 Ga0068851_10042008
399 Ga0068851_10445032
400 Ga0068851_10663841
401 Ga0068870_10352213
402 Ga0068863_100252216
403 Ga0068863_100367754
404 Ga0070715_10162470
405 Ga0070716_100045434
406 Ga0070716_101621247
407 Ga0097621_100003730
408 Ga0097621_100816367
409 Ga0097621_100855644
410 Ga0075370_10165166
411 Ga0068871_100008309
412 Ga0068871_100031260
413 Ga0068871_102255260
414 Ga0075428_101016702
415 Ga0075430_100081421
416 Ga0075431_100011674
417 Ga0075431_100345126
418 Ga0075433_10124437
419 Ga0068865_100007733
420 Ga0068865_100426899
421 Ga0097620_100815461
422 Ga0099794_10006295
423 Ga0099795_10080697
424 Ga0099795_10296810
425 Ga0105240_10034070
426 Ga0105240_10423159
427 Ga0105245_10629349
428 Ga0105245_11310995
429 Ga0114129_10001432
430 Ga0114129_12126748
431 Ga0105243_10651147
432 Ga0105243_12429223
433 Ga0105242_10033362
434 Ga0105248_10266964
435 Ga0105237_10393598
436 Ga0105237_11058757
437 Ga0105237_12340452
438 Ga0105030_104792
439 Ga0105239_10110270
440 Ga0105239_10744703
441 Ga0157373_10338786
442 Ga0157370_10634689
443 Ga0157369_10103672
444 Ga0157374_10404646
445 Ga0157374_11945392
446 Ga0157378_10000006
447 Ga0157378_10067973
448 Ga0163162_10496816
449 Ga0163162_10719885
450 Ga0157372_10139800
451 Ga0157372_10255405
452 Ga0157372_10544608
453 Ga0157372_12562958
454 Ga0163163_10224939
455 Ga0157380_10255045
456 Ga0157380_11263797
457 Ga0157380_13207981
458 Ga0157380_13524739
459 Ga0157379_10794375
460 Ga0157379_11448710
461 Ga0157376_10303402
462 Ga0157376_11443105
463 Ga0209675_1002402
464 Ga0207697_10295348
465 Ga0207656_10725139
466 Ga0207682_10015231
467 Ga0207642_10687605
468 Ga0207647_10560381
469 Ga0207705_10260452
470 Ga0207671_10302807
471 Ga0207693_10531925
472 Ga0207662_10614808
473 Ga0207662_10732520
474 Ga0207657_10049299
475 Ga0207649_10113733
476 Ga0207649_10308475
477 Ga0207694_10002776
478 Ga0207650_10264700
479 Ga0207650_10265572
480 Ga0207650_11480314
481 Ga0207659_10221461
482 Ga0207659_10282745
483 Ga0207659_10364584
484 Ga0207664_11433041
485 Ga0207644_10707292
486 Ga0207644_11174734
487 Ga0207690_10253949
488 Ga0207706_10279124
489 Ga0207706_10319900
490 Ga0207686_10013294
491 Ga0207670_10388918
492 Ga0207670_10647678
493 Ga0207669_10239098
494 Ga0207669_11944917
495 Ga0207704_10010360
496 Ga0207704_10365635
497 Ga0207704_10588070
498 Ga0207665_10182941
499 Ga0207665_10622251
500 Ga0207691_10132530
501 Ga0207691_10218460
502 Ga0207691_10612201
503 Ga0207711_12145708
504 Ga0207661_10260173
505 Ga0207661_11083990
506 Ga0207679_10080099
507 Ga0207679_10232257
508 Ga0207667_10847549
509 Ga0207667_12015462
510 Ga0207651_10160118
511 Ga0207651_10780398
512 Ga0207651_10874861
513 Ga0207651_11028885
514 Ga0207640_10382336
515 Ga0207640_11773695
516 Ga0207703_11211520
517 Ga0207639_10242860
518 Ga0207639_10429841
519 Ga0207639_10881499
520 Ga0207639_10883336
521 Ga0207678_10997134
522 Ga0207702_11882079
523 Ga0207641_10235888
524 Ga0207648_10118458
525 Ga0207648_10978821
526 Ga0207676_10044762
527 Ga0207676_11152518
528 Ga0207674_10008765
529 Ga0207674_10099346
530 Ga0207675_100306239
531 Ga0207675_102065681
532 Ga0207683_10154046
533 Ga0207683_10185354
534 Ga0207683_10209936
535 Ga0207683_10670744
536 Ga0207683_11907307
537 Ga0207698_10139722
538 Ga0207698_10417370
539 Ga0207698_11124513
540 Ga0209588_1026773
541 Ga0209971_1060050
542 Ga0209966_1064070
543 Ga0268266_10009083
544 Ga0307517_10001511
545 Ga0265338_10790824
546 Ga0316180_1140089
547 Ga0265327_10143344
548 Ga0307513_10057757
549 Ga0307408_100320564
550 Ga0307408_101079402
551 Ga0307508_10002731
552 Ga0307508_10135395
553 Ga0307405_10982555
554 Ga0307410_10502443
555 Ga0307406_10281421
556 Ga0307412_10307895
557 Ga0307409_100063931
558 Ga0307416_101243307
559 Ga0307411_10601268
560 Ga0307411_11096608
561 Ga0307415_101235945
562 Ga0307507_10356325
563 Ga0373944_0088396
564 Ga0373936_0038598
565 Ga0373945_0030658
566 Ga0373946_0250116
567 Ga0373946_0353548
568 Ga0373955_0154825
569 Ga0373947_0464121
570 Ga0373947_1219415
571 Ga0373937_0001204
572 Ga0373937_0684570
573 Ga0373925_0019043
574 Ga0373925_0287453
575 Ga0373925_1176361
576 Ga0436365_0367130
577 Ga0451851_0051979
578 Ga0451853_0859566
579 Ga0451853_1677925
580 Ga0466972_0419149
581 Ga0466965_0555371
582 Ga0466967_0025467
583 Ga0495592_0182938
584 Ga0495592_0643562
585 Ga0495603_0262109
586 Ga0495638_0032495
587 Ga0495594_0203923
588 Ga0495618_0308608
589 Ga0495632_0057569
590 Ga0495648_0143459
591 Ga0495642_0401939
592 Ga0495647_0187129
593 Ga0495658_0128583
594 Ga0495658_0429628
595 Ga0495613_0818087
596 Ga0495613_0861536
597 Ga0495674_1355038
598 Ga0495672_0037575
599 Ga0495672_0047696
600 Ga0496101_0632586
601 Ga0496104_0328257
602 Ga0496104_1043960
603 Ga0496105_0027666
604 Ga0496105_0050593
605 Ga0496105_0105564
606 Ga0496106_0640469
607 Ga0496108_0154705
608 Ga0496109_1708925
609 Ga0496110_0353846
610 Ga0496110_0503387
611 Ga0496111_0345199
612 Ga0496112_0394947
613 Ga0496114_0448515
614 Ga0496115_0262805
615 Ga0496124_0420763
616 Ga0501031_0301060
617 Ga0501033_0231254
618 Ga0501034_0006202
619 Ga0501037_0636849
620 Ga0501038_0018377
621 Ga0501041_0812148
622 Ga0501042_0593690
623 Ga0501046_0001887
624 Ga0501047_0181399
625 Ga0501047_0300577
626 Ga0501047_1367734
627 Ga0501067_0447166
628 Ga0501071_0449303
629 Ga0501071_1181249
630 Ga0501073_0581629
631 Ga0501223_043729
632 Ga0501239_000916
633 Ga0501239_021436
634 Ga0501242_047281
635 Ga0501250_005968
636 Ga0501257_023473
637 Ga0501079_1173971
638 Ga0501080_0251228
639 Ga0501081_1024931
640 Ga0501265_106851
641 Ga0501270_031287
642 Ga0501035_0070124
643 Ga0501044_0031415
644 nmdc:mga0k408_6461_c1
645 nmdc:mga05p37_1333_c1
646 nmdc:mga05p37_1815511_c1
647 nmdc:mga05p37_209704_c1
648 nmdc:mga09592_575823_c1
649 nmdc:mga0qj67_1573292_c1
650 nmdc:mga06r32_128490_c1
651 nmdc:mga06r32_182961_c1
652 Ga0500635_0273241
653 Ga0495619_0089706
654 Ga0500646_0135157
655 Ga0500583_0021316
656 Ga0500583_0070790
657 Ga0500641_0291488
658 Ga0500650_0042126
659 Ga0500556_0313815
660 Ga0500617_072428
661 Ga0500642_0168715
662 Ga0500658_0147577
663 Ga0500588_0241019
664 Ga0500637_0024788
665 Ga0501084_0225386
666 Ga0501084_0248789
667 Ga0466962_0007762
668 8004183579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10041

DUF2277

Uncharacterized conserved protein (DUF2277)

2

76

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8glv-assembly1.cif.gz_AR 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.6418 15 61
5wi4-assembly1.cif.gz_A crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.6105 6 61
5wi4-assembly1.cif.gz_C crystal structure of dynlt1/tctex-1 in complex with arhgef2 0.6094 6 61
7xxm-assembly2.cif.gz_G orf1-glycine-4-aminobutylthricin complex 0.5716 15 69
5hxl-assembly1.cif.gz_A-2 structure based function annotation of a hypothetical protein mgg_01005 related to the development of rice blast fungus 0.5672 9 69
ID Description Score Start End Superfamily
af_Q9TZB8_149_233_1.10.246.20 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.6279 17 66 1.10.246.20
1sb0A00 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1;Coactivator CBP, KIX domain 0.616 6 63 1.10.246.20
af_Q94255_26_115_1.10.225.10 Mainly Alpha;Orthogonal Bundle;NK-Lysin;Saposin-like 0.6138 17 67 1.10.225.10
af_Q9VLV6_166_281_1.25.40.420 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.6114 15 60 1.25.40.420
af_A5A6Y4_49_125_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.5848 15 62 1.10.287.110
ID Description Score Start End GO Terms
AF-E0I5X4-F1-model_v4 DUF2277 domain-containing protein 0.9976 1 87
AF-A0A529FDB9-F1-model_v4 DUF2277 domain-containing protein 0.9961 1 70
AF-A0A359LWU3-F1-model_v4 DUF2277 domain-containing protein 0.9939 1 87
AF-A0A3N5PKK7-F1-model_v4 DUF2277 domain-containing protein 0.9903 1 88
AF-A0A7W0MYW5-F1-model_v4 DUF2277 domain-containing protein 0.99 1 87

Map