F411575

General Info

Members Datasets Scaffolds Average Seq Length
333 290 282 369

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2545555834|2545675375
Length 405
Sequence TTIDSGQNLLDAAAGRDLLDTGASGHEGPQASGHEGPQAGSHRVPAPRSPVMAWNEWDPLEEVIVGSLDGATIPTHHLTVIFNLPRAAQPFYRLASGWKYPKFMKKLAQAELDNFIRILAGEGVRVRRPDAVDFSKKFRAPRWTSRGFCVACPRDPYLVIGDEIIESPMCWRSRYFEGDAYRSLFKEYFRAGARWTSAPRPQLTDELYNYDYRVPNLKAGEPMRYTVNEFEPVFDAADFVRCGRDLFVTRSNVTNLMGIEWLRRHLGPGFRIHEIESRCPQPMHIDSSFMPLAPGKVLVNPDYVDVERLPKVLKSWDVLIAPRPDPVEGFMSRISMCSPWTSINVLMLDEKKVVVDASQPTLIKALKGWGFDPIPAPFLSYGPFGGSFHCATLDVRRRGTLKSYF

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231031 Pseudomonas sp. GM16 Isolate Nodule
5 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
6 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
7 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
8 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
9 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
10 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
11 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
12 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
13 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
14 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
15 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
16 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
17 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
18 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
19 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
20 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
21 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
22 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
23 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
24 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
25 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
26 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
27 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
28 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
29 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
30 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
31 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
32 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
33 2902330777 Methylobacterium sp. 2A Isolate Unclassified
34 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
35 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
36 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
37 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
38 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
39 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
40 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
41 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
42 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
43 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
89 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
126 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
127 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
184 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
188 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
201 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
239 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
240 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
241 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
242 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
243 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
244 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
245 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
246 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
247 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
248 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
249 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
250 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
251 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
252 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
253 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
254 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
257 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
258 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
263 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
267 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
268 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 641522639 Methylobacterium sp. 4-46 Isolate Nodule
285 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
286 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
287 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
288 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
289 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
290 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.38
Metatranscriptomes 0.3
Isolates 15.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 3
Nodule 5.11
Rhizoplane 0.3
Rhizosphere 84.08
Stem 0
Stem Tuber 0
Unclassified 7.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10064421 3300005288 Bacteria 398277
2 Ga0065712_10000131 3300005290 Bacteria 122292
3 Ga0065715_10000358 3300005293 Bacteria 14340
4 Ga0070658_10136463 3300005327 Bacteria 2047
5 Ga0070690_100025486 3300005330 Bacteria 3643
6 Ga0070687_100098388 3300005343 Bacteria 1633
7 Ga0070692_10031127 3300005345 Bacteria 2673
8 Ga0070673_100071770 3300005364 Bacteria 2783
9 Ga0070714_100117550 3300005435 Bacteria 2362
10 Ga0070710_10005563 3300005437 Bacteria 5999
11 Ga0070694_100099849 3300005444 Bacteria 2052
12 Ga0070708_100232702 3300005445 Bacteria 1729
13 Ga0070681_10222550 3300005458 Bacteria 1802
14 Ga0070706_100000090 3300005467 Bacteria 107658
15 Ga0070706_100040032 3300005467 Bacteria 4327
16 Ga0070706_100215590 3300005467 Bacteria 1792
17 Ga0070707_100017222 3300005468 Bacteria 6791
18 Ga0070698_100268961 3300005471 Bacteria 1636
19 Ga0070699_100001710 3300005518 Bacteria 20008
20 Ga0070679_100028792 3300005530 Bacteria 5479
21 Ga0070684_100001181 3300005535 Bacteria 18773
22 Ga0070697_100062187 3300005536 Bacteria 3047
23 Ga0070697_100196941 3300005536 Bacteria 1711
24 Ga0068853_100489548 3300005539 Bacteria 1160
25 Ga0070695_100044099 3300005545 Bacteria 2838
26 Ga0070695_100084717 3300005545 Bacteria 2103
27 Ga0070693_100003950 3300005547 Bacteria 6957
28 Ga0068855_100359246 3300005563 Bacteria 1603
29 Ga0068857_100289180 3300005577 Bacteria 1509
30 Ga0068859_100011600 3300005617 Bacteria 8862
31 Ga0068863_100364823 3300005841 Bacteria 1408
32 Ga0068858_100007326 3300005842 Bacteria 10679
33 Ga0068858_100305579 3300005842 Bacteria 1518
34 Ga0068860_100019248 3300005843 Bacteria 6627
35 Ga0068862_100115011 3300005844 Bacteria 2365
36 Ga0068862_100254812 3300005844 Bacteria 1600
37 Ga0081540_1018978 3300005983 Bacteria 4199
38 Ga0081540_1024616 3300005983 Bacteria 3489
39 Ga0081539_10006157 3300005985 Bacteria 11673
40 Ga0075365_10068537 3300006038 Bacteria 2384
41 Ga0075365_10160355 3300006038 Bacteria 1567
42 Ga0075363_100013888 3300006048 Bacteria 3920
43 Ga0070712_100031683 3300006175 Bacteria 3564
44 Ga0075367_10017524 3300006178 Bacteria 3932
45 Ga0075370_10022063 3300006353 Bacteria 3492
46 Ga0068871_100151555 3300006358 Bacteria 1978
47 Ga0075428_100047958 3300006844 Bacteria 4690
48 Ga0075430_100048712 3300006846 Bacteria 3578
49 Ga0075433_10045037 3300006852 Bacteria 3834
50 Ga0075434_100248186 3300006871 Bacteria 1799
51 Ga0075436_100101666 3300006914 Bacteria 2002
52 Ga0097620_100011600 3300006931 Bacteria 8862
53 Ga0099825_1035093 3300006941 Bacteria 1816
54 Ga0099824_1021362 3300006942 Bacteria 4536
55 Ga0099795_10041616 3300007788 Bacteria 1637
56 Ga0105251_10050720 3300009011 Bacteria 1981
57 Ga0105244_10002346 3300009036 Bacteria 14371
58 Ga0105244_10033680 3300009036 Bacteria 2700
59 Ga0111539_10016137 3300009094 Bacteria 9268
60 Ga0105247_10000076 3300009101 Bacteria 111669
61 Ga0114129_10016310 3300009147 Bacteria 10575
62 Ga0114129_10334154 3300009147 Bacteria 2011
63 Ga0105243_10133607 3300009148 Bacteria 2108
64 Ga0105241_10008088 3300009174 Bacteria 7737
65 Ga0105241_10070143 3300009174 Bacteria 2719
66 Ga0105237_10015534 3300009545 Bacteria 7921
67 Ga0099796_10017201 3300010159 Bacteria 2149
68 Ga0099796_10028938 3300010159 Bacteria 1783
69 Ga0105239_10161497 3300010375 Bacteria 2503
70 Ga0105246_10060558 3300011119 Bacteria 2631
71 Ga0105246_10110393 3300011119 Bacteria 2019
72 Ga0157373_10034962 3300013100 Bacteria 3609
73 Ga0157373_10035928 3300013100 Bacteria 3557
74 Ga0157373_10176861 3300013100 Bacteria 1502
75 Ga0157372_10560014 3300013307 Bacteria 1332
76 Ga0182008_10000921 3300014497 Bacteria 20485
77 Ga0182007_10000631 3300015262 Bacteria 20496
78 Ga0256744_111471 3300023309 Bacteria 2344
79 Ga0207655_1007338 3300025728 Bacteria 7158
80 Ga0207692_10169898 3300025898 Bacteria 1263
81 Ga0207710_10001319 3300025900 Bacteria 12525
82 Ga0207688_10010827 3300025901 Bacteria 4963
83 Ga0207684_10021038 3300025910 Bacteria 5570
84 Ga0207654_10015083 3300025911 Bacteria 4001
85 Ga0207654_10135440 3300025911 Bacteria 1564
86 Ga0207707_10125429 3300025912 Bacteria 2245
87 Ga0207671_10038678 3300025914 Bacteria 3535
88 Ga0207693_10120494 3300025915 Bacteria 2060
89 Ga0207662_10032797 3300025918 Bacteria 3024
90 Ga0207662_10061449 3300025918 Bacteria 2256
91 Ga0207652_10046500 3300025921 Bacteria 3703
92 Ga0207681_10121272 3300025923 Bacteria 1918
93 Ga0207691_10100902 3300025940 Bacteria 2576
94 Ga0207689_10145752 3300025942 Bacteria 1951
95 Ga0207651_10163072 3300025960 Bacteria 1749
96 Ga0207640_10081576 3300025981 Bacteria 2212
97 Ga0207703_10024782 3300026035 Bacteria 4720
98 Ga0207703_10207703 3300026035 Bacteria 1744
99 Ga0207674_10175330 3300026116 Bacteria 2097
100 Ga0209389_1000156 3300027296 Bacteria 57387
101 Ga0209389_1058456 3300027296 Bacteria 2449
102 Ga0209589_1033185 3300027357 Bacteria 2449
103 Ga0209489_109778 3300027361 Bacteria 11546
104 Ga0209700_100030 3300027363 Bacteria 212982
105 Ga0209588_1002274 3300027671 Bacteria 5196
106 Ga0209588_1002390 3300027671 Bacteria 5084
107 Ga0207428_10010596 3300027907 Bacteria 8227
108 Ga0268264_10061035 3300028381 Bacteria 3161
109 Ga0307515_10294754 3300028794 Bacteria 1314
110 Ga0265328_10000169 3300031239 Bacteria 30144
111 Ga0265331_10000015 3300031250 Bacteria 289934
112 Ga0265331_10010024 3300031250 Bacteria 5268
113 Ga0265327_10003662 3300031251 Bacteria 14435
114 Ga0307408_100002777 3300031548 Bacteria 12156
115 Ga0307405_10032746 3300031731 Unclassified 3075
116 Ga0307413_10109454 3300031824 Bacteria 1846
117 Ga0307410_10004439 3300031852 Bacteria 7253
118 Ga0307406_10000896 3300031901 Bacteria 16744
119 Ga0307407_10128002 3300031903 Bacteria 1620
120 Ga0307412_10003108 3300031911 Bacteria 9216
121 Ga0307416_100003558 3300032002 Bacteria 9189
122 Ga0307414_10002142 3300032004 Bacteria 10306
123 Ga0307411_10015410 3300032005 Unclassified 4292
124 Ga0307415_100001435 3300032126 Bacteria 11403
125 Ga0307415_100018393 3300032126 Bacteria 4219
126 Ga0307507_10012847 3300033179 Bacteria 10276
127 Ga0307510_10002246 3300033180 Bacteria 21830
128 Ga0373951_0002796 3300035091 Bacteria 4353
129 Ga0373951_0004318 3300035091 Bacteria 3384
130 Ga0373960_0048050 3300035121 Bacteria 1258
131 Ga0373955_0104555 3300035172 Bacteria 1630
132 Ga0373927_0008321 3300035695 Bacteria 6984
133 Ga0373947_0115611 3300035725 Bacteria 1700
134 Ga0373937_0038394 3300036401 Bacteria 4363
135 Ga0373925_0048981 3300037068 Bacteria 3149
136 Ga0395901_0246597 3300038443 Bacteria 1862
137 Ga0242422_00565 3300038699 Bacteria 2397
138 Ga0466969_0010063 3300044656 Bacteria 5016
139 Ga0466969_0018090 3300044656 Bacteria 3677
140 Ga0466972_0002291 3300044658 Bacteria 9403
141 Ga0466972_0045748 3300044658 Bacteria 2120
142 Ga0466965_0000093 3300044683 Bacteria 25726
143 Ga0466965_0017870 3300044683 Bacteria 3392
144 Ga0466966_0005683 3300044684 Bacteria 8204
145 Ga0466966_0018549 3300044684 Bacteria 4587
146 Ga0466966_0091462 3300044684 Bacteria 1888
147 Ga0466961_0006243 3300044693 Bacteria 7568
148 Ga0466961_0042376 3300044693 Bacteria 2917
149 Ga0466963_0002154 3300044694 Bacteria 10898
150 Ga0466964_0012694 3300044706 Bacteria 3189
151 Ga0453684_0009524 3300044712 Bacteria 16981
152 Ga0466971_0000380 3300044719 Bacteria 17048
153 Ga0466968_0007938 3300044735 Bacteria 4053
154 Ga0466970_0000725 3300044765 Bacteria 16100
155 Ga0466957_0000595 3300044842 Bacteria 18393
156 Ga0466957_0141517 3300044842 Bacteria 1550
157 Ga0466959_0003287 3300045049 Bacteria 10539
158 Ga0466959_0019465 3300045049 Bacteria 4992
159 Ga0451576_0106891 3300045051 Bacteria 2912
160 Ga0466958_0079472 3300045836 Bacteria 2016
161 Ga0495617_002326 3300046452 Bacteria 7637
162 Ga0495627_000747 3300046453 Bacteria 24285
163 Ga0495591_006581 3300046458 Bacteria 5108
164 Ga0495629_0016662 3300046459 Bacteria 5274
165 Ga0495638_0009066 3300046460 Bacteria 7011
166 Ga0495651_0001669 3300046462 Bacteria 17161
167 Ga0495651_0014706 3300046462 Bacteria 6052
168 Ga0495653_0030246 3300046463 Bacteria 4316
169 Ga0495662_0010758 3300046476 Bacteria 4473
170 Ga0495664_0002876 3300046477 Bacteria 9283
171 Ga0495585_0110390 3300046492 Bacteria 1463
172 Ga0495596_0014098 3300046500 Bacteria 3371
173 Ga0495607_0002527 3300046501 Bacteria 14812
174 Ga0495583_0009167 3300046506 Bacteria 5944
175 Ga0495610_0002720 3300046512 Bacteria 14546
176 Ga0495616_0001843 3300046513 Bacteria 14347
177 Ga0495620_0001518 3300046515 Bacteria 13804
178 Ga0495632_0002135 3300046519 Bacteria 15357
179 Ga0495637_0000670 3300046520 Bacteria 23802
180 Ga0495643_0002572 3300046522 Bacteria 14177
181 Ga0495644_0008193 3300046523 Bacteria 4022
182 Ga0495648_0000325 3300046524 Bacteria 52966
183 Ga0495648_0002973 3300046524 Bacteria 15212
184 Ga0495652_0001657 3300046529 Bacteria 24202
185 Ga0495652_0276237 3300046529 Bacteria 1232
186 Ga0495654_0002145 3300046530 Bacteria 12874
187 Ga0495587_0082406 3300046536 Bacteria 1864
188 Ga0495587_0083839 3300046536 Bacteria 1846
189 Ga0495609_0001575 3300046538 Bacteria 14917
190 Ga0495667_0036358 3300046559 Bacteria 3288
191 Ga0495634_0009337 3300046642 Bacteria 7237
192 Ga0495611_0000491 3300046648 Bacteria 23626
193 Ga0495625_0001127 3300046660 Bacteria 34568
194 Ga0495635_0019421 3300046663 Bacteria 4736
195 Ga0495661_0002731 3300046665 Bacteria 13433
196 Ga0495657_0003863 3300046675 Bacteria 12068
197 Ga0495646_0002630 3300046680 Bacteria 11084
198 Ga0495613_0037541 3300046689 Bacteria 3591
199 Ga0495624_0203577 3300046690 Bacteria 1202
200 Ga0495670_0000804 3300046691 Bacteria 15101
201 Ga0495671_0010681 3300046692 Bacteria 5079
202 Ga0495600_0046489 3300046809 Bacteria 2831
203 Ga0495604_0001456 3300047317 Bacteria 19440
204 Ga0495604_0215766 3300047317 Bacteria 1324
205 Ga0495674_0051634 3300047319 Bacteria 3624
206 Ga0495672_0003836 3300047320 Bacteria 12649
207 Ga0495672_0008275 3300047320 Bacteria 7704
208 Ga0495676_0006970 3300047321 Bacteria 10371
209 Ga0495680_0050057 3300047322 Bacteria 3268
210 Ga0495683_0001716 3300047323 Bacteria 13892
211 Ga0495687_003237 3300047443 Bacteria 12024
212 Ga0495673_0003089 3300047469 Bacteria 11196
213 Ga0495681_0001231 3300047470 Bacteria 19473
214 Ga0495686_0003889 3300047472 Bacteria 12603
215 Ga0495686_0005555 3300047472 Bacteria 9916
216 Ga0495686_0060640 3300047472 Bacteria 2351
217 Ga0495593_0075956 3300047673 Bacteria 1741
218 Ga0495602_0027355 3300048088 Bacteria 5480
219 Ga0496108_0418049 3300048911 Bacteria 1171
220 Ga0501298_002579 3300049521 Bacteria 2754
221 Ga0501034_0163959 3300049571 Bacteria 2192
222 Ga0501036_0024376 3300049572 Bacteria 5099
223 Ga0501038_0201609 3300049574 Unclassified 1596
224 Ga0501040_0007908 3300049576 Bacteria 6896
225 Ga0501046_0010307 3300049580 Bacteria 8037
226 Ga0501048_0004852 3300049582 Bacteria 10253
227 Ga0501071_0023742 3300049587 Bacteria 4283
228 Ga0501072_0028665 3300049588 Bacteria 4346
229 Ga0501073_0169346 3300049589 Bacteria 1512
230 Ga0501074_0022742 3300049590 Bacteria 4558
231 Ga0501075_0019320 3300049591 Bacteria 4940
232 Ga0501076_0087550 3300049592 Bacteria 2503
233 Ga0501077_0105334 3300049593 Bacteria 1787
234 Ga0501198_000274 3300049649 Bacteria 6519
235 Ga0501207_001440 3300049654 Unclassified 2973
236 Ga0501208_001345 3300049655 Bacteria 2307
237 Ga0501216_000230 3300049660 Bacteria 6190
238 Ga0501217_000039 3300049661 Bacteria 14504
239 Ga0501223_000150 3300049663 Bacteria 18608
240 Ga0501224_000097 3300049664 Bacteria 9180
241 Ga0501227_000008 3300049665 Bacteria 36003
242 Ga0501233_002771 3300049668 Unclassified 3111
243 Ga0501235_000524 3300049669 Bacteria 7690
244 Ga0501239_001513 3300049672 Unclassified 2005
245 Ga0501240_000091 3300049673 Bacteria 5630
246 Ga0501246_002265 3300049676 Unclassified 1519
247 Ga0501250_001378 3300049680 Bacteria 1980
248 Ga0501253_003777 3300049683 Bacteria 1850
249 Ga0501257_007522 3300049686 Unclassified 2434
250 Ga0501259_002419 3300049688 Unclassified 3030
251 Ga0501225_0000089 3300049705 Bacteria 29061
252 Ga0501229_000810 3300049706 Unclassified 3533
253 Ga0501234_000675 3300049707 Bacteria 5272
254 Ga0501245_002730 3300049708 Bacteria 2369
255 Ga0501079_0046379 3300049741 Bacteria 3353
256 Ga0501080_0125467 3300049742 Unclassified 2377
257 Ga0501081_0063924 3300049743 Bacteria 2555
258 Ga0501268_007772 3300049765 Bacteria 1607
259 Ga0501273_001470 3300049770 Unclassified 2250
260 Ga0501035_0024150 3300049822 Bacteria 5577
261 Ga0501045_0079486 3300049824 Bacteria 2417
262 Ga0501204_002303 3300049850 Bacteria 1928
263 Ga0501212_012936 3300049851 Bacteria 1219
264 Ga0501226_000541 3300049853 Bacteria 5229
265 nmdc:mga03n38_3356_c1 3300050490 Bacteria 5127
266 nmdc:mga0yw44_57006_c1 3300050492 Bacteria 2382
267 nmdc:mga06z11_60008_c1 3300050494 Bacteria 1979
268 nmdc:mga07m45_11751_c1 3300050496 Bacteria 4607
269 nmdc:mga05p37_26483_c1 3300050507 Bacteria 7053
270 nmdc:mga05p37_31603_c1 3300050507 Bacteria 6468
271 nmdc:mga0qj67_40973_c1 3300050509 Bacteria 3641
272 nmdc:mga06r32_378112_c1 3300050510 Bacteria 1399
273 nmdc:mga08y16_188695_c1 3300050511 Bacteria 2139
274 Ga0495601_0005930 3300053077 Bacteria 7124
275 Ga0495619_0151138 3300053085 Bacteria 1602
276 Ga0500618_005390 3300053125 Bacteria 3899
277 Ga0501084_0291616 3300054114 Bacteria 1378
278 Ga0501082_0024163 3300060353 Bacteria 5241
279 Ga0501082_0163528 3300060353 Bacteria 1934
280 Ga0466962_0000309 3300061719 Bacteria 20902
281 Ga0530510_0009301 3300061734 Bacteria 6895
282 Ga0530510_0040713 3300061734 Bacteria 3353

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_26483_c1 nmdc:mga05p37_26483_c1_4656_5612 305
2 3300035172 Ga0373955_0104555 Ga0373955_0104555_639_1592 316
3 3300035091 Ga0373951_0002796 Ga0373951_0002796_2878_3843 321
4 3300049571 Ga0501034_0163959 Ga0501034_0163959_1184_2182 327
5 3300046809 Ga0495600_0046489 Ga0495600_0046489_36_1040 328
6 3300049668 Ga0501233_002771 Ga0501233_002771_1539_2534 331
7 3300046462 Ga0495651_0001669 Ga0495651_0001669_3183_4268 332
8 3300028794 Ga0307515_10294754 Ga0307515_102947541 335
9 3300009147 Ga0114129_10016310 Ga0114129_100163106 337
10 3300044656 Ga0466969_0010063 Ga0466969_0010063_2634_3665 337
11 3300044684 Ga0466966_0018549 Ga0466966_0018549_781_1812 337
12 3300045049 Ga0466959_0019465 Ga0466959_0019465_1474_2505 337
13 3300048088 Ga0495602_0027355 Ga0495602_0027355_4297_5370 337
14 iso_pu_bacteria 2847939898 2847942569 337
15 3300049521 Ga0501298_002579 Ga0501298_002579_197_1213 338
16 3300033179 Ga0307507_10012847 Ga0307507_100128476 341
17 3300035121 Ga0373960_0048050 Ga0373960_0048050_48_1073 341
18 3300046459 Ga0495629_0016662 Ga0495629_0016662_1120_2205 341
19 3300046476 Ga0495662_0010758 Ga0495662_0010758_3198_4283 341
20 3300046477 Ga0495664_0002876 Ga0495664_0002876_1250_2335 341
21 3300046536 Ga0495587_0083839 Ga0495587_0083839_393_1478 341
22 3300046642 Ga0495634_0009337 Ga0495634_0009337_2977_4062 341
23 3300046663 Ga0495635_0019421 Ga0495635_0019421_107_1192 341
24 3300046675 Ga0495657_0003863 Ga0495657_0003863_8286_9371 341
25 3300046689 Ga0495613_0037541 Ga0495613_0037541_983_2068 341
26 3300047317 Ga0495604_0001456 Ga0495604_0001456_14738_15823 341
27 3300047319 Ga0495674_0051634 Ga0495674_0051634_2455_3540 341
28 3300047321 Ga0495676_0006970 Ga0495676_0006970_3167_4252 341
29 3300047673 Ga0495593_0075956 Ga0495593_0075956_466_1551 341
30 iso_pu_bacteria 2873151551 2873152607 346
31 3300006846 Ga0075430_100048712 Ga0075430_1000487124 348
32 iso_pu_bacteria 8025478263 8025482496 348
33 3300035725 Ga0373947_0115611 Ga0373947_0115611_172_1236 349
34 3300046559 Ga0495667_0036358 Ga0495667_0036358_30_1094 349
35 3300046690 Ga0495624_0203577 Ga0495624_0203577_116_1180 349
36 3300047317 Ga0495604_0215766 Ga0495604_0215766_227_1294 349
37 3300047472 Ga0495686_0005555 Ga0495686_0005555_2808_3872 349
38 3300047472 Ga0495686_0060640 Ga0495686_0060640_773_1837 349
39 3300061734 Ga0530510_0009301 Ga0530510_0009301_5594_6643 349
40 3300005467 Ga0070706_100215590 Ga0070706_1002155903 350
41 3300050509 nmdc:mga0qj67_40973_c1 nmdc:mga0qj67_40973_c1_2468_3538 350
42 3300014497 Ga0182008_10000921 Ga0182008_100009219 354
43 3300015262 Ga0182007_10000631 Ga0182007_1000063110 354
44 3300053125 Ga0500618_005390 Ga0500618_005390_2026_3153 354
45 iso_pu_bacteria 2510065053 2510282028 354
46 iso_pu_bacteria 2510065055 2510291813 354
47 iso_pu_bacteria 2510065058 2510310176 354
48 iso_pu_bacteria 2513237139 2513880470 354
49 iso_pu_bacteria 2984499530 2984502560 354
50 iso_pu_bacteria 3006493962 3006500489 354
51 3300005343 Ga0070687_100098388 Ga0070687_1000983881 355
52 3300025918 Ga0207662_10061449 Ga0207662_100614492 355
53 iso_pu_bacteria 2852657418 2852662361 355
54 iso_pu_bacteria 3006486233 3006490961 355
55 3300005437 Ga0070710_10005563 Ga0070710_100055634 356
56 3300005842 Ga0068858_100305579 Ga0068858_1003055792 356
57 3300026035 Ga0207703_10207703 Ga0207703_102077032 356
58 iso_pu_bacteria 2511231031 2511413731 356
59 iso_pu_bacteria 2867346516 2867350257 356
60 iso_pu_bacteria 8002060224 8002063870 356
61 3300005547 Ga0070693_100003950 Ga0070693_1000039502 357
62 3300049743 Ga0501081_0063924 Ga0501081_0063924_210_1370 357
63 3300060353 Ga0501082_0163528 Ga0501082_0163528_194_1354 357
64 iso_pu_bacteria 8056667051 8056671211 357
65 3300009011 Ga0105251_10050720 Ga0105251_100507202 358
66 3300009036 Ga0105244_10033680 Ga0105244_100336801 358
67 3300013100 Ga0157373_10034962 Ga0157373_100349623 358
68 3300050490 nmdc:mga03n38_3356_c1 nmdc:mga03n38_3356_c1_436_1548 358
69 3300050494 nmdc:mga06z11_60008_c1 nmdc:mga06z11_60008_c1_685_1797 358
70 3300050496 nmdc:mga07m45_11751_c1 nmdc:mga07m45_11751_c1_2698_3810 358
71 iso_pu_bacteria 2891088606 2891092793 358
72 3300035695 Ga0373927_0008321 Ga0373927_0008321_528_1625 359
73 3300037068 Ga0373925_0048981 Ga0373925_0048981_597_1694 359
74 3300005467 Ga0070706_100000090 Ga0070706_10000009028 360
75 3300005471 Ga0070698_100268961 Ga0070698_1002689612 360
76 3300009036 Ga0105244_10002346 Ga0105244_100023465 360
77 3300025728 Ga0207655_1007338 Ga0207655_10073385 360
78 3300031250 Ga0265331_10000015 Ga0265331_10000015231 360
79 3300031250 Ga0265331_10010024 Ga0265331_100100246 360
80 3300031251 Ga0265327_10003662 Ga0265327_100036628 360
81 3300033180 Ga0307510_10002246 Ga0307510_100022466 360
82 3300046452 Ga0495617_002326 Ga0495617_002326_3238_4344 360
83 3300046453 Ga0495627_000747 Ga0495627_000747_9493_10599 360
84 3300046458 Ga0495591_006581 Ga0495591_006581_2411_3517 360
85 3300046460 Ga0495638_0009066 Ga0495638_0009066_4713_5819 360
86 3300046492 Ga0495585_0110390 Ga0495585_0110390_89_1195 360
87 3300046500 Ga0495596_0014098 Ga0495596_0014098_1654_2760 360
88 3300046501 Ga0495607_0002527 Ga0495607_0002527_9229_10335 360
89 3300046506 Ga0495583_0009167 Ga0495583_0009167_4347_5453 360
90 3300046512 Ga0495610_0002720 Ga0495610_0002720_9224_10330 360
91 3300046513 Ga0495616_0001843 Ga0495616_0001843_3763_4869 360
92 3300046515 Ga0495620_0001518 Ga0495620_0001518_9152_10258 360
93 3300046519 Ga0495632_0002135 Ga0495632_0002135_9679_10785 360
94 3300046520 Ga0495637_0000670 Ga0495637_0000670_9558_10664 360
95 3300046522 Ga0495643_0002572 Ga0495643_0002572_3840_4946 360
96 3300046523 Ga0495644_0008193 Ga0495644_0008193_809_1915 360
97 3300046524 Ga0495648_0002973 Ga0495648_0002973_9518_10624 360
98 3300046530 Ga0495654_0002145 Ga0495654_0002145_10422_11528 360
99 3300046538 Ga0495609_0001575 Ga0495609_0001575_9491_10597 360
100 3300046648 Ga0495611_0000491 Ga0495611_0000491_9979_11085 360
101 3300046660 Ga0495625_0001127 Ga0495625_0001127_20920_22026 360
102 3300046665 Ga0495661_0002731 Ga0495661_0002731_9231_10337 360
103 3300046691 Ga0495670_0000804 Ga0495670_0000804_4532_5638 360
104 3300046692 Ga0495671_0010681 Ga0495671_0010681_2055_3161 360
105 3300047320 Ga0495672_0003836 Ga0495672_0003836_9168_10274 360
106 3300047323 Ga0495683_0001716 Ga0495683_0001716_9217_10323 360
107 3300047469 Ga0495673_0003089 Ga0495673_0003089_2236_3342 360
108 3300047470 Ga0495681_0001231 Ga0495681_0001231_4694_5800 360
109 3300047472 Ga0495686_0003889 Ga0495686_0003889_8000_9106 360
110 iso_pu_bacteria 2524023205 2524439360 360
111 iso_pu_bacteria 2744054633 2745082738 360
112 iso_pu_bacteria 2802429603 2805922644 360
113 iso_pu_bacteria 2824704595 2824707282 360
114 iso_pu_bacteria 2824753945 2824756684 360
115 iso_pu_bacteria 2824763712 2824770867 360
116 iso_pu_bacteria 2847930680 2847936920 360
117 iso_pu_bacteria 2879083081 2879087770 360
118 iso_pu_bacteria 2885409591 2885414417 360
119 iso_pu_bacteria 2904711408 2904716956 360
120 iso_pu_bacteria 2906626472 2906633900 360
121 iso_pu_bacteria 2906643746 2906646848 360
122 iso_pu_bacteria 8016583857 8016585819 360
123 3300050510 nmdc:mga06r32_378112_c1 nmdc:mga06r32_378112_c1_24_1115 361
124 iso_pu_bacteria 2547132111 2547406396 361
125 iso_pu_bacteria 2875391855 2875393618 361
126 3300005536 Ga0070697_100062187 Ga0070697_1000621872 362
127 3300009094 Ga0111539_10016137 Ga0111539_100161372 362
128 3300023309 Ga0256744_111471 Ga0256744_1114711 362
129 3300025898 Ga0207692_10169898 Ga0207692_101698981 362
130 3300027907 Ga0207428_10010596 Ga0207428_100105963 362
131 3300031239 Ga0265328_10000169 Ga0265328_100001698 362
132 3300032126 Ga0307415_100018393 Ga0307415_1000183935 362
133 3300044712 Ga0453684_0009524 Ga0453684_0009524_11350_12456 362
134 3300046529 Ga0495652_0001657 Ga0495652_0001657_5457_6578 362
135 3300046680 Ga0495646_0002630 Ga0495646_0002630_1450_2571 362
136 3300049708 Ga0501245_002730 Ga0501245_002730_1137_2225 362
137 3300050511 nmdc:mga08y16_188695_c1 nmdc:mga08y16_188695_c1_242_1357 362
138 3300053077 Ga0495601_0005930 Ga0495601_0005930_1779_2900 362
139 3300054114 Ga0501084_0291616 Ga0501084_0291616_102_1217 362
140 iso_pu_bacteria 2846540461 2846540822 362
141 iso_pu_bacteria 2858902515 2858906971 362
142 3300005435 Ga0070714_100117550 Ga0070714_1001175502 363
143 3300005445 Ga0070708_100232702 Ga0070708_1002327022 363
144 3300005467 Ga0070706_100040032 Ga0070706_1000400323 363
145 3300005468 Ga0070707_100017222 Ga0070707_1000172226 363
146 3300005518 Ga0070699_100001710 Ga0070699_10000171014 363
147 3300005536 Ga0070697_100196941 Ga0070697_1001969412 363
148 3300005577 Ga0068857_100289180 Ga0068857_1002891801 363
149 3300006914 Ga0075436_100101666 Ga0075436_1001016662 363
150 3300025910 Ga0207684_10021038 Ga0207684_100210385 363
151 3300026116 Ga0207674_10175330 Ga0207674_101753301 363
152 3300047320 Ga0495672_0008275 Ga0495672_0008275_3636_4760 363
153 3300005327 Ga0070658_10136463 Ga0070658_101364632 364
154 3300005458 Ga0070681_10222550 Ga0070681_102225501 364
155 3300005530 Ga0070679_100028792 Ga0070679_1000287922 364
156 3300005535 Ga0070684_100001181 Ga0070684_1000011815 364
157 3300005983 Ga0081540_1018978 Ga0081540_10189785 364
158 3300005983 Ga0081540_1024616 Ga0081540_10246163 364
159 3300006038 Ga0075365_10068537 Ga0075365_100685372 364
160 3300006038 Ga0075365_10160355 Ga0075365_101603552 364
161 3300006048 Ga0075363_100013888 Ga0075363_1000138883 364
162 3300006175 Ga0070712_100031683 Ga0070712_1000316833 364
163 3300006178 Ga0075367_10017524 Ga0075367_100175243 364
164 3300006353 Ga0075370_10022063 Ga0075370_100220633 364
165 3300006941 Ga0099825_1035093 Ga0099825_10350932 364
166 3300006942 Ga0099824_1021362 Ga0099824_10213626 364
167 3300007788 Ga0099795_10041616 Ga0099795_100416161 364
168 3300009147 Ga0114129_10334154 Ga0114129_103341541 364
169 3300010159 Ga0099796_10017201 Ga0099796_100172012 364
170 3300010159 Ga0099796_10028938 Ga0099796_100289381 364
171 3300025912 Ga0207707_10125429 Ga0207707_101254292 364
172 3300025915 Ga0207693_10120494 Ga0207693_101204942 364
173 3300025921 Ga0207652_10046500 Ga0207652_100465002 364
174 3300027296 Ga0209389_1000156 Ga0209389_100015651 364
175 3300027296 Ga0209389_1058456 Ga0209389_10584562 364
176 3300027357 Ga0209589_1033185 Ga0209589_10331852 364
177 3300027361 Ga0209489_109778 Ga0209489_10977814 364
178 3300027363 Ga0209700_100030 Ga0209700_10003085 364
179 3300027671 Ga0209588_1002274 Ga0209588_10022747 364
180 3300027671 Ga0209588_1002390 Ga0209588_10023903 364
181 3300035091 Ga0373951_0004318 Ga0373951_0004318_101_1195 364
182 3300036401 Ga0373937_0038394 Ga0373937_0038394_2152_3276 364
183 3300044656 Ga0466969_0018090 Ga0466969_0018090_2303_3436 364
184 3300044658 Ga0466972_0002291 Ga0466972_0002291_523_1656 364
185 3300044683 Ga0466965_0017870 Ga0466965_0017870_243_1376 364
186 3300044684 Ga0466966_0005683 Ga0466966_0005683_4567_5700 364
187 3300044693 Ga0466961_0006243 Ga0466961_0006243_4569_5702 364
188 3300044735 Ga0466968_0007938 Ga0466968_0007938_1896_3029 364
189 3300044842 Ga0466957_0141517 Ga0466957_0141517_22_1305 364
190 3300046462 Ga0495651_0014706 Ga0495651_0014706_4497_5621 364
191 3300046463 Ga0495653_0030246 Ga0495653_0030246_964_2088 364
192 3300046524 Ga0495648_0000325 Ga0495648_0000325_5889_7013 364
193 3300046529 Ga0495652_0276237 Ga0495652_0276237_47_1171 364
194 3300046536 Ga0495587_0082406 Ga0495587_0082406_231_1355 364
195 3300047322 Ga0495680_0050057 Ga0495680_0050057_2039_3163 364
196 3300047443 Ga0495687_003237 Ga0495687_003237_889_2013 364
197 3300049572 Ga0501036_0024376 Ga0501036_0024376_3594_4730 364
198 3300049574 Ga0501038_0201609 Ga0501038_0201609_427_1563 364
199 3300049576 Ga0501040_0007908 Ga0501040_0007908_2871_4007 364
200 3300049580 Ga0501046_0010307 Ga0501046_0010307_1700_2836 364
201 3300049582 Ga0501048_0004852 Ga0501048_0004852_8592_9728 364
202 3300049587 Ga0501071_0023742 Ga0501071_0023742_1710_2846 364
203 3300049588 Ga0501072_0028665 Ga0501072_0028665_1819_2955 364
204 3300049589 Ga0501073_0169346 Ga0501073_0169346_174_1298 364
205 3300049590 Ga0501074_0022742 Ga0501074_0022742_1394_2530 364
206 3300049591 Ga0501075_0019320 Ga0501075_0019320_2645_3781 364
207 3300049592 Ga0501076_0087550 Ga0501076_0087550_692_1828 364
208 3300049593 Ga0501077_0105334 Ga0501077_0105334_45_1181 364
209 3300049741 Ga0501079_0046379 Ga0501079_0046379_2203_3339 364
210 3300049742 Ga0501080_0125467 Ga0501080_0125467_742_1878 364
211 3300049822 Ga0501035_0024150 Ga0501035_0024150_2672_3808 364
212 3300049824 Ga0501045_0079486 Ga0501045_0079486_121_1257 364
213 3300050492 nmdc:mga0yw44_57006_c1 nmdc:mga0yw44_57006_c1_312_1439 364
214 3300053085 Ga0495619_0151138 Ga0495619_0151138_155_1279 364
215 3300060353 Ga0501082_0024163 Ga0501082_0024163_3286_4422 364
216 3300061734 Ga0530510_0040713 Ga0530510_0040713_1150_2286 364
217 iso_pu_bacteria 2545555834 2545675375 364
218 iso_pu_bacteria 2595698237 2596376593 364
219 iso_pu_bacteria 2738541281 2738743045 364
220 iso_pu_bacteria 2738543032 2739356649 364
221 iso_pu_bacteria 2829745981 2829749209 364
222 iso_pu_bacteria 2842698319 2842698333 364
223 iso_pu_bacteria 2861691609 2861695089 364
224 iso_pu_bacteria 2876761206 2876761393 364
225 iso_pu_bacteria 2876761206 2876761399 364
226 iso_pu_bacteria 2889306138 2889306843 364
227 iso_pu_bacteria 2902330777 2902334396 364
228 iso_pu_bacteria 2902405164 2902411532 364
229 iso_pu_bacteria 2928125067 2928128680 364
230 iso_pu_bacteria 3003665799 3003672449 364
231 iso_pu_bacteria 641522639 641646430 364
232 iso_pu_bacteria 643348564 643604704 364
233 3300005844 Ga0068862_100254812 Ga0068862_1002548122 365
234 3300044658 Ga0466972_0045748 Ga0466972_0045748_51_1205 365
235 3300044683 Ga0466965_0000093 Ga0466965_0000093_12149_13303 365
236 3300044684 Ga0466966_0091462 Ga0466966_0091462_646_1800 365
237 3300044693 Ga0466961_0042376 Ga0466961_0042376_990_2144 365
238 3300044694 Ga0466963_0002154 Ga0466963_0002154_7568_8722 365
239 3300044706 Ga0466964_0012694 Ga0466964_0012694_571_1725 365
240 3300044719 Ga0466971_0000380 Ga0466971_0000380_6604_7758 365
241 3300044765 Ga0466970_0000725 Ga0466970_0000725_12894_14048 365
242 3300044842 Ga0466957_0000595 Ga0466957_0000595_16467_17621 365
243 3300045049 Ga0466959_0003287 Ga0466959_0003287_8612_9766 365
244 3300045836 Ga0466958_0079472 Ga0466958_0079472_774_1928 365
245 3300061719 Ga0466962_0000309 Ga0466962_0000309_17232_18386 365
246 iso_pu_bacteria 2912715099 2912715342 365
247 iso_pu_bacteria 8054160619 8054161520 365
248 3300009174 Ga0105241_10008088 Ga0105241_100080886 366
249 3300011119 Ga0105246_10110393 Ga0105246_101103932 366
250 3300013100 Ga0157373_10035928 Ga0157373_100359282 366
251 3300025911 Ga0207654_10015083 Ga0207654_100150833 366
252 3300025981 Ga0207640_10081576 Ga0207640_100815761 366
253 3300005444 Ga0070694_100099849 Ga0070694_1000998491 368
254 3300005545 Ga0070695_100044099 Ga0070695_1000440992 368
255 3300005844 Ga0068862_100115011 Ga0068862_1001150112 368
256 3300009148 Ga0105243_10133607 Ga0105243_101336072 368
257 3300048911 Ga0496108_0418049 Ga0496108_0418049_38_1144 368
258 3300005288 Ga0065714_10064421 Ga0065714_10064421327 369
259 3300005290 Ga0065712_10000131 Ga0065712_100001316 369
260 3300005293 Ga0065715_10000358 Ga0065715_100003584 369
261 3300005330 Ga0070690_100025486 Ga0070690_1000254862 369
262 3300005345 Ga0070692_10031127 Ga0070692_100311271 369
263 3300005364 Ga0070673_100071770 Ga0070673_1000717702 369
264 3300005539 Ga0068853_100489548 Ga0068853_1004895481 369
265 3300005545 Ga0070695_100084717 Ga0070695_1000847172 369
266 3300005563 Ga0068855_100359246 Ga0068855_1003592461 369
267 3300005617 Ga0068859_100011600 Ga0068859_1000116002 369
268 3300005841 Ga0068863_100364823 Ga0068863_1003648231 369
269 3300005842 Ga0068858_100007326 Ga0068858_1000073269 369
270 3300005843 Ga0068860_100019248 Ga0068860_1000192482 369
271 3300005985 Ga0081539_10006157 Ga0081539_100061576 369
272 3300006358 Ga0068871_100151555 Ga0068871_1001515552 369
273 3300006844 Ga0075428_100047958 Ga0075428_1000479583 369
274 3300006852 Ga0075433_10045037 Ga0075433_100450372 369
275 3300006871 Ga0075434_100248186 Ga0075434_1002481862 369
276 3300006931 Ga0097620_100011600 Ga0097620_1000116002 369
277 3300009101 Ga0105247_10000076 Ga0105247_1000007628 369
278 3300009174 Ga0105241_10070143 Ga0105241_100701433 369
279 3300009545 Ga0105237_10015534 Ga0105237_100155342 369
280 3300010375 Ga0105239_10161497 Ga0105239_101614972 369
281 3300011119 Ga0105246_10060558 Ga0105246_100605582 369
282 3300013100 Ga0157373_10176861 Ga0157373_101768611 369
283 3300013307 Ga0157372_10560014 Ga0157372_105600141 369
284 3300025900 Ga0207710_10001319 Ga0207710_100013198 369
285 3300025901 Ga0207688_10010827 Ga0207688_100108273 369
286 3300025911 Ga0207654_10135440 Ga0207654_101354401 369
287 3300025914 Ga0207671_10038678 Ga0207671_100386782 369
288 3300025918 Ga0207662_10032797 Ga0207662_100327972 369
289 3300025923 Ga0207681_10121272 Ga0207681_101212722 369
290 3300025940 Ga0207691_10100902 Ga0207691_101009022 369
291 3300025942 Ga0207689_10145752 Ga0207689_101457522 369
292 3300025960 Ga0207651_10163072 Ga0207651_101630721 369
293 3300026035 Ga0207703_10024782 Ga0207703_100247823 369
294 3300028381 Ga0268264_10061035 Ga0268264_100610352 369
295 3300031548 Ga0307408_100002777 Ga0307408_1000027773 369
296 3300031731 Ga0307405_10032746 Ga0307405_100327462 369
297 3300031824 Ga0307413_10109454 Ga0307413_101094542 369
298 3300031852 Ga0307410_10004439 Ga0307410_100044392 369
299 3300031901 Ga0307406_10000896 Ga0307406_100008966 369
300 3300031903 Ga0307407_10128002 Ga0307407_101280022 369
301 3300031911 Ga0307412_10003108 Ga0307412_100031083 369
302 3300032002 Ga0307416_100003558 Ga0307416_1000035583 369
303 3300032004 Ga0307414_10002142 Ga0307414_100021422 369
304 3300032005 Ga0307411_10015410 Ga0307411_100154102 369
305 3300032126 Ga0307415_100001435 Ga0307415_1000014354 369
306 3300038443 Ga0395901_0246597 Ga0395901_0246597_456_1565 369
307 3300038699 Ga0242422_00565 Ga0242422_00565_140_1258 369
308 3300045051 Ga0451576_0106891 Ga0451576_0106891_1353_2471 369
309 3300049649 Ga0501198_000274 Ga0501198_000274_614_1723 369
310 3300049654 Ga0501207_001440 Ga0501207_001440_591_1700 369
311 3300049655 Ga0501208_001345 Ga0501208_001345_154_1263 369
312 3300049660 Ga0501216_000230 Ga0501216_000230_3098_4207 369
313 3300049661 Ga0501217_000039 Ga0501217_000039_3905_5014 369
314 3300049663 Ga0501223_000150 Ga0501223_000150_5743_6852 369
315 3300049664 Ga0501224_000097 Ga0501224_000097_1665_2774 369
316 3300049665 Ga0501227_000008 Ga0501227_000008_3961_5070 369
317 3300049669 Ga0501235_000524 Ga0501235_000524_710_1819 369
318 3300049672 Ga0501239_001513 Ga0501239_001513_434_1543 369
319 3300049673 Ga0501240_000091 Ga0501240_000091_2397_3506 369
320 3300049676 Ga0501246_002265 Ga0501246_002265_122_1231 369
321 3300049680 Ga0501250_001378 Ga0501250_001378_727_1836 369
322 3300049683 Ga0501253_003777 Ga0501253_003777_727_1836 369
323 3300049686 Ga0501257_007522 Ga0501257_007522_828_1937 369
324 3300049688 Ga0501259_002419 Ga0501259_002419_711_1820 369
325 3300049705 Ga0501225_0000089 Ga0501225_0000089_8121_9230 369
326 3300049706 Ga0501229_000810 Ga0501229_000810_1381_2490 369
327 3300049707 Ga0501234_000675 Ga0501234_000675_2626_3735 369
328 3300049765 Ga0501268_007772 Ga0501268_007772_238_1347 369
329 3300049770 Ga0501273_001470 Ga0501273_001470_102_1211 369
330 3300049850 Ga0501204_002303 Ga0501204_002303_144_1253 369
331 3300049851 Ga0501212_012936 Ga0501212_012936_35_1144 369
332 3300049853 Ga0501226_000541 Ga0501226_000541_2330_3439 369
333 3300050507 nmdc:mga05p37_31603_c1 nmdc:mga05p37_31603_c1_4269_5378 369

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u1r-assembly1.cif.gz_A sxtg an amidinotransferase from the microseira wollei in saxitoxin biosynthetic pathway 0.9701 14 363
5wpi-assembly1.cif.gz_B the virulence-associated protein hsva from the fire blight pathogen erwinia amylovora is a polyamine amidinotransferase 0.9664 1 363
4jdw-assembly1.cif.gz_A-2 crystal structure and mechanism of l-arginine: glycine amidinotransferase: a mitochondrial enzyme involved in creatine biosynthesis 0.9661 14 363
6u1r-assembly1.cif.gz_B sxtg an amidinotransferase from the microseira wollei in saxitoxin biosynthetic pathway 0.9636 14 363
5wpi-assembly1.cif.gz_B the virulence-associated protein hsva from the fire blight pathogen erwinia amylovora is a polyamine amidinotransferase 0.9612 1 363
ID Description Score Start End Superfamily
5wpiB00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9664 1 363 3.75.10.10
5wpiB00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9612 1 363 3.75.10.10
2jdxA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9498 14 363 3.75.10.10
2jdxA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9237 14 363 3.75.10.10
1bwdB00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9006 16 365 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A1G5QZ40-F1-model_v4 Glycine amidinotransferase 0.9948 246 364 GO:0006601
GO:0015068
AF-A0A7D9MP17-F1-model_v4 deleted 0.993 117 174
AF-A0A1S8WN21-F1-model_v4 Glycine amidinotransferase (EC 2.1.4.1) (L-arginine:glycine amidinotransferase) 0.9929 303 363 GO:0005743
GO:0005758
GO:0006601
GO:0015068
AF-A0A523XRU7-F1-model_v4 Serine/threonine protein kinase 0.9922 297 363 GO:0006601
GO:0015068
AF-A0A3S1AIF3-F1-model_v4 Glycine amidinotransferase 0.9921 297 363 GO:0006601
GO:0015068

Feature Viewer

pLDDT pTM Quality
90.29 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map