F411526

General Info

Members Datasets Scaffolds Average Seq Length
333 206 666 259

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0519761|Ga0496115_0519761_83_937
Length 284
Sequence MEPPRSLETDKAPRKRTMTQAWLKDPLSLFSVKGKVAIVTGASGAFGALAAQVLAGGGAKLVLAAGRQDELAKVAAECQALGAEVESVAIRPSSEANCDRIVKAAVDRFGRVDILVVGSGKNDVAKINEMSPERFLDVMDANVTQSWLIARAAGRQMLAQGQGGKVILMSSARGLLGHPAGYTAYCASKSAVDGMTKALGCEWGGTGITVNAIAPTVFRSALTEWMYGEDERAKTVRAGFLARVPKGRLGEPGDLAGPLLFLASAASDFYTGHILYADGGYTAG

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
35 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
50 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
83 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
84 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
85 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
86 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
87 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
90 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
115 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
129 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
169 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
186 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
190 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
191 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
192 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
193 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
197 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
198 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
199 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
200 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
201 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
202 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
203 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
204 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
205 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
206 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.1
Metatranscriptomes 0.6
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.11
Nodule 3
Rhizoplane 1.8
Rhizosphere 67.87
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0519761 3300048918 Bacteria 955
2 rootH1_10372853 3300003323 Bacteria 1616
3 Ga0070688_100142788 3300005365 Bacteria 1628
4 Ga0070714_100130008 3300005435 Bacteria 2250
5 Ga0070713_100140213 3300005436 Bacteria 2141
6 Ga0070713_100693401 3300005436 Bacteria 972
7 Ga0070711_100016364 3300005439 Bacteria 4709
8 Ga0070711_100140310 3300005439 Bacteria 1811
9 Ga0070663_100060275 3300005455 Bacteria 2729
10 Ga0070707_100111017 3300005468 Bacteria 2659
11 Ga0068853_100211566 3300005539 Bacteria 1768
12 Ga0070665_100003920 3300005548 Bacteria 15711
13 Ga0070665_100204994 3300005548 Bacteria 1972
14 Ga0068854_100322077 3300005578 Bacteria 1257
15 Ga0081538_10077455 3300005981 Bacteria 1791
16 Ga0081539_10020225 3300005985 Bacteria 4512
17 Ga0070717_10019537 3300006028 Bacteria 5316
18 Ga0075365_10001135 3300006038 Bacteria 11661
19 Ga0075363_100046390 3300006048 Bacteria 2305
20 Ga0075363_100064061 3300006048 Bacteria 1985
21 Ga0075363_100109947 3300006048 Bacteria 1531
22 Ga0075364_10001140 3300006051 Bacteria 14195
23 Ga0075364_10026921 3300006051 Bacteria 3670
24 Ga0075362_10015712 3300006177 Bacteria 3084
25 Ga0075367_10066207 3300006178 Bacteria 2164
26 Ga0075367_10098317 3300006178 Bacteria 1786
27 Ga0075367_10269215 3300006178 Bacteria 1070
28 Ga0075366_10000583 3300006195 Bacteria 17127
29 Ga0075370_10002755 3300006353 Bacteria 8232
30 Ga0075370_10145883 3300006353 Bacteria 1385
31 Ga0075430_100000669 3300006846 Bacteria 26198
32 Ga0075429_100278667 3300006880 Bacteria 1464
33 Ga0075436_100489888 3300006914 Bacteria 898
34 Ga0105240_10000121 3300009093 Bacteria 163057
35 Ga0114129_10626919 3300009147 Bacteria 1390
36 Ga0105237_10004279 3300009545 Bacteria 16578
37 Ga0105237_10013466 3300009545 Bacteria 8575
38 Ga0105237_10021569 3300009545 Bacteria 6622
39 Ga0105238_10005328 3300009551 Bacteria 12707
40 Ga0105238_10074077 3300009551 Bacteria 3398
41 Ga0105239_10055489 3300010375 Bacteria 4345
42 Ga0105239_10282474 3300010375 Bacteria 1869
43 Ga0157370_10019737 3300013104 Bacteria 6747
44 Ga0157369_10642413 3300013105 Bacteria 1095
45 Ga0213872_10004947 3300021361 Bacteria 6929
46 Ga0213872_10011556 3300021361 Bacteria 4175
47 Ga0213876_10000978 3300021384 Bacteria 18826
48 Ga0213871_10007014 3300021441 Bacteria 2414
49 Ga0224572_1000501 3300024225 Bacteria 4705
50 Ga0209758_1000485 3300025297 Bacteria 65234
51 Ga0207692_10048512 3300025898 Bacteria 2138
52 Ga0207647_10010742 3300025904 Bacteria 6448
53 Ga0207647_10273903 3300025904 Bacteria 964
54 Ga0207695_10000006 3300025913 Bacteria 1135309
55 Ga0207671_10158989 3300025914 Bacteria 1749
56 Ga0207671_10196701 3300025914 Bacteria 1573
57 Ga0207671_10199376 3300025914 Bacteria 1563
58 Ga0207663_10086157 3300025916 Bacteria 2071
59 Ga0207663_10438268 3300025916 Bacteria 1006
60 Ga0207698_10281212 3300026142 Bacteria 1539
61 Ga0209813_10056728 3300027866 Bacteria 1240
62 Ga0268266_10248431 3300028379 Bacteria 1645
63 Ga0265336_10007003 3300028666 Bacteria 4033
64 Ga0307515_10007352 3300028794 Bacteria 21793
65 Ga0307515_10079512 3300028794 Bacteria 4294
66 Ga0265338_10005436 3300028800 Bacteria 16627
67 Ga0265338_10018348 3300028800 Bacteria 7494
68 Ga0265338_10058319 3300028800 Bacteria 3408
69 Ga0307511_10184256 3300030521 Bacteria 1118
70 Ga0307512_10006386 3300030522 Bacteria 11948
71 Ga0265762_1003079 3300030760 Bacteria 2979
72 Ga0265773_1000411 3300031018 Bacteria 1690
73 Ga0265325_10161791 3300031241 Unclassified 1052
74 Ga0265340_10154844 3300031247 Bacteria 1043
75 Ga0265339_10000091 3300031249 Bacteria 75937
76 Ga0265339_10177470 3300031249 Bacteria 1063
77 Ga0265316_10127067 3300031344 Bacteria 1922
78 Ga0307513_10000991 3300031456 Bacteria 41018
79 Ga0307513_10002989 3300031456 Bacteria 23047
80 Ga0307513_10008616 3300031456 Bacteria 13011
81 Ga0265313_10000260 3300031595 Bacteria 57581
82 Ga0307508_10003183 3300031616 Bacteria 16783
83 Ga0265342_10045735 3300031712 Bacteria 2633
84 Ga0316576_10028092 3300031727 Bacteria 3961
85 Ga0316576_10045321 3300031727 Unclassified 3180
86 Ga0316576_10169873 3300031727 Bacteria 1646
87 Ga0316578_10114078 3300031728 Bacteria 1623
88 Ga0307516_10001334 3300031730 Bacteria 34247
89 Ga0307516_10007190 3300031730 Bacteria 12848
90 Ga0307413_10078727 3300031824 Bacteria 2104
91 Ga0307413_10546640 3300031824 Bacteria 939
92 Ga0307412_10005282 3300031911 Bacteria 7250
93 Ga0307412_10047370 3300031911 Bacteria 2823
94 Ga0307409_100441079 3300031995 Bacteria 1254
95 Ga0307414_10004721 3300032004 Bacteria 7436
96 Ga0307507_10000017 3300033179 Bacteria 224506
97 Ga0307507_10019702 3300033179 Bacteria 7589
98 Ga0373936_0001442 3300035113 Bacteria 8638
99 Ga0373953_0075993 3300035117 Bacteria 1391
100 Ga0373957_0005210 3300035120 Bacteria 4020
101 Ga0373957_0050496 3300035120 Bacteria 1590
102 Ga0373946_0027094 3300035171 Bacteria 2265
103 Ga0373955_0026127 3300035172 Bacteria 3004
104 Ga0373955_0043609 3300035172 Bacteria 2413
105 Ga0373942_0000577 3300035207 Bacteria 10309
106 Ga0373924_0006585 3300035410 Bacteria 4165
107 Ga0373927_0000127 3300035695 Bacteria 58182
108 Ga0373927_0027141 3300035695 Bacteria 3740
109 Ga0373933_0007720 3300035724 Bacteria 5874
110 Ga0373933_0227032 3300035724 Bacteria 1199
111 Ga0373947_0099218 3300035725 Bacteria 1828
112 Ga0373937_0002200 3300036401 Bacteria 16293
113 Ga0373937_0012535 3300036401 Bacteria 7459
114 Ga0316582_0018972 3300036647 Bacteria 4016
115 Ga0373925_0000276 3300037068 Bacteria 53582
116 Ga0373925_0007220 3300037068 Bacteria 8123
117 Ga0373925_0066407 3300037068 Bacteria 2719
118 Ga0373925_0108681 3300037068 Bacteria 2140
119 Ga0395900_0096821 3300037418 Bacteria 3032
120 Ga0400484_22339 3300038725 Bacteria 2096
121 Ga0400484_37937 3300038725 Bacteria 2390
122 Ga0400484_41489 3300038725 Bacteria 6762
123 Ga0400490_60015 3300038726 Bacteria 1048
124 Ga0400488_15929 3300038741 Unclassified 1273
125 Ga0400488_19698 3300038741 Unclassified 2372
126 Ga0400488_33800 3300038741 Bacteria 3316
127 Ga0400488_61411 3300038741 Bacteria 7408
128 Ga0400483_005135 3300039062 Bacteria 49198
129 Ga0400483_021239 3300039062 Bacteria 2276
130 Ga0400483_051139 3300039062 Bacteria 4482
131 Ga0400483_144721 3300039062 Bacteria 2874
132 Ga0400483_196725 3300039062 Bacteria 2081
133 Ga0400483_202297 3300039062 Bacteria 8487
134 Ga0400483_206320 3300039062 Bacteria 2790
135 Ga0400483_209567 3300039062 Unclassified 2453
136 Ga0400483_218784 3300039062 Bacteria 3083
137 Ga0400483_225059 3300039062 Bacteria 3085
138 Ga0400483_285024 3300039062 Bacteria 2672
139 Ga0400489_15667 3300039093 Bacteria 22561
140 Ga0400489_28798 3300039093 Bacteria 1424
141 Ga0400489_33239 3300039093 Bacteria 6219
142 Ga0400489_86322 3300039093 Bacteria 19518
143 Ga0400489_86675 3300039093 Bacteria 35007
144 Ga0400487_51476 3300039110 Bacteria 9751
145 Ga0436365_0503086 3300039437 Bacteria 2471
146 Ga0436365_1527796 3300039437 Bacteria 2871
147 Ga0436360_0377745 3300039438 Bacteria 5135
148 Ga0436360_0430403 3300039438 Bacteria 2073
149 Ga0436360_1359982 3300039438 Bacteria 9264
150 Ga0436361_0238116 3300039447 Bacteria 14192
151 Ga0436361_0902848 3300039447 Bacteria 8157
152 Ga0436363_1486283 3300039450 Bacteria 4276
153 Ga0436362_0459926 3300039453 Bacteria 2486
154 Ga0436362_0854199 3300039453 Bacteria 873
155 Ga0436362_0928376 3300039453 Bacteria 12218
156 Ga0436362_1155898 3300039453 Bacteria 2295
157 Ga0451843_0852141 3300041509 Bacteria 1807
158 Ga0453684_0004091 3300044712 Bacteria 31642
159 Ga0453684_0163844 3300044712 Bacteria 2627
160 Ga0466968_0004425 3300044735 Bacteria 5252
161 Ga0466970_0056843 3300044765 Bacteria 2091
162 Ga0466957_0038777 3300044842 Bacteria 2872
163 Ga0466960_0034660 3300044901 Bacteria 2354
164 Ga0466959_0046960 3300045049 Bacteria 3177
165 Ga0466959_0101183 3300045049 Bacteria 2063
166 Ga0466967_0081470 3300045976 Bacteria 2923
167 Ga0466967_0100758 3300045976 Bacteria 2639
168 Ga0466967_0111773 3300045976 Bacteria 2511
169 Ga0466967_0152832 3300045976 Bacteria 2159
170 Ga0495592_0015953 3300046454 Bacteria 5698
171 Ga0495592_0049341 3300046454 Bacteria 3129
172 Ga0495592_0095132 3300046454 Bacteria 2131
173 Ga0495591_056680 3300046458 Bacteria 1053
174 Ga0495629_0017606 3300046459 Bacteria 5122
175 Ga0495638_0010417 3300046460 Bacteria 6458
176 Ga0495638_0027556 3300046460 Bacteria 3676
177 Ga0495651_0000754 3300046462 Bacteria 25043
178 Ga0495651_0006633 3300046462 Bacteria 8843
179 Ga0495651_0056669 3300046462 Bacteria 3009
180 Ga0495653_0076142 3300046463 Bacteria 2495
181 Ga0495664_0044304 3300046477 Bacteria 2637
182 Ga0495607_0007550 3300046501 Bacteria 7506
183 Ga0495608_0000124 3300046511 Bacteria 55024
184 Ga0495608_0011937 3300046511 Bacteria 6042
185 Ga0495608_0301568 3300046511 Bacteria 992
186 Ga0495616_0000753 3300046513 Bacteria 23674
187 Ga0495616_0118348 3300046513 Bacteria 1225
188 Ga0495618_0013010 3300046514 Bacteria 5058
189 Ga0495618_0044703 3300046514 Bacteria 2793
190 Ga0495628_0006929 3300046516 Bacteria 9842
191 Ga0495630_0024175 3300046517 Bacteria 4493
192 Ga0495632_0079619 3300046519 Bacteria 1564
193 Ga0495644_0003057 3300046523 Bacteria 6622
194 Ga0495652_0002334 3300046529 Bacteria 19711
195 Ga0495652_0020577 3300046529 Bacteria 5865
196 Ga0495652_0021591 3300046529 Bacteria 5721
197 Ga0495652_0033427 3300046529 Bacteria 4490
198 Ga0495654_0121533 3300046530 Bacteria 1181
199 Ga0495665_0021601 3300046531 Bacteria 3459
200 Ga0495640_0008150 3300046533 Bacteria 8229
201 Ga0495640_0010709 3300046533 Bacteria 7074
202 Ga0495640_0078433 3300046533 Bacteria 2200
203 Ga0495586_0020352 3300046535 Bacteria 3533
204 Ga0495586_0028340 3300046535 Bacteria 2997
205 Ga0495586_0102726 3300046535 Bacteria 1587
206 Ga0495621_0000354 3300046539 Bacteria 11165
207 Ga0495645_0005566 3300046543 Bacteria 8663
208 Ga0495645_0046226 3300046543 Bacteria 3173
209 Ga0495645_0076876 3300046543 Bacteria 2401
210 Ga0495667_0001559 3300046559 Bacteria 15211
211 Ga0495634_0001639 3300046642 Bacteria 19477
212 Ga0495634_0096143 3300046642 Bacteria 1918
213 Ga0495635_0001827 3300046663 Bacteria 14391
214 Ga0495635_0005000 3300046663 Bacteria 9227
215 Ga0495635_0186615 3300046663 Bacteria 1408
216 Ga0495661_0000498 3300046665 Bacteria 40908
217 Ga0495657_0001183 3300046675 Bacteria 22882
218 Ga0495657_0049744 3300046675 Bacteria 2822
219 Ga0495657_0237159 3300046675 Bacteria 1102
220 Ga0495623_0071285 3300046679 Bacteria 2162
221 Ga0495646_0002512 3300046680 Bacteria 11269
222 Ga0495646_0035821 3300046680 Bacteria 3076
223 Ga0495646_0067696 3300046680 Bacteria 2110
224 Ga0495624_0012430 3300046690 Bacteria 5820
225 Ga0495600_0000251 3300046809 Bacteria 29255
226 Ga0495600_0000785 3300046809 Bacteria 16777
227 Ga0495604_0000774 3300047317 Bacteria 26883
228 Ga0495604_0354163 3300047317 Bacteria 975
229 Ga0495674_0001761 3300047319 Bacteria 21319
230 Ga0495674_0002327 3300047319 Bacteria 18668
231 Ga0495674_0030486 3300047319 Bacteria 4904
232 Ga0495672_0005202 3300047320 Bacteria 10370
233 Ga0495680_0025710 3300047322 Bacteria 4869
234 Ga0495680_0231327 3300047322 Unclassified 1316
235 Ga0495675_0005682 3300047444 Bacteria 7620
236 Ga0495675_0006789 3300047444 Bacteria 7020
237 Ga0495681_0006726 3300047470 Bacteria 7500
238 Ga0495684_0005637 3300047471 Bacteria 9756
239 Ga0495684_0006845 3300047471 Bacteria 8860
240 Ga0495684_0020952 3300047471 Bacteria 5036
241 Ga0495686_0101496 3300047472 Bacteria 1735
242 Ga0495602_0026858 3300048088 Bacteria 5544
243 Ga0495602_0323369 3300048088 Bacteria 1121
244 Ga0496104_0019416 3300048907 Bacteria 6218
245 Ga0496105_0017953 3300048908 Bacteria 5678
246 Ga0496110_0201890 3300048913 Bacteria 1807
247 Ga0496111_0056212 3300048914 Bacteria 2847
248 Ga0496115_0003484 3300048918 Bacteria 11313
249 Ga0496117_0047507 3300048920 Bacteria 3077
250 Ga0496117_0055615 3300048920 Bacteria 2764
251 Ga0496118_0008648 3300048921 Bacteria 10473
252 Ga0496118_0052238 3300048921 Bacteria 3120
253 Ga0496121_0001142 3300048924 Bacteria 46580
254 Ga0496121_0210510 3300048924 Bacteria 1378
255 Ga0496124_0061588 3300048927 Bacteria 3145
256 Ga0496124_0173699 3300048927 Bacteria 1666
257 Ga0496125_0004099 3300048928 Bacteria 17042
258 Ga0496126_0003527 3300048929 Bacteria 19681
259 Ga0496126_0074490 3300048929 Bacteria 3015
260 Ga0501034_0021143 3300049571 Bacteria 6637
261 Ga0501034_0050791 3300049571 Bacteria 4182
262 Ga0501034_0071273 3300049571 Bacteria 3485
263 Ga0501034_0143801 3300049571 Bacteria 2363
264 Ga0501036_0013946 3300049572 Bacteria 6683
265 Ga0501036_0044073 3300049572 Bacteria 3778
266 Ga0501037_0311221 3300049573 Bacteria 1092
267 Ga0501038_0093515 3300049574 Bacteria 2515
268 Ga0501039_0035491 3300049575 Bacteria 3848
269 Ga0501040_0257607 3300049576 Bacteria 1245
270 Ga0501046_0066400 3300049580 Bacteria 2812
271 Ga0501047_0093149 3300049581 Bacteria 2892
272 Ga0501047_0326368 3300049581 Bacteria 1374
273 Ga0501048_0285332 3300049582 Bacteria 1174
274 Ga0501067_0000249 3300049583 Bacteria 29614
275 Ga0501070_0071779 3300049586 Bacteria 2866
276 Ga0501070_0235162 3300049586 Bacteria 1501
277 Ga0501072_0023939 3300049588 Bacteria 4746
278 Ga0501073_0016499 3300049589 Bacteria 5353
279 Ga0501074_0186881 3300049590 Bacteria 1477
280 Ga0501075_0057299 3300049591 Bacteria 2933
281 Ga0501075_0200560 3300049591 Bacteria 1522
282 Ga0501076_0073205 3300049592 Bacteria 2743
283 Ga0501076_0204364 3300049592 Bacteria 1613
284 Ga0501077_0067068 3300049593 Bacteria 2276
285 Ga0501077_0076511 3300049593 Bacteria 2120
286 Ga0501081_0076832 3300049743 Bacteria 2332
287 Ga0501263_000337 3300049760 Bacteria 3316
288 Ga0501035_0216677 3300049822 Bacteria 1636
289 Ga0501045_0001364 3300049824 Bacteria 16238
290 nmdc:mga03683_45465_c1 3300050489 Bacteria 1817
291 nmdc:mga03n38_9807_c1 3300050490 Bacteria 3497
292 nmdc:mga00v17_11399_c1 3300050491 Bacteria 4887
293 nmdc:mga00v17_23695_c1 3300050491 Bacteria 3553
294 nmdc:mga0yw44_71397_c1 3300050492 Bacteria 2156
295 nmdc:mga0k408_7174_c1 3300050493 Bacteria 5956
296 nmdc:mga06z11_15762_c2 3300050494 Bacteria 1665
297 nmdc:mga06z11_23670_c1 3300050494 Bacteria 2889
298 nmdc:mga06z11_50948_c1 3300050494 Bacteria 2118
299 nmdc:mga06z11_87505_c1 3300050494 Bacteria 1685
300 nmdc:mga07m45_7576_c1 3300050496 Bacteria 5551
301 nmdc:mga05p37_502955_c1 3300050507 Bacteria 1390
302 nmdc:mga0qj67_182_c1 3300050509 Bacteria 42807
303 nmdc:mga08x19_436829_c1 3300050514 Bacteria 920
304 Ga0495601_0000751 3300053077 Bacteria 17458
305 Ga0495601_0116076 3300053077 Bacteria 1736
306 Ga0495619_0021530 3300053085 Bacteria 4117
307 Ga0495619_0052566 3300053085 Bacteria 2693
308 Ga0495619_0271747 3300053085 Bacteria 1175
309 Ga0500644_0001606 3300053088 Bacteria 5907
310 Ga0500591_068062 3300053115 Bacteria 1621
311 Ga0500593_020497 3300053117 Bacteria 2902
312 Ga0500652_007311 3300053131 Bacteria 3608
313 Ga0500577_0020817 3300053142 Bacteria 2152
314 Ga0500588_0002485 3300053146 Bacteria 3758
315 Ga0500588_0006030 3300053146 Bacteria 2721
316 Ga0500616_0022648 3300053153 Bacteria 3505
317 Ga0500620_001925 3300053155 Bacteria 4015
318 Ga0500627_0078431 3300053158 Bacteria 1470
319 Ga0500636_0099695 3300053177 Bacteria 1653
320 Ga0501084_0424648 3300054114 Bacteria 1124
321 Ga0501084_0648190 3300054114 Bacteria 892
322 Ga0501082_0129028 3300060353 Bacteria 2194
323 2588514415 2588253730 Bacteria 6881675
324 2842489049 2842482326 Bacteria 7212537
325 2935684016 2935675223 Bacteria 9928132
326 2935693791 2935684952 Bacteria 9590419
327 2935722488 2935713505 Bacteria 9608509
328 2935731797 2935722832 Bacteria 9608746
329 2935741006 2935732158 Bacteria 9706831
330 2935750291 2935741537 Bacteria 9707219
331 2935759976 2935750917 Bacteria 9590372
332 2935769545 2935760218 Bacteria 9817913
333 2940565881 2940556831 Bacteria 9590747
334 Ga0496115_0519761
335 rootH1_10372853
336 Ga0070688_100142788
337 Ga0070714_100130008
338 Ga0070713_100140213
339 Ga0070713_100693401
340 Ga0070711_100016364
341 Ga0070711_100140310
342 Ga0070663_100060275
343 Ga0070707_100111017
344 Ga0068853_100211566
345 Ga0070665_100003920
346 Ga0070665_100204994
347 Ga0068854_100322077
348 Ga0081538_10077455
349 Ga0081539_10020225
350 Ga0070717_10019537
351 Ga0075365_10001135
352 Ga0075363_100046390
353 Ga0075363_100064061
354 Ga0075363_100109947
355 Ga0075364_10001140
356 Ga0075364_10026921
357 Ga0075362_10015712
358 Ga0075367_10066207
359 Ga0075367_10098317
360 Ga0075367_10269215
361 Ga0075366_10000583
362 Ga0075370_10002755
363 Ga0075370_10145883
364 Ga0075430_100000669
365 Ga0075429_100278667
366 Ga0075436_100489888
367 Ga0105240_10000121
368 Ga0114129_10626919
369 Ga0105237_10004279
370 Ga0105237_10013466
371 Ga0105237_10021569
372 Ga0105238_10005328
373 Ga0105238_10074077
374 Ga0105239_10055489
375 Ga0105239_10282474
376 Ga0157370_10019737
377 Ga0157369_10642413
378 Ga0213872_10004947
379 Ga0213872_10011556
380 Ga0213876_10000978
381 Ga0213871_10007014
382 Ga0224572_1000501
383 Ga0209758_1000485
384 Ga0207692_10048512
385 Ga0207647_10010742
386 Ga0207647_10273903
387 Ga0207695_10000006
388 Ga0207671_10158989
389 Ga0207671_10196701
390 Ga0207671_10199376
391 Ga0207663_10086157
392 Ga0207663_10438268
393 Ga0207698_10281212
394 Ga0209813_10056728
395 Ga0268266_10248431
396 Ga0265336_10007003
397 Ga0307515_10007352
398 Ga0307515_10079512
399 Ga0265338_10005436
400 Ga0265338_10018348
401 Ga0265338_10058319
402 Ga0307511_10184256
403 Ga0307512_10006386
404 Ga0265762_1003079
405 Ga0265773_1000411
406 Ga0265325_10161791
407 Ga0265340_10154844
408 Ga0265339_10000091
409 Ga0265339_10177470
410 Ga0265316_10127067
411 Ga0307513_10000991
412 Ga0307513_10002989
413 Ga0307513_10008616
414 Ga0265313_10000260
415 Ga0307508_10003183
416 Ga0265342_10045735
417 Ga0316576_10028092
418 Ga0316576_10045321
419 Ga0316576_10169873
420 Ga0316578_10114078
421 Ga0307516_10001334
422 Ga0307516_10007190
423 Ga0307413_10078727
424 Ga0307413_10546640
425 Ga0307412_10005282
426 Ga0307412_10047370
427 Ga0307409_100441079
428 Ga0307414_10004721
429 Ga0307507_10000017
430 Ga0307507_10019702
431 Ga0373936_0001442
432 Ga0373953_0075993
433 Ga0373957_0005210
434 Ga0373957_0050496
435 Ga0373946_0027094
436 Ga0373955_0026127
437 Ga0373955_0043609
438 Ga0373942_0000577
439 Ga0373924_0006585
440 Ga0373927_0000127
441 Ga0373927_0027141
442 Ga0373933_0007720
443 Ga0373933_0227032
444 Ga0373947_0099218
445 Ga0373937_0002200
446 Ga0373937_0012535
447 Ga0316582_0018972
448 Ga0373925_0000276
449 Ga0373925_0007220
450 Ga0373925_0066407
451 Ga0373925_0108681
452 Ga0395900_0096821
453 Ga0400484_22339
454 Ga0400484_37937
455 Ga0400484_41489
456 Ga0400490_60015
457 Ga0400488_15929
458 Ga0400488_19698
459 Ga0400488_33800
460 Ga0400488_61411
461 Ga0400483_005135
462 Ga0400483_021239
463 Ga0400483_051139
464 Ga0400483_144721
465 Ga0400483_196725
466 Ga0400483_202297
467 Ga0400483_206320
468 Ga0400483_209567
469 Ga0400483_218784
470 Ga0400483_225059
471 Ga0400483_285024
472 Ga0400489_15667
473 Ga0400489_28798
474 Ga0400489_33239
475 Ga0400489_86322
476 Ga0400489_86675
477 Ga0400487_51476
478 Ga0436365_0503086
479 Ga0436365_1527796
480 Ga0436360_0377745
481 Ga0436360_0430403
482 Ga0436360_1359982
483 Ga0436361_0238116
484 Ga0436361_0902848
485 Ga0436363_1486283
486 Ga0436362_0459926
487 Ga0436362_0854199
488 Ga0436362_0928376
489 Ga0436362_1155898
490 Ga0451843_0852141
491 Ga0453684_0004091
492 Ga0453684_0163844
493 Ga0466968_0004425
494 Ga0466970_0056843
495 Ga0466957_0038777
496 Ga0466960_0034660
497 Ga0466959_0046960
498 Ga0466959_0101183
499 Ga0466967_0081470
500 Ga0466967_0100758
501 Ga0466967_0111773
502 Ga0466967_0152832
503 Ga0495592_0015953
504 Ga0495592_0049341
505 Ga0495592_0095132
506 Ga0495591_056680
507 Ga0495629_0017606
508 Ga0495638_0010417
509 Ga0495638_0027556
510 Ga0495651_0000754
511 Ga0495651_0006633
512 Ga0495651_0056669
513 Ga0495653_0076142
514 Ga0495664_0044304
515 Ga0495607_0007550
516 Ga0495608_0000124
517 Ga0495608_0011937
518 Ga0495608_0301568
519 Ga0495616_0000753
520 Ga0495616_0118348
521 Ga0495618_0013010
522 Ga0495618_0044703
523 Ga0495628_0006929
524 Ga0495630_0024175
525 Ga0495632_0079619
526 Ga0495644_0003057
527 Ga0495652_0002334
528 Ga0495652_0020577
529 Ga0495652_0021591
530 Ga0495652_0033427
531 Ga0495654_0121533
532 Ga0495665_0021601
533 Ga0495640_0008150
534 Ga0495640_0010709
535 Ga0495640_0078433
536 Ga0495586_0020352
537 Ga0495586_0028340
538 Ga0495586_0102726
539 Ga0495621_0000354
540 Ga0495645_0005566
541 Ga0495645_0046226
542 Ga0495645_0076876
543 Ga0495667_0001559
544 Ga0495634_0001639
545 Ga0495634_0096143
546 Ga0495635_0001827
547 Ga0495635_0005000
548 Ga0495635_0186615
549 Ga0495661_0000498
550 Ga0495657_0001183
551 Ga0495657_0049744
552 Ga0495657_0237159
553 Ga0495623_0071285
554 Ga0495646_0002512
555 Ga0495646_0035821
556 Ga0495646_0067696
557 Ga0495624_0012430
558 Ga0495600_0000251
559 Ga0495600_0000785
560 Ga0495604_0000774
561 Ga0495604_0354163
562 Ga0495674_0001761
563 Ga0495674_0002327
564 Ga0495674_0030486
565 Ga0495672_0005202
566 Ga0495680_0025710
567 Ga0495680_0231327
568 Ga0495675_0005682
569 Ga0495675_0006789
570 Ga0495681_0006726
571 Ga0495684_0005637
572 Ga0495684_0006845
573 Ga0495684_0020952
574 Ga0495686_0101496
575 Ga0495602_0026858
576 Ga0495602_0323369
577 Ga0496104_0019416
578 Ga0496105_0017953
579 Ga0496110_0201890
580 Ga0496111_0056212
581 Ga0496115_0003484
582 Ga0496117_0047507
583 Ga0496117_0055615
584 Ga0496118_0008648
585 Ga0496118_0052238
586 Ga0496121_0001142
587 Ga0496121_0210510
588 Ga0496124_0061588
589 Ga0496124_0173699
590 Ga0496125_0004099
591 Ga0496126_0003527
592 Ga0496126_0074490
593 Ga0501034_0021143
594 Ga0501034_0050791
595 Ga0501034_0071273
596 Ga0501034_0143801
597 Ga0501036_0013946
598 Ga0501036_0044073
599 Ga0501037_0311221
600 Ga0501038_0093515
601 Ga0501039_0035491
602 Ga0501040_0257607
603 Ga0501046_0066400
604 Ga0501047_0093149
605 Ga0501047_0326368
606 Ga0501048_0285332
607 Ga0501067_0000249
608 Ga0501070_0071779
609 Ga0501070_0235162
610 Ga0501072_0023939
611 Ga0501073_0016499
612 Ga0501074_0186881
613 Ga0501075_0057299
614 Ga0501075_0200560
615 Ga0501076_0073205
616 Ga0501076_0204364
617 Ga0501077_0067068
618 Ga0501077_0076511
619 Ga0501081_0076832
620 Ga0501263_000337
621 Ga0501035_0216677
622 Ga0501045_0001364
623 nmdc:mga03683_45465_c1
624 nmdc:mga03n38_9807_c1
625 nmdc:mga00v17_11399_c1
626 nmdc:mga00v17_23695_c1
627 nmdc:mga0yw44_71397_c1
628 nmdc:mga0k408_7174_c1
629 nmdc:mga06z11_15762_c2
630 nmdc:mga06z11_23670_c1
631 nmdc:mga06z11_50948_c1
632 nmdc:mga06z11_87505_c1
633 nmdc:mga07m45_7576_c1
634 nmdc:mga05p37_502955_c1
635 nmdc:mga0qj67_182_c1
636 nmdc:mga08x19_436829_c1
637 Ga0495601_0000751
638 Ga0495601_0116076
639 Ga0495619_0021530
640 Ga0495619_0052566
641 Ga0495619_0271747
642 Ga0500644_0001606
643 Ga0500591_068062
644 Ga0500593_020497
645 Ga0500652_007311
646 Ga0500577_0020817
647 Ga0500588_0002485
648 Ga0500588_0006030
649 Ga0500616_0022648
650 Ga0500620_001925
651 Ga0500627_0078431
652 Ga0500636_0099695
653 Ga0501084_0424648
654 Ga0501084_0648190
655 Ga0501082_0129028
656 2588514415
657 2842489049
658 2935684016
659 2935693791
660 2935722488
661 2935731797
662 2935741006
663 2935750291
664 2935759976
665 2935769545
666 2940565881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

230

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

282

0.91

PF08659

KR

KR domain

36

214

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9722 17 265
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9688 13 262
3o03-assembly1.cif.gz_A quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 0.9665 5 266
3ftp-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9654 13 263
3ftp-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.9647 13 263
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9658 102 199 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9654 13 263 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9639 14 266 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9634 13 266 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9605 5 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A847ZWM4-F1-model_v4 SDR family oxidoreductase 0.9959 72 266 GO:0006633
GO:0016616
GO:0048038
AF-A0A847ZWM4-F1-model_v4 SDR family oxidoreductase 0.9908 72 266 GO:0006633
GO:0016616
GO:0048038
AF-A0A354VKD5-F1-model_v4 deleted 0.9879 1 159
AF-A0A2A4QPP6-F1-model_v4 Oxidoreductase 0.9853 9 266 GO:0006633
GO:0016616
GO:0048038
AF-A0A1Z9GTC6-F1-model_v4 Oxidoreductase 0.985 4 266 GO:0006633
GO:0016616
GO:0048038

Map