F411536

General Info

Members Datasets Scaffolds Average Seq Length
333 184 666 122

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0966593|Ga0501031_0966593_130_534
Length 134
Sequence LNAPDLETLPGIPRGEDGPVFREPWEAQAFAMAVALHARGAFTWGEWAAALAAEIKAAQAAGDPDTGENYYRHWLAALEKLASAKKLTDPAELQGRKDQWDRAARATPHGQPIALANDPLANNARAKDLAARRR

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
83 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
84 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
92 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
93 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
166 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
167 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
168 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
169 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
172 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
173 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
180 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.3
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.62
Nodule 0
Rhizoplane 3.3
Rhizosphere 76.58
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0966593 3300049568 Unclassified 545
2 JGI25151J46595_10000429 3300003187 Bacteria 41718
3 JGI25153J46596_10000046 3300003215 Bacteria 148355
4 rootL2_10218029 3300003322 Bacteria 1057
5 JGI25160J50197_1017433 3300003354 Bacteria 2275
6 Ga0055531_10006374 3300003794 Bacteria 6711
7 Ga0070683_100765306 3300005329 Unclassified 925
8 Ga0070660_100209589 3300005339 Bacteria 1582
9 Ga0070689_100664576 3300005340 Bacteria 907
10 Ga0070689_102142864 3300005340 Bacteria 512
11 Ga0070667_100849851 3300005367 Bacteria 848
12 Ga0070708_100114651 3300005445 Bacteria 2480
13 Ga0070663_100019526 3300005455 Bacteria 4469
14 Ga0070706_100639234 3300005467 Bacteria 988
15 Ga0070707_102008510 3300005468 Bacteria 546
16 Ga0070699_101057632 3300005518 Unclassified 744
17 Ga0070697_100764846 3300005536 Bacteria 854
18 Ga0068853_100086797 3300005539 Bacteria 2745
19 Ga0070693_100684519 3300005547 Bacteria 749
20 Ga0068855_100035164 3300005563 Bacteria 5967
21 Ga0068852_100002373 3300005616 Bacteria 12970
22 Ga0068864_100582596 3300005618 Bacteria 1084
23 Ga0068863_100699573 3300005841 Bacteria 1007
24 Ga0068860_100111803 3300005843 Bacteria 2612
25 Ga0068862_100026823 3300005844 Bacteria 4845
26 Ga0081455_10458775 3300005937 Bacteria 868
27 Ga0081539_10000083 3300005985 Bacteria 218881
28 Ga0081539_10087801 3300005985 Bacteria 1615
29 Ga0075363_100109888 3300006048 Bacteria 1532
30 Ga0075428_100000929 3300006844 Bacteria 30978
31 Ga0075428_100002581 3300006844 Bacteria 19672
32 Ga0075428_100586343 3300006844 Bacteria 1191
33 Ga0075428_100918613 3300006844 Bacteria 928
34 Ga0075428_101631866 3300006844 Unclassified 674
35 Ga0075430_100077195 3300006846 Bacteria 2792
36 Ga0075430_100520011 3300006846 Bacteria 982
37 Ga0075431_100004023 3300006847 Bacteria 14329
38 Ga0075431_100013085 3300006847 Bacteria 8380
39 Ga0075431_100068462 3300006847 Bacteria 3664
40 Ga0075433_10004787 3300006852 Bacteria 10563
41 Ga0075433_10150538 3300006852 Bacteria 2070
42 Ga0075434_100371037 3300006871 Bacteria 1452
43 Ga0075429_100006614 3300006880 Bacteria 10040
44 Ga0075429_100272649 3300006880 Bacteria 1482
45 Ga0075429_101553007 3300006880 Bacteria 576
46 Ga0075436_100000874 3300006914 Bacteria 20002
47 Ga0075435_100243461 3300007076 Unclassified 1530
48 Ga0099794_10071893 3300007265 Bacteria 1695
49 Ga0099794_10094439 3300007265 Bacteria 1487
50 Ga0099794_10212004 3300007265 Bacteria 993
51 Ga0105251_10283534 3300009011 Bacteria 749
52 Ga0105247_10164187 3300009101 Bacteria 1472
53 Ga0114129_10005235 3300009147 Bacteria 18276
54 Ga0114129_10015155 3300009147 Bacteria 10973
55 Ga0114129_10047294 3300009147 Bacteria 6046
56 Ga0114129_10049195 3300009147 Bacteria 5924
57 Ga0105238_10038920 3300009551 Bacteria 4827
58 Ga0105035_110428 3300009988 Bacteria 815
59 Ga0105246_12152947 3300011119 Bacteria 542
60 Ga0157369_10002483 3300013105 Bacteria 22088
61 Ga0157372_10007768 3300013307 Bacteria 11389
62 Ga0163163_10017389 3300014325 Bacteria 6705
63 Ga0157379_11426022 3300014968 Bacteria 672
64 Ga0206353_11779100 3300020082 Bacteria 714
65 Ga0213874_10235843 3300021377 Bacteria 670
66 Ga0213875_10008830 3300021388 Bacteria 5143
67 Ga0209148_1001059 3300025254 Bacteria 16929
68 Ga0209455_1000236 3300025272 Bacteria 69542
69 Ga0209130_1000461 3300025284 Bacteria 42274
70 Ga0209675_1000469 3300025291 Bacteria 30957
71 Ga0209025_1000282 3300025294 Bacteria 115627
72 Ga0209758_1000005 3300025297 Bacteria 1368918
73 Ga0209758_1049400 3300025297 Bacteria 1486
74 Ga0209758_1060787 3300025297 Bacteria 1248
75 Ga0209758_1088174 3300025297 Bacteria 917
76 Ga0209758_1138803 3300025297 Bacteria 633
77 Ga0207426_1000474 3300025302 Bacteria 61569
78 Ga0209051_1031184 3300025303 Bacteria 2056
79 Ga0209257_1000504 3300025304 Bacteria 68999
80 Ga0207710_10261353 3300025900 Bacteria 867
81 Ga0207646_11647957 3300025922 Bacteria 552
82 Ga0207694_11543217 3300025924 Bacteria 560
83 Ga0207690_10257749 3300025932 Unclassified 1350
84 Ga0207661_10576734 3300025944 Bacteria 1032
85 Ga0207667_10044683 3300025949 Bacteria 4693
86 Ga0207703_10512900 3300026035 Bacteria 1127
87 Ga0207639_10785967 3300026041 Bacteria 886
88 Ga0207678_10091505 3300026067 Bacteria 2600
89 Ga0207641_10653523 3300026088 Bacteria 1033
90 Ga0207676_10637438 3300026095 Bacteria 1027
91 Ga0207698_10010187 3300026142 Bacteria 6025
92 Ga0209588_1122920 3300027671 Bacteria 830
93 Ga0268265_10006503 3300028380 Bacteria 7920
94 Ga0268264_10157638 3300028381 Bacteria 2041
95 Ga0265327_10027828 3300031251 Bacteria 3246
96 Ga0307513_10048621 3300031456 Bacteria 4602
97 Ga0316576_10048207 3300031727 Bacteria 3089
98 Ga0307516_10371122 3300031730 Bacteria 1094
99 Ga0307406_12078380 3300031901 Bacteria 509
100 Ga0307415_100801353 3300032126 Bacteria 860
101 Ga0307510_10285481 3300033180 Bacteria 1119
102 Ga0373936_0254029 3300035113 Bacteria 786
103 Ga0316574_0000092 3300035398 Bacteria 25814
104 Ga0373947_0623780 3300035725 Bacteria 735
105 Ga0316584_0279172 3300036712 Bacteria 1214
106 Ga0373925_0377731 3300037068 Bacteria 1154
107 Ga0395900_0203386 3300037418 Bacteria 2003
108 Ga0395900_0405088 3300037418 Bacteria 1327
109 Ga0395900_1149156 3300037418 Bacteria 693
110 Ga0436364_1238052 3300037853 Bacteria 1476
111 Ga0436364_1444387 3300037853 Bacteria 1392
112 Ga0436364_1466398 3300037853 Bacteria 902
113 Ga0436364_1526522 3300037853 Bacteria 845
114 Ga0395901_0915282 3300038443 Bacteria 858
115 Ga0436365_0509983 3300039437 Bacteria 884
116 Ga0436365_1355104 3300039437 Unclassified 762
117 Ga0436363_0919339 3300039450 Bacteria 1800
118 Ga0451789_0410505 3300041443 Bacteria 580
119 Ga0451849_0011685 3300041505 Unclassified 762
120 Ga0439431_0154830 3300041997 Bacteria 653
121 Ga0466966_0060206 3300044684 Bacteria 2397
122 Ga0466971_0137890 3300044719 Bacteria 1135
123 Ga0466970_0550208 3300044765 Bacteria 667
124 Ga0466957_0281138 3300044842 Bacteria 1114
125 Ga0466957_1268328 3300044842 Bacteria 534
126 Ga0466959_0026066 3300045049 Bacteria 4335
127 Ga0466958_0326927 3300045836 Bacteria 986
128 Ga0495638_0043134 3300046460 Bacteria 2847
129 Ga0495582_0387024 3300046473 Bacteria 806
130 Ga0495606_0252334 3300046507 Bacteria 978
131 Ga0495610_0028488 3300046512 Bacteria 2953
132 Ga0495616_0211939 3300046513 Unclassified 847
133 Ga0495630_0504973 3300046517 Bacteria 927
134 Ga0495642_0444343 3300046528 Bacteria 573
135 Ga0495624_0558572 3300046690 Bacteria 683
136 Ga0495581_0138160 3300047315 Bacteria 1421
137 Ga0495686_0113294 3300047472 Bacteria 1624
138 Ga0496101_1350076 3300048904 Bacteria 557
139 Ga0496104_0005437 3300048907 Bacteria 11148
140 Ga0496109_0122947 3300048912 Bacteria 2418
141 Ga0496110_0038424 3300048913 Bacteria 4165
142 Ga0496111_0093089 3300048914 Bacteria 2209
143 Ga0496111_0166267 3300048914 Bacteria 1638
144 Ga0496112_0024469 3300048915 Bacteria 5782
145 Ga0496113_0005139 3300048916 Bacteria 8134
146 Ga0496114_0113719 3300048917 Bacteria 2321
147 Ga0496115_0330042 3300048918 Bacteria 1246
148 Ga0501031_0191473 3300049568 Bacteria 1336
149 Ga0501032_0010900 3300049569 Bacteria 6535
150 Ga0501032_1054461 3300049569 Bacteria 510
151 Ga0501033_0002085 3300049570 Bacteria 17322
152 Ga0501033_0030037 3300049570 Bacteria 4084
153 Ga0501033_0226018 3300049570 Bacteria 1331
154 Ga0501034_0129924 3300049571 Bacteria 2503
155 Ga0501034_0543129 3300049571 Bacteria 1072
156 Ga0501034_0813333 3300049571 Unclassified 826
157 Ga0501034_0942985 3300049571 Bacteria 749
158 Ga0501034_1323939 3300049571 Bacteria 597
159 Ga0501036_0010640 3300049572 Bacteria 7600
160 Ga0501036_0174186 3300049572 Bacteria 1812
161 Ga0501036_0188987 3300049572 Bacteria 1733
162 Ga0501036_0497931 3300049572 Bacteria 1014
163 Ga0501036_0630999 3300049572 Bacteria 888
164 Ga0501036_0929166 3300049572 Bacteria 713
165 Ga0501037_0001979 3300049573 Bacteria 14829
166 Ga0501037_0233879 3300049573 Bacteria 1290
167 Ga0501037_0294526 3300049573 Bacteria 1128
168 Ga0501037_0403420 3300049573 Bacteria 937
169 Ga0501037_0562195 3300049573 Bacteria 769
170 Ga0501037_0572797 3300049573 Bacteria 760
171 Ga0501037_0589131 3300049573 Bacteria 748
172 Ga0501038_0002227 3300049574 Bacteria 18051
173 Ga0501038_0061469 3300049574 Bacteria 3212
174 Ga0501038_0151598 3300049574 Bacteria 1889
175 Ga0501038_0314671 3300049574 Bacteria 1226
176 Ga0501038_0475404 3300049574 Bacteria 958
177 Ga0501039_0052213 3300049575 Bacteria 3163
178 Ga0501039_0099600 3300049575 Bacteria 2268
179 Ga0501039_0301478 3300049575 Bacteria 1260
180 Ga0501040_0050443 3300049576 Bacteria 2847
181 Ga0501040_0325796 3300049576 Bacteria 1099
182 Ga0501041_0282624 3300049577 Bacteria 1044
183 Ga0501042_0023568 3300049578 Bacteria 4309
184 Ga0501042_0143469 3300049578 Bacteria 1722
185 Ga0501043_0010154 3300049579 Bacteria 7381
186 Ga0501043_0048476 3300049579 Bacteria 3339
187 Ga0501043_0341624 3300049579 Bacteria 1139
188 Ga0501043_0388868 3300049579 Bacteria 1055
189 Ga0501046_0009240 3300049580 Bacteria 8534
190 Ga0501046_0037679 3300049580 Bacteria 3885
191 Ga0501046_0411549 3300049580 Unclassified 976
192 Ga0501047_0017854 3300049581 Bacteria 6797
193 Ga0501047_0054556 3300049581 Bacteria 3866
194 Ga0501047_0098444 3300049581 Bacteria 2803
195 Ga0501047_0526449 3300049581 Unclassified 1007
196 Ga0501048_0007214 3300049582 Bacteria 8438
197 Ga0501048_0549712 3300049582 Bacteria 828
198 Ga0501048_0775196 3300049582 Bacteria 689
199 Ga0501067_0010828 3300049583 Bacteria 5046
200 Ga0501067_0225827 3300049583 Bacteria 1043
201 Ga0501067_0447594 3300049583 Unclassified 721
202 Ga0501067_0542500 3300049583 Bacteria 651
203 Ga0501068_0012162 3300049584 Bacteria 4866
204 Ga0501068_0359043 3300049584 Bacteria 937
205 Ga0501069_0053304 3300049585 Bacteria 2252
206 Ga0501069_0064071 3300049585 Bacteria 2054
207 Ga0501069_0423204 3300049585 Unclassified 790
208 Ga0501069_0890559 3300049585 Bacteria 541
209 Ga0501070_0003344 3300049586 Bacteria 13925
210 Ga0501070_0013371 3300049586 Bacteria 6921
211 Ga0501070_0037378 3300049586 Bacteria 4054
212 Ga0501070_0126780 3300049586 Bacteria 2109
213 Ga0501070_0300752 3300049586 Unclassified 1307
214 Ga0501070_0322175 3300049586 Bacteria 1257
215 Ga0501070_0694795 3300049586 Bacteria 805
216 Ga0501071_0256704 3300049587 Bacteria 1320
217 Ga0501071_0979407 3300049587 Unclassified 653
218 Ga0501072_0136364 3300049588 Bacteria 1956
219 Ga0501072_0224748 3300049588 Unclassified 1496
220 Ga0501072_1335935 3300049588 Bacteria 555
221 Ga0501073_0003577 3300049589 Bacteria 11689
222 Ga0501073_0005205 3300049589 Bacteria 9751
223 Ga0501073_0126278 3300049589 Bacteria 1773
224 Ga0501073_0209715 3300049589 Bacteria 1346
225 Ga0501073_0375652 3300049589 Bacteria 982
226 Ga0501073_0927117 3300049589 Bacteria 600
227 Ga0501074_0002402 3300049590 Bacteria 13062
228 Ga0501074_0010115 3300049590 Bacteria 6849
229 Ga0501074_0296355 3300049590 Bacteria 1149
230 Ga0501074_0490365 3300049590 Bacteria 871
231 Ga0501075_0093976 3300049591 Bacteria 2276
232 Ga0501076_0005340 3300049592 Bacteria 9227
233 Ga0501076_0015233 3300049592 Bacteria 5809
234 Ga0501076_0524582 3300049592 Bacteria 976
235 Ga0501077_0010643 3300049593 Bacteria 5729
236 Ga0501077_0307833 3300049593 Bacteria 1010
237 Ga0501079_0001937 3300049741 Bacteria 14816
238 Ga0501079_0036379 3300049741 Bacteria 3793
239 Ga0501079_0269173 3300049741 Bacteria 1332
240 Ga0501079_0396018 3300049741 Unclassified 1083
241 Ga0501079_0439584 3300049741 Bacteria 1024
242 Ga0501080_0009780 3300049742 Bacteria 8760
243 Ga0501080_0059518 3300049742 Bacteria 3554
244 Ga0501080_0072705 3300049742 Bacteria 3199
245 Ga0501080_0207917 3300049742 Bacteria 1794
246 Ga0501080_0253047 3300049742 Bacteria 1606
247 Ga0501080_0404089 3300049742 Bacteria 1229
248 Ga0501080_0462140 3300049742 Bacteria 1137
249 Ga0501080_0577146 3300049742 Bacteria 1000
250 Ga0501080_0957119 3300049742 Bacteria 744
251 Ga0501080_1424397 3300049742 Bacteria 591
252 Ga0501081_0045264 3300049743 Bacteria 3022
253 Ga0501083_0028252 3300049744 Bacteria 3867
254 Ga0501083_0039718 3300049744 Bacteria 3195
255 Ga0501083_0481457 3300049744 Bacteria 808
256 Ga0501035_0001302 3300049822 Bacteria 25776
257 Ga0501035_0007872 3300049822 Bacteria 9959
258 Ga0501035_0064864 3300049822 Bacteria 3245
259 Ga0501035_0251960 3300049822 Bacteria 1499
260 Ga0501044_0002579 3300049823 Bacteria 20621
261 Ga0501044_0019987 3300049823 Bacteria 7151
262 Ga0501044_0030532 3300049823 Bacteria 5679
263 Ga0501044_0038066 3300049823 Bacteria 5023
264 Ga0501044_0083925 3300049823 Bacteria 3220
265 Ga0501044_0193659 3300049823 Bacteria 1994
266 Ga0501044_0317077 3300049823 Bacteria 1484
267 Ga0501044_0630330 3300049823 Bacteria 963
268 Ga0501044_1169638 3300049823 Bacteria 637
269 nmdc:mga03n38_40881_c1 3300050490 Bacteria 2017
270 nmdc:mga05p37_42502_c1 3300050507 Bacteria 5585
271 nmdc:mga05p37_5623_c1 3300050507 Bacteria 14730
272 nmdc:mga05p37_74819_c1 3300050507 Bacteria 4169
273 nmdc:mga09592_189768_c1 3300050508 Bacteria 1779
274 nmdc:mga09592_32880_c1 3300050508 Bacteria 4325
275 nmdc:mga09592_47411_c1 3300050508 Bacteria 3621
276 nmdc:mga0qj67_184828_c1 3300050509 Bacteria 1693
277 nmdc:mga06r32_13289_c1 3300050510 Bacteria 7455
278 nmdc:mga06r32_190081_c1 3300050510 Bacteria 2041
279 nmdc:mga06r32_9598_c1 3300050510 Bacteria 8742
280 nmdc:mga0n895_419997_c1 3300050512 Bacteria 1352
281 nmdc:mga0n895_44305_c1 3300050512 Bacteria 4339
282 nmdc:mga0rr50_6862_c1 3300050513 Bacteria 6980
283 nmdc:mga08x19_13929_c1 3300050514 Bacteria 4872
284 nmdc:mga0a205_16365_c1 3300050515 Bacteria 6948
285 nmdc:mga0a205_323452_c1 3300050515 Bacteria 1413
286 Ga0500635_0001007 3300053080 Bacteria 6744
287 Ga0500643_069490 3300053087 Bacteria 979
288 Ga0500644_0069988 3300053088 Unclassified 1262
289 Ga0500646_0042736 3300053090 Unclassified 1281
290 Ga0500651_0020152 3300053093 Bacteria 4149
291 Ga0500651_0112515 3300053093 Bacteria 1660
292 Ga0500651_0480981 3300053093 Unclassified 687
293 Ga0500566_0102909 3300053094 Bacteria 1563
294 Ga0500641_0001655 3300053096 Bacteria 7938
295 Ga0500650_0264710 3300053098 Bacteria 768
296 Ga0500650_0475033 3300053098 Unclassified 534
297 Ga0500555_001445 3300053103 Bacteria 7280
298 Ga0500556_0329640 3300053104 Unclassified 593
299 Ga0500594_0102780 3300053118 Bacteria 881
300 Ga0500595_002778 3300053119 Bacteria 8434
301 Ga0500642_0003483 3300053130 Bacteria 4767
302 Ga0500652_001217 3300053131 Bacteria 8211
303 Ga0500658_0001966 3300053134 Bacteria 8033
304 Ga0500658_0080053 3300053134 Bacteria 1395
305 Ga0500658_0329933 3300053134 Bacteria 701
306 Ga0500568_0004207 3300053139 Bacteria 7756
307 Ga0500568_0116191 3300053139 Bacteria 998
308 Ga0500568_0186510 3300053139 Unclassified 762
309 Ga0500577_0018775 3300053142 Bacteria 2229
310 Ga0500577_0195104 3300053142 Bacteria 872
311 Ga0500588_0018688 3300053146 Bacteria 1830
312 Ga0500588_0046486 3300053146 Bacteria 1334
313 Ga0500588_0208481 3300053146 Unclassified 726
314 Ga0500616_0000686 3300053153 Bacteria 39652
315 Ga0500622_0228805 3300053156 Bacteria 829
316 Ga0500627_0326506 3300053158 Bacteria 666
317 Ga0500609_001713 3300053731 Bacteria 3189
318 Ga0500609_004141 3300053731 Bacteria 2017
319 Ga0501084_0005893 3300054114 Bacteria 10088
320 Ga0501084_0043682 3300054114 Bacteria 3749
321 Ga0501084_0203419 3300054114 Bacteria 1671
322 Ga0501084_1540477 3300054114 Bacteria 556
323 Ga0501082_0068452 3300060353 Bacteria 3056
324 Ga0501082_0148549 3300060353 Bacteria 2035
325 Ga0501082_0216621 3300060353 Bacteria 1666
326 Ga0501082_0247008 3300060353 Bacteria 1553
327 Ga0501082_0631663 3300060353 Unclassified 937
328 Ga0501082_1029662 3300060353 Bacteria 720
329 Ga0530510_0000864 3300061734 Bacteria 19984
330 Ga0530510_0001540 3300061734 Bacteria 15553
331 Ga0530510_0043980 3300061734 Bacteria 3227
332 Ga0530510_0195926 3300061734 Bacteria 1500
333 2844536653 2844533157 Bacteria 7517899
334 Ga0501031_0966593
335 JGI25151J46595_10000429
336 JGI25153J46596_10000046
337 rootL2_10218029
338 JGI25160J50197_1017433
339 Ga0055531_10006374
340 Ga0070683_100765306
341 Ga0070660_100209589
342 Ga0070689_100664576
343 Ga0070689_102142864
344 Ga0070667_100849851
345 Ga0070708_100114651
346 Ga0070663_100019526
347 Ga0070706_100639234
348 Ga0070707_102008510
349 Ga0070699_101057632
350 Ga0070697_100764846
351 Ga0068853_100086797
352 Ga0070693_100684519
353 Ga0068855_100035164
354 Ga0068852_100002373
355 Ga0068864_100582596
356 Ga0068863_100699573
357 Ga0068860_100111803
358 Ga0068862_100026823
359 Ga0081455_10458775
360 Ga0081539_10000083
361 Ga0081539_10087801
362 Ga0075363_100109888
363 Ga0075428_100000929
364 Ga0075428_100002581
365 Ga0075428_100586343
366 Ga0075428_100918613
367 Ga0075428_101631866
368 Ga0075430_100077195
369 Ga0075430_100520011
370 Ga0075431_100004023
371 Ga0075431_100013085
372 Ga0075431_100068462
373 Ga0075433_10004787
374 Ga0075433_10150538
375 Ga0075434_100371037
376 Ga0075429_100006614
377 Ga0075429_100272649
378 Ga0075429_101553007
379 Ga0075436_100000874
380 Ga0075435_100243461
381 Ga0099794_10071893
382 Ga0099794_10094439
383 Ga0099794_10212004
384 Ga0105251_10283534
385 Ga0105247_10164187
386 Ga0114129_10005235
387 Ga0114129_10015155
388 Ga0114129_10047294
389 Ga0114129_10049195
390 Ga0105238_10038920
391 Ga0105035_110428
392 Ga0105246_12152947
393 Ga0157369_10002483
394 Ga0157372_10007768
395 Ga0163163_10017389
396 Ga0157379_11426022
397 Ga0206353_11779100
398 Ga0213874_10235843
399 Ga0213875_10008830
400 Ga0209148_1001059
401 Ga0209455_1000236
402 Ga0209130_1000461
403 Ga0209675_1000469
404 Ga0209025_1000282
405 Ga0209758_1000005
406 Ga0209758_1049400
407 Ga0209758_1060787
408 Ga0209758_1088174
409 Ga0209758_1138803
410 Ga0207426_1000474
411 Ga0209051_1031184
412 Ga0209257_1000504
413 Ga0207710_10261353
414 Ga0207646_11647957
415 Ga0207694_11543217
416 Ga0207690_10257749
417 Ga0207661_10576734
418 Ga0207667_10044683
419 Ga0207703_10512900
420 Ga0207639_10785967
421 Ga0207678_10091505
422 Ga0207641_10653523
423 Ga0207676_10637438
424 Ga0207698_10010187
425 Ga0209588_1122920
426 Ga0268265_10006503
427 Ga0268264_10157638
428 Ga0265327_10027828
429 Ga0307513_10048621
430 Ga0316576_10048207
431 Ga0307516_10371122
432 Ga0307406_12078380
433 Ga0307415_100801353
434 Ga0307510_10285481
435 Ga0373936_0254029
436 Ga0316574_0000092
437 Ga0373947_0623780
438 Ga0316584_0279172
439 Ga0373925_0377731
440 Ga0395900_0203386
441 Ga0395900_0405088
442 Ga0395900_1149156
443 Ga0436364_1238052
444 Ga0436364_1444387
445 Ga0436364_1466398
446 Ga0436364_1526522
447 Ga0395901_0915282
448 Ga0436365_0509983
449 Ga0436365_1355104
450 Ga0436363_0919339
451 Ga0451789_0410505
452 Ga0451849_0011685
453 Ga0439431_0154830
454 Ga0466966_0060206
455 Ga0466971_0137890
456 Ga0466970_0550208
457 Ga0466957_0281138
458 Ga0466957_1268328
459 Ga0466959_0026066
460 Ga0466958_0326927
461 Ga0495638_0043134
462 Ga0495582_0387024
463 Ga0495606_0252334
464 Ga0495610_0028488
465 Ga0495616_0211939
466 Ga0495630_0504973
467 Ga0495642_0444343
468 Ga0495624_0558572
469 Ga0495581_0138160
470 Ga0495686_0113294
471 Ga0496101_1350076
472 Ga0496104_0005437
473 Ga0496109_0122947
474 Ga0496110_0038424
475 Ga0496111_0093089
476 Ga0496111_0166267
477 Ga0496112_0024469
478 Ga0496113_0005139
479 Ga0496114_0113719
480 Ga0496115_0330042
481 Ga0501031_0191473
482 Ga0501032_0010900
483 Ga0501032_1054461
484 Ga0501033_0002085
485 Ga0501033_0030037
486 Ga0501033_0226018
487 Ga0501034_0129924
488 Ga0501034_0543129
489 Ga0501034_0813333
490 Ga0501034_0942985
491 Ga0501034_1323939
492 Ga0501036_0010640
493 Ga0501036_0174186
494 Ga0501036_0188987
495 Ga0501036_0497931
496 Ga0501036_0630999
497 Ga0501036_0929166
498 Ga0501037_0001979
499 Ga0501037_0233879
500 Ga0501037_0294526
501 Ga0501037_0403420
502 Ga0501037_0562195
503 Ga0501037_0572797
504 Ga0501037_0589131
505 Ga0501038_0002227
506 Ga0501038_0061469
507 Ga0501038_0151598
508 Ga0501038_0314671
509 Ga0501038_0475404
510 Ga0501039_0052213
511 Ga0501039_0099600
512 Ga0501039_0301478
513 Ga0501040_0050443
514 Ga0501040_0325796
515 Ga0501041_0282624
516 Ga0501042_0023568
517 Ga0501042_0143469
518 Ga0501043_0010154
519 Ga0501043_0048476
520 Ga0501043_0341624
521 Ga0501043_0388868
522 Ga0501046_0009240
523 Ga0501046_0037679
524 Ga0501046_0411549
525 Ga0501047_0017854
526 Ga0501047_0054556
527 Ga0501047_0098444
528 Ga0501047_0526449
529 Ga0501048_0007214
530 Ga0501048_0549712
531 Ga0501048_0775196
532 Ga0501067_0010828
533 Ga0501067_0225827
534 Ga0501067_0447594
535 Ga0501067_0542500
536 Ga0501068_0012162
537 Ga0501068_0359043
538 Ga0501069_0053304
539 Ga0501069_0064071
540 Ga0501069_0423204
541 Ga0501069_0890559
542 Ga0501070_0003344
543 Ga0501070_0013371
544 Ga0501070_0037378
545 Ga0501070_0126780
546 Ga0501070_0300752
547 Ga0501070_0322175
548 Ga0501070_0694795
549 Ga0501071_0256704
550 Ga0501071_0979407
551 Ga0501072_0136364
552 Ga0501072_0224748
553 Ga0501072_1335935
554 Ga0501073_0003577
555 Ga0501073_0005205
556 Ga0501073_0126278
557 Ga0501073_0209715
558 Ga0501073_0375652
559 Ga0501073_0927117
560 Ga0501074_0002402
561 Ga0501074_0010115
562 Ga0501074_0296355
563 Ga0501074_0490365
564 Ga0501075_0093976
565 Ga0501076_0005340
566 Ga0501076_0015233
567 Ga0501076_0524582
568 Ga0501077_0010643
569 Ga0501077_0307833
570 Ga0501079_0001937
571 Ga0501079_0036379
572 Ga0501079_0269173
573 Ga0501079_0396018
574 Ga0501079_0439584
575 Ga0501080_0009780
576 Ga0501080_0059518
577 Ga0501080_0072705
578 Ga0501080_0207917
579 Ga0501080_0253047
580 Ga0501080_0404089
581 Ga0501080_0462140
582 Ga0501080_0577146
583 Ga0501080_0957119
584 Ga0501080_1424397
585 Ga0501081_0045264
586 Ga0501083_0028252
587 Ga0501083_0039718
588 Ga0501083_0481457
589 Ga0501035_0001302
590 Ga0501035_0007872
591 Ga0501035_0064864
592 Ga0501035_0251960
593 Ga0501044_0002579
594 Ga0501044_0019987
595 Ga0501044_0030532
596 Ga0501044_0038066
597 Ga0501044_0083925
598 Ga0501044_0193659
599 Ga0501044_0317077
600 Ga0501044_0630330
601 Ga0501044_1169638
602 nmdc:mga03n38_40881_c1
603 nmdc:mga05p37_42502_c1
604 nmdc:mga05p37_5623_c1
605 nmdc:mga05p37_74819_c1
606 nmdc:mga09592_189768_c1
607 nmdc:mga09592_32880_c1
608 nmdc:mga09592_47411_c1
609 nmdc:mga0qj67_184828_c1
610 nmdc:mga06r32_13289_c1
611 nmdc:mga06r32_190081_c1
612 nmdc:mga06r32_9598_c1
613 nmdc:mga0n895_419997_c1
614 nmdc:mga0n895_44305_c1
615 nmdc:mga0rr50_6862_c1
616 nmdc:mga08x19_13929_c1
617 nmdc:mga0a205_16365_c1
618 nmdc:mga0a205_323452_c1
619 Ga0500635_0001007
620 Ga0500643_069490
621 Ga0500644_0069988
622 Ga0500646_0042736
623 Ga0500651_0020152
624 Ga0500651_0112515
625 Ga0500651_0480981
626 Ga0500566_0102909
627 Ga0500641_0001655
628 Ga0500650_0264710
629 Ga0500650_0475033
630 Ga0500555_001445
631 Ga0500556_0329640
632 Ga0500594_0102780
633 Ga0500595_002778
634 Ga0500642_0003483
635 Ga0500652_001217
636 Ga0500658_0001966
637 Ga0500658_0080053
638 Ga0500658_0329933
639 Ga0500568_0004207
640 Ga0500568_0116191
641 Ga0500568_0186510
642 Ga0500577_0018775
643 Ga0500577_0195104
644 Ga0500588_0018688
645 Ga0500588_0046486
646 Ga0500588_0208481
647 Ga0500616_0000686
648 Ga0500622_0228805
649 Ga0500627_0326506
650 Ga0500609_001713
651 Ga0500609_004141
652 Ga0501084_0005893
653 Ga0501084_0043682
654 Ga0501084_0203419
655 Ga0501084_1540477
656 Ga0501082_0068452
657 Ga0501082_0148549
658 Ga0501082_0216621
659 Ga0501082_0247008
660 Ga0501082_0631663
661 Ga0501082_1029662
662 Ga0530510_0000864
663 Ga0530510_0001540
664 Ga0530510_0043980
665 Ga0530510_0195926
666 2844536653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

6

128

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a8m-assembly1.cif.gz_B crystal structure of nitrile hydratase mutant y72f complexed with trimethylacetonitrile 0.7537 16 103
3wvd-assembly1.cif.gz_B crystal structure of nitrile hydratase mutant br56k complexed with trimethylacetonitrile, photo-activated for 50 min 0.7514 16 103
4zgd-assembly1.cif.gz_B mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.7207 8 103
4fm4-assembly7.cif.gz_N wild type fe-type nitrile hydratase from comamonas testosteroni ni1 0.6868 8 103
3a8g-assembly1.cif.gz_B crystal structure of nitrile hydratase mutant s113a complexed with trimethylacetonitrile 0.6743 8 103
ID Description Score Start End Superfamily
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.7179 8 101 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6234 8 101 1.10.472.20
2dd4H00 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5984 2 119 1.10.472.20
3qxeB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5789 8 125 1.10.472.20
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5613 8 122 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A382BUY1-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.9734 25 120
AF-A0A536J6X5-F1-model_v4 Nitrile hydratase accessory protein 0.9539 40 120
AF-A0A2M7GP92-F1-model_v4 Nitrile hydratase accessory protein 0.9487 23 120
AF-A0A5A7YB97-F1-model_v4 Nitrile hydratase accessory protein 0.9461 38 120
AF-A0A848W8R3-F1-model_v4 Nitrile hydratase accessory protein 0.9455 14 120

Map