F411310

General Info

Members Datasets Scaffolds Average Seq Length
333 190 333 286

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100014107|Ga0075434_1000141077
Length 324
Sequence VTSKAFIKPLFAEDGCNINEGVATLQRKLILKDQKVAVVTGSSTGIGFETCLLFARSGIHTYATMRDLTKADLIKNVAEKEKLSLKIIQMDVDKDDSVAEAFKQMYDDRRTRIDILVNNAGFGLFGALEDQSIDDIKKQFETNLFGAIRTIQQVLPIMRDQRSGIIVNISSLAGYVGFPASSVYNSTKFALEGLSESLAYEIEPYGISVVLIEPGVINSNFAKNIIIPSNTQSISSYLSVSTKYANVVERFLCHYYPAMRNAPQPKEVAKVILESIEASVVSARQGNNNFHRYPIGEDAKLYADAKRKMSDSELHSFVSKRILS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
88 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
97 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
125 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
126 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
127 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
128 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
146 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
147 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
148 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
149 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
150 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
151 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
152 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
153 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
154 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
157 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
158 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
159 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
160 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
161 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
162 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
163 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
168 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
169 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
170 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
174 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
186 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 2.4
Rhizosphere 96.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_817053 2162886007 Archaea 1758
2 JGI25407J50210_10009088 3300003373 Archaea 2512
3 JGI25407J50210_10045626 3300003373 Archaea 1117
4 Ga0065704_10078954 3300005289 Archaea 4294
5 Ga0065704_10086219 3300005289 Archaea 3124
6 Ga0065712_10001675 3300005290 Archaea 9814
7 Ga0065712_10070333 3300005290 Archaea 6106
8 Ga0065715_10001862 3300005293 Archaea 5862
9 Ga0065715_10002710 3300005293 Archaea 15479
10 Ga0065715_10091932 3300005293 Archaea 5438
11 Ga0065707_10003488 3300005295 Archaea 3817
12 Ga0070683_100560480 3300005329 Bacteria 1092
13 Ga0070680_100089217 3300005336 Bacteria 2551
14 Ga0070682_100041429 3300005337 Bacteria 2838
15 Ga0068868_100216451 3300005338 Bacteria 1602
16 Ga0070671_100297509 3300005355 Archaea 1374
17 Ga0070710_10178529 3300005437 Bacteria 1328
18 Ga0070711_100361894 3300005439 Archaea 1169
19 Ga0070705_100026724 3300005440 Archaea 3144
20 Ga0070705_100394903 3300005440 Bacteria 1022
21 Ga0070694_100018187 3300005444 Bacteria 4458
22 Ga0070708_100011681 3300005445 Archaea 7147
23 Ga0070708_100012389 3300005445 Archaea 6959
24 Ga0070678_100249383 3300005456 Bacteria 1488
25 Ga0070681_10143769 3300005458 Archaea 2315
26 Ga0070707_100044725 3300005468 Archaea 4239
27 Ga0070707_100162230 3300005468 Unclassified 2178
28 Ga0070707_100390697 3300005468 Archaea 1351
29 Ga0070707_100473240 3300005468 Archaea 1214
30 Ga0070698_100189677 3300005471 Archaea 1994
31 Ga0070699_100176010 3300005518 Archaea 1897
32 Ga0070699_100200386 3300005518 Bacteria 1775
33 Ga0070684_100042391 3300005535 Archaea 3928
34 Ga0070684_100105902 3300005535 Bacteria 2517
35 Ga0070697_100175387 3300005536 Bacteria 1816
36 Ga0070672_100470563 3300005543 Archaea 1084
37 Ga0070686_100312230 3300005544 Archaea 1169
38 Ga0070695_100127676 3300005545 Archaea 1748
39 Ga0070696_100307754 3300005546 Archaea 1216
40 Ga0070693_100059495 3300005547 Bacteria 2215
41 Ga0070693_100087036 3300005547 Unclassified 1876
42 Ga0070704_100016732 3300005549 Archaea 4642
43 Ga0070704_100092701 3300005549 Archaea 2255
44 Ga0070664_100540725 3300005564 Archaea 1077
45 Ga0068856_100385769 3300005614 Bacteria 1420
46 Ga0070702_100003279 3300005615 Archaea 7208
47 Ga0070702_100021787 3300005615 Bacteria 3379
48 Ga0068864_100255908 3300005618 Archaea 1627
49 Ga0081455_10001661 3300005937 Archaea 26948
50 Ga0081455_10005202 3300005937 Archaea 14314
51 Ga0081455_10026370 3300005937 Archaea 5346
52 Ga0081455_10167393 3300005937 Archaea 1678
53 Ga0081455_10262979 3300005937 Archaea 1256
54 Ga0081538_10004183 3300005981 Archaea 13394
55 Ga0081538_10007120 3300005981 Archaea 9718
56 Ga0081538_10023261 3300005981 Archaea 4460
57 Ga0081538_10126833 3300005981 Archaea 1211
58 Ga0075432_10003764 3300006058 Archaea 5166
59 Ga0097621_100039055 3300006237 Bacteria 3811
60 Ga0097621_100148735 3300006237 Archaea 2007
61 Ga0075428_100025925 3300006844 Archaea 6492
62 Ga0075428_100226210 3300006844 Archaea 2019
63 Ga0075428_100365519 3300006844 Archaea 1548
64 Ga0075428_100414967 3300006844 Archaea 1442
65 Ga0075430_100000818 3300006846 Archaea 24268
66 Ga0075430_100007545 3300006846 Archaea 9185
67 Ga0075430_100156416 3300006846 Archaea 1897
68 Ga0075430_100259373 3300006846 Archaea 1440
69 Ga0075430_100263233 3300006846 Archaea 1428
70 Ga0075431_100008631 3300006847 Archaea 10206
71 Ga0075431_100042216 3300006847 Archaea 4702
72 Ga0075433_10015238 3300006852 Archaea 6301
73 Ga0075433_10112379 3300006852 Archaea 2416
74 Ga0075433_10215411 3300006852 Archaea 1706
75 Ga0075434_100004632 3300006871 Archaea 12425
76 Ga0075434_100014107 3300006871 Archaea 7631
77 Ga0075434_100222263 3300006871 Archaea 1908
78 Ga0075429_100006569 3300006880 Archaea 10071
79 Ga0075429_100011541 3300006880 Archaea 7662
80 Ga0075429_100014031 3300006880 Archaea 6945
81 Ga0075436_100100149 3300006914 Archaea 2018
82 Ga0075435_100105169 3300007076 Archaea 2343
83 Ga0075435_100203170 3300007076 Archaea 1679
84 Ga0075435_100205128 3300007076 Archaea 1671
85 Ga0075435_100267161 3300007076 Archaea 1458
86 Ga0111539_10015072 3300009094 Archaea 9634
87 Ga0111539_10385394 3300009094 Archaea 1632
88 Ga0111539_10396443 3300009094 Archaea 1607
89 Ga0114129_10001647 3300009147 Archaea 30352
90 Ga0114129_10008082 3300009147 Archaea 14989
91 Ga0114129_10102982 3300009147 Archaea 3947
92 Ga0114129_10220843 3300009147 Archaea 2556
93 Ga0114129_10251823 3300009147 Archaea 2370
94 Ga0114129_10268834 3300009147 Archaea 2282
95 Ga0114129_10279157 3300009147 Archaea 2232
96 Ga0114129_10360561 3300009147 Archaea 1924
97 Ga0114129_10446951 3300009147 Archaea 1696
98 Ga0105239_10099515 3300010375 Bacteria 3215
99 Ga0105239_10711053 3300010375 Archaea 1149
100 Ga0105246_10042249 3300011119 Archaea 3087
101 Ga0105246_10218616 3300011119 Archaea 1492
102 Ga0105246_10441228 3300011119 Archaea 1092
103 Ga0157371_10168948 3300013102 Bacteria 1562
104 Ga0157369_10161520 3300013105 Archaea 2365
105 Ga0157369_10605665 3300013105 Bacteria 1131
106 Ga0157374_10002562 3300013296 Unclassified 15340
107 Ga0157378_10178390 3300013297 Archaea 1997
108 Ga0157372_10032458 3300013307 Archaea 5726
109 Ga0157372_10200857 3300013307 Archaea 2309
110 Ga0157375_10987981 3300013308 Archaea 982
111 Ga0163163_10204300 3300014325 Bacteria 2024
112 Ga0182008_10004101 3300014497 Archaea 8585
113 Ga0182008_10009457 3300014497 Archaea 5258
114 Ga0157377_10111817 3300014745 Bacteria 1643
115 Ga0157376_10375024 3300014969 Bacteria 1369
116 Ga0206355_1489455 3300020076 Archaea 1024
117 Ga0206352_10969824 3300020078 Unclassified 1035
118 Ga0224712_10143497 3300022467 Archaea 1053
119 Ga0224712_10143923 3300022467 Archaea 1051
120 Ga0207647_10199863 3300025904 Archaea 1157
121 Ga0207654_10081705 3300025911 Archaea 1947
122 Ga0207663_10478612 3300025916 Archaea 964
123 Ga0207662_10221053 3300025918 Archaea 1233
124 Ga0207690_10255023 3300025932 Archaea 1357
125 Ga0207661_10224785 3300025944 Bacteria 1660
126 Ga0207678_10087433 3300026067 Archaea 2663
127 Ga0207702_10477703 3300026078 Bacteria 1212
128 Ga0207676_10124152 3300026095 Archaea 2183
129 Ga0207676_10639019 3300026095 Bacteria 1026
130 Ga0207683_10085959 3300026121 Bacteria 2796
131 Ga0207683_10364322 3300026121 Archaea 1327
132 Ga0207428_10000419 3300027907 Archaea 52701
133 Ga0207428_10000926 3300027907 Archaea 32789
134 Ga0207428_10090869 3300027907 Archaea 2371
135 Ga0307408_100126465 3300031548 Archaea 1988
136 Ga0307408_100307507 3300031548 Archaea 1330
137 Ga0307413_10019089 3300031824 Archaea 3613
138 Ga0307413_10159488 3300031824 Archaea 1583
139 Ga0307413_10280285 3300031824 Unclassified 1253
140 Ga0307410_10010705 3300031852 Archaea 5212
141 Ga0307410_10271664 3300031852 Unclassified 1326
142 Ga0307406_10029125 3300031901 Archaea 3342
143 Ga0307406_10104143 3300031901 Archaea 1939
144 Ga0307407_10008103 3300031903 Archaea 4800
145 Ga0307407_10318246 3300031903 Unclassified 1091
146 Ga0307412_10163981 3300031911 Archaea 1655
147 Ga0307409_100017400 3300031995 Archaea 4790
148 Ga0307409_100058650 3300031995 Archaea 2991
149 Ga0307409_100627411 3300031995 Unclassified 1066
150 Ga0307416_100025223 3300032002 Archaea 4354
151 Ga0307416_100431167 3300032002 Archaea 1365
152 Ga0307416_100496767 3300032002 Archaea 1283
153 Ga0307414_10069699 3300032004 Archaea 2529
154 Ga0307414_10113703 3300032004 Unclassified 2067
155 Ga0307414_10223765 3300032004 Archaea 1546
156 Ga0307414_10302800 3300032004 Archaea 1353
157 Ga0307411_10086638 3300032005 Archaea 2173
158 Ga0307411_10374508 3300032005 Archaea 1169
159 Ga0307415_100125328 3300032126 Archaea 1934
160 Ga0373953_0002081 3300035117 Archaea 5969
161 Ga0373954_0000660 3300035118 Archaea 13198
162 Ga0373956_0002147 3300035119 Archaea 8159
163 Ga0373957_0000848 3300035120 Archaea 8004
164 Ga0373955_0002725 3300035172 Archaea 7737
165 Ga0373935_0042222 3300035692 Archaea 2867
166 Ga0373927_0221842 3300035695 Archaea 1242
167 Ga0373933_0001553 3300035724 Archaea 13447
168 Ga0373937_0003474 3300036401 Archaea 13239
169 Ga0242420_002037 3300038996 Archaea 2823
170 Ga0439435_0016325 3300042436 Archaea 1861
171 Ga0439460_0015486 3300042461 Archaea 2020
172 Ga0453683_0025303 3300044673 Unclassified 3773
173 Ga0466964_0205695 3300044706 Archaea 948
174 Ga0466957_0444366 3300044842 Archaea 893
175 Ga0466960_0123844 3300044901 Archaea 1357
176 Ga0495592_0007824 3300046454 Archaea 8010
177 Ga0495651_0010165 3300046462 Archaea 7226
178 Ga0495653_0045456 3300046463 Archaea 3404
179 Ga0495584_0104808 3300046491 Unclassified 1430
180 Ga0495628_0015768 3300046516 Archaea 6308
181 Ga0495652_0004558 3300046529 Archaea 13223
182 Ga0495587_0013536 3300046536 Archaea 5124
183 Ga0495645_0009826 3300046543 Archaea 6694
184 Ga0495667_0009780 3300046559 Archaea 6496
185 Ga0495657_0076906 3300046675 Archaea 2167
186 Ga0495599_0007581 3300046678 Archaea 6587
187 Ga0495646_0010424 3300046680 Archaea 5908
188 Ga0495600_0034288 3300046809 Archaea 3295
189 Ga0495604_0003509 3300047317 Archaea 12501
190 Ga0495680_0021816 3300047322 Archaea 5352
191 Ga0495675_0010780 3300047444 Archaea 5727
192 Ga0495684_0412082 3300047471 Archaea 946
193 Ga0495602_0005545 3300048088 Archaea 13238
194 Ga0496102_0254103 3300048905 Archaea 1657
195 Ga0496106_0084712 3300048909 Bacteria 2439
196 Ga0496106_0497073 3300048909 Bacteria 980
197 Ga0496106_0525746 3300048909 Unclassified 950
198 Ga0496107_0350365 3300048910 Unclassified 1099
199 Ga0496108_0317498 3300048911 Bacteria 1358
200 Ga0496108_0318739 3300048911 Archaea 1355
201 Ga0496110_0377926 3300048913 Archaea 1291
202 Ga0501290_001340 3300049513 Archaea 3405
203 Ga0501291_001794 3300049514 Archaea 2507
204 Ga0501291_003127 3300049514 Archaea 2040
205 Ga0501291_024858 3300049514 Archaea 977
206 Ga0501294_007090 3300049517 Archaea 1080
207 Ga0501298_015044 3300049521 Archaea 1389
208 Ga0501298_029237 3300049521 Archaea 1073
209 Ga0501299_027018 3300049522 Archaea 1087
210 Ga0501031_0027160 3300049568 Archaea 3732
211 Ga0501033_0320533 3300049570 Archaea 1089
212 Ga0501036_0080423 3300049572 Archaea 2755
213 Ga0501037_0122901 3300049573 Archaea 1865
214 Ga0501038_0005675 3300049574 Archaea 11577
215 Ga0501039_0000866 3300049575 Archaea 21914
216 Ga0501039_0476389 3300049575 Archaea 980
217 Ga0501040_0001269 3300049576 Bacteria 16049
218 Ga0501040_0405369 3300049576 Archaea 979
219 Ga0501041_0000195 3300049577 Archaea 27868
220 Ga0501041_0137239 3300049577 Archaea 1524
221 Ga0501042_0005274 3300049578 Archaea 8308
222 Ga0501042_0208200 3300049578 Archaea 1410
223 Ga0501046_0015323 3300049580 Unclassified 6445
224 Ga0501046_0167054 3300049580 Archaea 1653
225 Ga0501046_0278076 3300049580 Archaea 1227
226 Ga0501048_0016406 3300049582 Archaea 5458
227 Ga0501048_0067030 3300049582 Archaea 2538
228 Ga0501069_0085616 3300049585 Archaea 1779
229 Ga0501071_0000328 3300049587 Archaea 22864
230 Ga0501071_0371713 3300049587 Archaea 1089
231 Ga0501072_0000070 3300049588 Archaea 74168
232 Ga0501072_0029575 3300049588 Archaea 4281
233 Ga0501072_0048735 3300049588 Archaea 3335
234 Ga0501074_0151129 3300049590 Archaea 1660
235 Ga0501075_0035300 3300049591 Archaea 3728
236 Ga0501075_0084675 3300049591 Archaea 2401
237 Ga0501076_0000452 3300049592 Archaea 26014
238 Ga0501076_0021914 3300049592 Archaea 4906
239 Ga0501076_0322532 3300049592 Archaea 1267
240 Ga0501076_0396350 3300049592 Archaea 1135
241 Ga0501076_0462028 3300049592 Archaea 1045
242 Ga0501077_0000887 3300049593 Archaea 17983
243 Ga0501077_0209051 3300049593 Archaea 1240
244 Ga0501199_003772 3300049650 Archaea 1467
245 Ga0501199_008443 3300049650 Archaea 1078
246 Ga0501199_008659 3300049650 Archaea 1068
247 Ga0501202_000862 3300049652 Archaea 4614
248 Ga0501202_026516 3300049652 Archaea 1186
249 Ga0501202_035015 3300049652 Archaea 1064
250 Ga0501208_026527 3300049655 Archaea 994
251 Ga0501209_000788 3300049656 Archaea 4068
252 Ga0501209_015814 3300049656 Archaea 1691
253 Ga0501209_031413 3300049656 Archaea 1349
254 Ga0501209_040887 3300049656 Archaea 1225
255 Ga0501211_006348 3300049658 Archaea 1173
256 Ga0501214_000700 3300049659 Archaea 2378
257 Ga0501214_005437 3300049659 Unclassified 1226
258 Ga0501217_004979 3300049661 Archaea 2756
259 Ga0501223_010481 3300049663 Archaea 1863
260 Ga0501224_009641 3300049664 Archaea 1414
261 Ga0501228_000593 3300049666 Archaea 2356
262 Ga0501235_001160 3300049669 Archaea 5537
263 Ga0501243_001648 3300049675 Archaea 3213
264 Ga0501251_004356 3300049681 Archaea 1460
265 Ga0501261_003416 3300049690 Archaea 1950
266 Ga0501221_003193 3300049704 Archaea 2693
267 Ga0501225_0003768 3300049705 Archaea 4559
268 Ga0501234_021577 3300049707 Archaea 1026
269 Ga0501079_0006094 3300049741 Archaea 9038
270 Ga0501079_0165615 3300049741 Archaea 1724
271 Ga0501080_0088080 3300049742 Archaea 2884
272 Ga0501081_0028720 3300049743 Archaea 3755
273 Ga0501081_0319373 3300049743 Archaea 1141
274 Ga0501081_0504023 3300049743 Archaea 902
275 Ga0501265_005309 3300049762 Archaea 1482
276 Ga0501275_002770 3300049772 Archaea 1607
277 Ga0501279_014060 3300049775 Archaea 1100
278 Ga0501283_013641 3300049779 Archaea 1233
279 Ga0501044_0220339 3300049823 Bacteria 1848
280 Ga0501045_0001534 3300049824 Archaea 15386
281 Ga0501045_0013046 3300049824 Archaea 5859
282 Ga0501204_008886 3300049850 Archaea 1154
283 Ga0501212_003961 3300049851 Archaea 1886
284 nmdc:mga05p37_106478_c1 3300050507 Archaea 3450
285 nmdc:mga05p37_11874_c1 3300050507 Archaea 10385
286 nmdc:mga05p37_213298_c1 3300050507 Archaea 2333
287 nmdc:mga05p37_247402_c1 3300050507 Unclassified 2140
288 nmdc:mga05p37_261238_c1 3300050507 Archaea 2072
289 nmdc:mga05p37_350308_c1 3300050507 Archaea 1739
290 nmdc:mga09592_174435_c1 3300050508 Archaea 1859
291 nmdc:mga09592_19977_c1 3300050508 Archaea 5502
292 nmdc:mga09592_2129_c1 3300050508 Archaea 15997
293 nmdc:mga09592_364177_c1 3300050508 Archaea 1251
294 nmdc:mga09592_6669_c1 3300050508 Archaea 9404
295 nmdc:mga0qj67_17380_c1 3300050509 Archaea 5468
296 nmdc:mga0qj67_21847_c1 3300050509 Archaea 4910
297 nmdc:mga0qj67_227921_c1 3300050509 Archaea 1512
298 nmdc:mga0qj67_23449_c1 3300050509 Archaea 4749
299 nmdc:mga0qj67_243667_c1 3300050509 Archaea 1458
300 nmdc:mga06r32_18980_c1 3300050510 Archaea 6304
301 nmdc:mga06r32_199883_c1 3300050510 Archaea 1987
302 nmdc:mga06r32_39588_c1 3300050510 Unclassified 4474
303 nmdc:mga08y16_11302_c3 3300050511 Archaea 7095
304 nmdc:mga08y16_272466_c1 3300050511 Archaea 1747
305 nmdc:mga0n895_194097_c1 3300050512 Unclassified 2062
306 nmdc:mga0n895_224267_c1 3300050512 Archaea 1908
307 nmdc:mga0n895_296382_c1 3300050512 Archaea 1640
308 nmdc:mga0n895_5160_c1 3300050512 Archaea 10866
309 nmdc:mga0n895_63691_c1 3300050512 Archaea 3646
310 nmdc:mga0rr50_16475_c1 3300050513 Archaea 4911
311 nmdc:mga0rr50_226287_c1 3300050513 Archaea 1546
312 nmdc:mga08x19_201515_c1 3300050514 Archaea 1364
313 nmdc:mga08x19_246235_c1 3300050514 Archaea 1233
314 nmdc:mga0a205_10296_c1 3300050515 Archaea 8592
315 nmdc:mga0a205_19836_c1 3300050515 Archaea 6343
316 nmdc:mga0a205_23016_c1 3300050515 Archaea 5908
317 nmdc:mga0a205_237903_c1 3300050515 Archaea 1702
318 nmdc:mga0a205_357775_c1 3300050515 Archaea 1327
319 nmdc:mga0a205_96228_c1 3300050515 Archaea 2860
320 Ga0495619_0002097 3300053085 Archaea 13236
321 Ga0500592_001905 3300053116 Bacteria 3353
322 Ga0500627_0000340 3300053158 Bacteria 12663
323 Ga0500627_0116595 3300053158 Bacteria 1203
324 Ga0501084_0002656 3300054114 Archaea 14406
325 Ga0501084_0101500 3300054114 Archaea 2416
326 Ga0501084_0503920 3300054114 Archaea 1023
327 Ga0587094_022616 3300059513 Archaea 924
328 Ga0501082_0001160 3300060353 Archaea 23208
329 Ga0501082_0230461 3300060353 Archaea 1612
330 Ga0501082_0317027 3300060353 Archaea 1358
331 Ga0530510_0000016 3300061734 Archaea 93784
332 Ga0530510_0006164 3300061734 Archaea 8332
333 Ga0530510_0235781 3300061734 Archaea 1362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0405369 Ga0501040_0405369_187_969 220
2 3300048909 Ga0496106_0497073 Ga0496106_0497073_61_750 229
3 3300044842 Ga0466957_0444366 Ga0466957_0444366_54_782 242
4 3300050515 nmdc:mga0a205_357775_c1 nmdc:mga0a205_357775_c1_551_1279 242
5 3300026121 Ga0207683_10364322 Ga0207683_103643221 245
6 3300035117 Ga0373953_0002081 Ga0373953_0002081_4450_5301 245
7 3300035118 Ga0373954_0000660 Ga0373954_0000660_7837_8688 245
8 3300035119 Ga0373956_0002147 Ga0373956_0002147_7071_7922 245
9 3300035120 Ga0373957_0000848 Ga0373957_0000848_5791_6642 245
10 3300035172 Ga0373955_0002725 Ga0373955_0002725_4439_5290 245
11 3300035692 Ga0373935_0042222 Ga0373935_0042222_1393_2244 245
12 3300035724 Ga0373933_0001553 Ga0373933_0001553_4747_5598 245
13 3300036401 Ga0373937_0003474 Ga0373937_0003474_7850_8701 245
14 3300046454 Ga0495592_0007824 Ga0495592_0007824_2621_3472 245
15 3300046462 Ga0495651_0010165 Ga0495651_0010165_1837_2688 245
16 3300046463 Ga0495653_0045456 Ga0495653_0045456_1426_2259 245
17 3300046516 Ga0495628_0015768 Ga0495628_0015768_3304_4155 245
18 3300046529 Ga0495652_0004558 Ga0495652_0004558_7849_8700 245
19 3300046536 Ga0495587_0013536 Ga0495587_0013536_4226_5077 245
20 3300046543 Ga0495645_0009826 Ga0495645_0009826_1769_2620 245
21 3300046559 Ga0495667_0009780 Ga0495667_0009780_3592_4443 245
22 3300046675 Ga0495657_0076906 Ga0495657_0076906_1079_1930 245
23 3300046678 Ga0495599_0007581 Ga0495599_0007581_1217_2068 245
24 3300046680 Ga0495646_0010424 Ga0495646_0010424_982_1833 245
25 3300046809 Ga0495600_0034288 Ga0495600_0034288_1158_2009 245
26 3300047317 Ga0495604_0003509 Ga0495604_0003509_7246_8097 245
27 3300047322 Ga0495680_0021816 Ga0495680_0021816_3732_4583 245
28 3300047444 Ga0495675_0010780 Ga0495675_0010780_85_936 245
29 3300047471 Ga0495684_0412082 Ga0495684_0412082_16_867 245
30 3300048088 Ga0495602_0005545 Ga0495602_0005545_7850_8701 245
31 3300048909 Ga0496106_0525746 Ga0496106_0525746_72_893 245
32 3300049514 Ga0501291_024858 Ga0501291_024858_145_960 245
33 3300050507 nmdc:mga05p37_106478_c1 nmdc:mga05p37_106478_c1_173_1027 245
34 3300050509 nmdc:mga0qj67_243667_c1 nmdc:mga0qj67_243667_c1_293_1147 245
35 3300053085 Ga0495619_0002097 Ga0495619_0002097_7850_8701 245
36 3300049568 Ga0501031_0027160 Ga0501031_0027160_2154_3095 254
37 3300049587 Ga0501071_0371713 Ga0501071_0371713_70_1011 254
38 3300049588 Ga0501072_0048735 Ga0501072_0048735_492_1433 254
39 3300054114 Ga0501084_0503920 Ga0501084_0503920_48_992 254
40 3300049592 Ga0501076_0322532 Ga0501076_0322532_287_1186 257
41 3300050513 nmdc:mga0rr50_226287_c1 nmdc:mga0rr50_226287_c1_523_1296 257
42 3300049570 Ga0501033_0320533 Ga0501033_0320533_23_967 259
43 3300053116 Ga0500592_001905 Ga0500592_001905_2281_3114 259
44 3300053158 Ga0500627_0000340 Ga0500627_0000340_290_1123 259
45 3300049823 Ga0501044_0220339 Ga0501044_0220339_752_1570 263
46 3300049517 Ga0501294_007090 Ga0501294_007090_175_1041 270
47 3300049650 Ga0501199_008443 Ga0501199_008443_56_922 270
48 3300053158 Ga0500627_0116595 Ga0500627_0116595_73_981 271
49 3300005937 Ga0081455_10262979 Ga0081455_102629791 272
50 3300005468 Ga0070707_100390697 Ga0070707_1003906971 273
51 3300031548 Ga0307408_100126465 Ga0307408_1001264652 273
52 3300031824 Ga0307413_10019089 Ga0307413_100190892 273
53 3300031852 Ga0307410_10010705 Ga0307410_100107053 273
54 3300031901 Ga0307406_10029125 Ga0307406_100291252 273
55 3300031903 Ga0307407_10008103 Ga0307407_100081033 273
56 3300031911 Ga0307412_10163981 Ga0307412_101639812 273
57 3300031995 Ga0307409_100017400 Ga0307409_1000174002 273
58 3300032002 Ga0307416_100025223 Ga0307416_1000252232 273
59 3300032004 Ga0307414_10223765 Ga0307414_102237652 273
60 3300032126 Ga0307415_100125328 Ga0307415_1001253282 273
61 3300049513 Ga0501290_001340 Ga0501290_001340_1078_1974 273
62 3300049514 Ga0501291_003127 Ga0501291_003127_899_1795 273
63 3300049521 Ga0501298_015044 Ga0501298_015044_70_966 273
64 3300049650 Ga0501199_003772 Ga0501199_003772_196_1092 273
65 3300049652 Ga0501202_000862 Ga0501202_000862_1651_2547 273
66 3300049656 Ga0501209_000788 Ga0501209_000788_2259_3155 273
67 3300049658 Ga0501211_006348 Ga0501211_006348_158_1054 273
68 3300049659 Ga0501214_000700 Ga0501214_000700_469_1365 273
69 3300049661 Ga0501217_004979 Ga0501217_004979_1086_1982 273
70 3300049664 Ga0501224_009641 Ga0501224_009641_331_1227 273
71 3300049666 Ga0501228_000593 Ga0501228_000593_868_1764 273
72 3300049669 Ga0501235_001160 Ga0501235_001160_4439_5335 273
73 3300049675 Ga0501243_001648 Ga0501243_001648_2167_3063 273
74 3300049681 Ga0501251_004356 Ga0501251_004356_252_1148 273
75 3300049690 Ga0501261_003416 Ga0501261_003416_458_1354 273
76 3300049704 Ga0501221_003193 Ga0501221_003193_1232_2128 273
77 3300049705 Ga0501225_0003768 Ga0501225_0003768_1861_2757 273
78 3300049762 Ga0501265_005309 Ga0501265_005309_250_1146 273
79 3300049772 Ga0501275_002770 Ga0501275_002770_481_1377 273
80 3300049775 Ga0501279_014060 Ga0501279_014060_55_951 273
81 3300049779 Ga0501283_013641 Ga0501283_013641_142_1038 273
82 3300049851 Ga0501212_003961 Ga0501212_003961_121_1017 273
83 3300006880 Ga0075429_100006569 Ga0075429_1000065692 274
84 3300049656 Ga0501209_015814 Ga0501209_015814_711_1643 274
85 3300006846 Ga0075430_100156416 Ga0075430_1001564161 275
86 3300009147 Ga0114129_10102982 Ga0114129_101029823 275
87 3300049578 Ga0501042_0208200 Ga0501042_0208200_157_1089 275
88 3300049580 Ga0501046_0167054 Ga0501046_0167054_260_1087 275
89 3300049650 Ga0501199_008659 Ga0501199_008659_130_1056 275
90 3300049741 Ga0501079_0165615 Ga0501079_0165615_393_1220 275
91 3300061734 Ga0530510_0235781 Ga0530510_0235781_395_1336 275
92 3300005289 Ga0065704_10078954 Ga0065704_100789541 276
93 3300005518 Ga0070699_100176010 Ga0070699_1001760101 276
94 3300031852 Ga0307410_10271664 Ga0307410_102716641 276
95 3300032004 Ga0307414_10113703 Ga0307414_101137032 276
96 3300035695 Ga0373927_0221842 Ga0373927_0221842_108_971 276
97 3300005355 Ga0070671_100297509 Ga0070671_1002975091 277
98 3300005437 Ga0070710_10178529 Ga0070710_101785292 277
99 3300005439 Ga0070711_100361894 Ga0070711_1003618941 277
100 3300005458 Ga0070681_10143769 Ga0070681_101437691 277
101 3300005535 Ga0070684_100042391 Ga0070684_1000423913 277
102 3300005544 Ga0070686_100312230 Ga0070686_1003122302 277
103 3300005547 Ga0070693_100087036 Ga0070693_1000870362 277
104 3300005564 Ga0070664_100540725 Ga0070664_1005407252 277
105 3300005615 Ga0070702_100003279 Ga0070702_10000327910 277
106 3300005618 Ga0068864_100255908 Ga0068864_1002559082 277
107 3300005937 Ga0081455_10026370 Ga0081455_100263706 277
108 3300006237 Ga0097621_100148735 Ga0097621_1001487351 277
109 3300007076 Ga0075435_100267161 Ga0075435_1002671612 277
110 3300010375 Ga0105239_10711053 Ga0105239_107110531 277
111 3300011119 Ga0105246_10441228 Ga0105246_104412281 277
112 3300013105 Ga0157369_10161520 Ga0157369_101615203 277
113 3300013297 Ga0157378_10178390 Ga0157378_101783902 277
114 3300013307 Ga0157372_10200857 Ga0157372_102008571 277
115 3300013308 Ga0157375_10987981 Ga0157375_109879811 277
116 3300020078 Ga0206352_10969824 Ga0206352_109698241 277
117 3300022467 Ga0224712_10143497 Ga0224712_101434971 277
118 3300025904 Ga0207647_10199863 Ga0207647_101998631 277
119 3300025911 Ga0207654_10081705 Ga0207654_100817051 277
120 3300025916 Ga0207663_10478612 Ga0207663_104786121 277
121 3300025918 Ga0207662_10221053 Ga0207662_102210531 277
122 3300025932 Ga0207690_10255023 Ga0207690_102550231 277
123 3300026067 Ga0207678_10087433 Ga0207678_100874332 277
124 3300026095 Ga0207676_10124152 Ga0207676_101241523 277
125 3300044706 Ga0466964_0205695 Ga0466964_0205695_38_871 277
126 3300048905 Ga0496102_0254103 Ga0496102_0254103_475_1308 277
127 3300048911 Ga0496108_0318739 Ga0496108_0318739_209_1042 277
128 3300048913 Ga0496110_0377926 Ga0496110_0377926_14_847 277
129 3300049514 Ga0501291_001794 Ga0501291_001794_467_1408 277
130 3300049652 Ga0501202_035015 Ga0501202_035015_22_954 277
131 3300049656 Ga0501209_040887 Ga0501209_040887_77_1009 277
132 3300049707 Ga0501234_021577 Ga0501234_021577_53_985 277
133 3300049743 Ga0501081_0504023 Ga0501081_0504023_21_854 277
134 3300050513 nmdc:mga0rr50_16475_c1 nmdc:mga0rr50_16475_c1_415_1248 277
135 3300059513 Ga0587094_022616 Ga0587094_022616_12_845 277
136 3300060353 Ga0501082_0230461 Ga0501082_0230461_571_1404 277
137 3300005290 Ga0065712_10001675 Ga0065712_100016759 278
138 3300005293 Ga0065715_10001862 Ga0065715_100018626 278
139 3300005937 Ga0081455_10005202 Ga0081455_100052027 278
140 3300006058 Ga0075432_10003764 Ga0075432_100037643 278
141 3300006844 Ga0075428_100025925 Ga0075428_1000259257 278
142 3300006844 Ga0075428_100226210 Ga0075428_1002262102 278
143 3300006847 Ga0075431_100008631 Ga0075431_1000086317 278
144 3300006852 Ga0075433_10215411 Ga0075433_102154112 278
145 3300006871 Ga0075434_100004632 Ga0075434_10000463214 278
146 3300006880 Ga0075429_100014031 Ga0075429_1000140315 278
147 3300006914 Ga0075436_100100149 Ga0075436_1001001492 278
148 3300007076 Ga0075435_100105169 Ga0075435_1001051693 278
149 3300009147 Ga0114129_10220843 Ga0114129_102208432 278
150 3300009147 Ga0114129_10251823 Ga0114129_102518232 278
151 3300010375 Ga0105239_10099515 Ga0105239_100995152 278
152 3300013102 Ga0157371_10168948 Ga0157371_101689481 278
153 3300013105 Ga0157369_10605665 Ga0157369_106056651 278
154 3300013296 Ga0157374_10002562 Ga0157374_1000256216 278
155 3300013307 Ga0157372_10032458 Ga0157372_100324586 278
156 3300014325 Ga0163163_10204300 Ga0163163_102043002 278
157 3300014745 Ga0157377_10111817 Ga0157377_101118171 278
158 3300014969 Ga0157376_10375024 Ga0157376_103750242 278
159 3300027907 Ga0207428_10000419 Ga0207428_1000041937 278
160 3300027907 Ga0207428_10000926 Ga0207428_100009265 278
161 3300027907 Ga0207428_10090869 Ga0207428_100908692 278
162 3300042436 Ga0439435_0016325 Ga0439435_0016325_588_1520 278
163 3300042461 Ga0439460_0015486 Ga0439460_0015486_836_1768 278
164 3300048909 Ga0496106_0084712 Ga0496106_0084712_1225_2070 278
165 3300048911 Ga0496108_0317498 Ga0496108_0317498_314_1159 278
166 3300049585 Ga0501069_0085616 Ga0501069_0085616_170_1012 278
167 3300050507 nmdc:mga05p37_11874_c1 nmdc:mga05p37_11874_c1_4870_5727 278
168 3300050507 nmdc:mga05p37_213298_c1 nmdc:mga05p37_213298_c1_634_1476 278
169 3300050508 nmdc:mga09592_19977_c1 nmdc:mga09592_19977_c1_4165_5097 278
170 3300050508 nmdc:mga09592_2129_c1 nmdc:mga09592_2129_c1_3813_4670 278
171 3300050509 nmdc:mga0qj67_23449_c1 nmdc:mga0qj67_23449_c1_3338_4270 278
172 3300050510 nmdc:mga06r32_199883_c1 nmdc:mga06r32_199883_c1_295_1227 278
173 3300050510 nmdc:mga06r32_39588_c1 nmdc:mga06r32_39588_c1_1525_2382 278
174 3300050511 nmdc:mga08y16_11302_c3 nmdc:mga08y16_11302_c3_4617_5474 278
175 3300050512 nmdc:mga0n895_194097_c1 nmdc:mga0n895_194097_c1_338_1195 278
176 3300050512 nmdc:mga0n895_224267_c1 nmdc:mga0n895_224267_c1_459_1301 278
177 3300050514 nmdc:mga08x19_201515_c1 nmdc:mga08x19_201515_c1_375_1217 278
178 3300050515 nmdc:mga0a205_10296_c1 nmdc:mga0a205_10296_c1_607_1449 278
179 3300050515 nmdc:mga0a205_23016_c1 nmdc:mga0a205_23016_c1_2831_3688 278
180 3300003373 JGI25407J50210_10045626 JGI25407J50210_100456261 279
181 3300005290 Ga0065712_10070333 Ga0065712_100703333 279
182 3300005293 Ga0065715_10002710 Ga0065715_1000271010 279
183 3300005293 Ga0065715_10091932 Ga0065715_100919324 279
184 3300005468 Ga0070707_100473240 Ga0070707_1004732401 279
185 3300005471 Ga0070698_100189677 Ga0070698_1001896772 279
186 3300005546 Ga0070696_100307754 Ga0070696_1003077541 279
187 3300005549 Ga0070704_100092701 Ga0070704_1000927011 279
188 3300005937 Ga0081455_10001661 Ga0081455_1000166111 279
189 3300005981 Ga0081538_10007120 Ga0081538_1000712010 279
190 3300006852 Ga0075433_10015238 Ga0075433_100152385 279
191 3300009147 Ga0114129_10001647 Ga0114129_100016478 279
192 3300011119 Ga0105246_10042249 Ga0105246_100422491 279
193 3300014497 Ga0182008_10004101 Ga0182008_100041015 279
194 3300031824 Ga0307413_10159488 Ga0307413_101594882 279
195 3300031903 Ga0307407_10318246 Ga0307407_103182461 279
196 3300031995 Ga0307409_100058650 Ga0307409_1000586503 279
197 3300032002 Ga0307416_100431167 Ga0307416_1004311672 279
198 3300032004 Ga0307414_10302800 Ga0307414_103028002 279
199 3300032005 Ga0307411_10374508 Ga0307411_103745081 279
200 3300038996 Ga0242420_002037 Ga0242420_002037_1852_2781 279
201 3300048910 Ga0496107_0350365 Ga0496107_0350365_163_1089 279
202 3300049572 Ga0501036_0080423 Ga0501036_0080423_1541_2425 279
203 3300049573 Ga0501037_0122901 Ga0501037_0122901_414_1292 279
204 3300049574 Ga0501038_0005675 Ga0501038_0005675_4151_5029 279
205 3300049575 Ga0501039_0000866 Ga0501039_0000866_17900_18778 279
206 3300049575 Ga0501039_0476389 Ga0501039_0476389_40_894 279
207 3300049576 Ga0501040_0001269 Ga0501040_0001269_8519_9397 279
208 3300049577 Ga0501041_0000195 Ga0501041_0000195_21449_22327 279
209 3300049578 Ga0501042_0005274 Ga0501042_0005274_5480_6358 279
210 3300049580 Ga0501046_0015323 Ga0501046_0015323_336_1214 279
211 3300049582 Ga0501048_0016406 Ga0501048_0016406_3352_4230 279
212 3300049587 Ga0501071_0000328 Ga0501071_0000328_640_1518 279
213 3300049588 Ga0501072_0000070 Ga0501072_0000070_51004_51882 279
214 3300049590 Ga0501074_0151129 Ga0501074_0151129_77_955 279
215 3300049591 Ga0501075_0084675 Ga0501075_0084675_1075_1953 279
216 3300049592 Ga0501076_0000452 Ga0501076_0000452_23186_24064 279
217 3300049592 Ga0501076_0462028 Ga0501076_0462028_61_915 279
218 3300049593 Ga0501077_0000887 Ga0501077_0000887_12988_13866 279
219 3300049741 Ga0501079_0006094 Ga0501079_0006094_3971_4849 279
220 3300049742 Ga0501080_0088080 Ga0501080_0088080_762_1640 279
221 3300049743 Ga0501081_0028720 Ga0501081_0028720_908_1786 279
222 3300049824 Ga0501045_0001534 Ga0501045_0001534_4123_5001 279
223 3300050515 nmdc:mga0a205_19836_c1 nmdc:mga0a205_19836_c1_1739_2668 279
224 3300054114 Ga0501084_0002656 Ga0501084_0002656_4758_5636 279
225 3300060353 Ga0501082_0001160 Ga0501082_0001160_14411_15289 279
226 3300061734 Ga0530510_0000016 Ga0530510_0000016_75175_76053 279
227 3300005289 Ga0065704_10086219 Ga0065704_100862195 280
228 3300005440 Ga0070705_100026724 Ga0070705_1000267242 280
229 3300005444 Ga0070694_100018187 Ga0070694_1000181875 280
230 3300005445 Ga0070708_100011681 Ga0070708_1000116816 280
231 3300005445 Ga0070708_100012389 Ga0070708_1000123897 280
232 3300005468 Ga0070707_100044725 Ga0070707_1000447252 280
233 3300005468 Ga0070707_100162230 Ga0070707_1001622302 280
234 3300005543 Ga0070672_100470563 Ga0070672_1004705631 280
235 3300005545 Ga0070695_100127676 Ga0070695_1001276763 280
236 3300005549 Ga0070704_100016732 Ga0070704_1000167322 280
237 3300005937 Ga0081455_10167393 Ga0081455_101673932 280
238 3300005981 Ga0081538_10004183 Ga0081538_1000418323 280
239 3300006844 Ga0075428_100365519 Ga0075428_1003655192 280
240 3300006844 Ga0075428_100414967 Ga0075428_1004149673 280
241 3300006846 Ga0075430_100000818 Ga0075430_10000081826 280
242 3300006846 Ga0075430_100007545 Ga0075430_10000754514 280
243 3300006846 Ga0075430_100259373 Ga0075430_1002593732 280
244 3300006847 Ga0075431_100042216 Ga0075431_1000422164 280
245 3300006880 Ga0075429_100011541 Ga0075429_1000115418 280
246 3300009094 Ga0111539_10015072 Ga0111539_100150722 280
247 3300009094 Ga0111539_10385394 Ga0111539_103853941 280
248 3300009147 Ga0114129_10008082 Ga0114129_100080826 280
249 3300009147 Ga0114129_10268834 Ga0114129_102688341 280
250 3300009147 Ga0114129_10360561 Ga0114129_103605612 280
251 3300009147 Ga0114129_10446951 Ga0114129_104469512 280
252 3300014497 Ga0182008_10009457 Ga0182008_100094573 280
253 3300020076 Ga0206355_1489455 Ga0206355_14894551 280
254 3300022467 Ga0224712_10143923 Ga0224712_101439231 280
255 3300031548 Ga0307408_100307507 Ga0307408_1003075072 280
256 3300031824 Ga0307413_10280285 Ga0307413_102802851 280
257 3300031901 Ga0307406_10104143 Ga0307406_101041431 280
258 3300031995 Ga0307409_100627411 Ga0307409_1006274111 280
259 3300032002 Ga0307416_100496767 Ga0307416_1004967672 280
260 3300032004 Ga0307414_10069699 Ga0307414_100696991 280
261 3300032005 Ga0307411_10086638 Ga0307411_100866381 280
262 3300044673 Ga0453683_0025303 Ga0453683_0025303_1356_2204 280
263 3300049521 Ga0501298_029237 Ga0501298_029237_197_1063 280
264 3300049522 Ga0501299_027018 Ga0501299_027018_115_1068 280
265 3300049577 Ga0501041_0137239 Ga0501041_0137239_537_1502 280
266 3300049580 Ga0501046_0278076 Ga0501046_0278076_57_983 280
267 3300049582 Ga0501048_0067030 Ga0501048_0067030_552_1517 280
268 3300049588 Ga0501072_0029575 Ga0501072_0029575_603_1568 280
269 3300049591 Ga0501075_0035300 Ga0501075_0035300_2134_3099 280
270 3300049592 Ga0501076_0021914 Ga0501076_0021914_3539_4504 280
271 3300049593 Ga0501077_0209051 Ga0501077_0209051_343_1203 280
272 3300049652 Ga0501202_026516 Ga0501202_026516_84_1037 280
273 3300049655 Ga0501208_026527 Ga0501208_026527_23_907 280
274 3300049656 Ga0501209_031413 Ga0501209_031413_426_1292 280
275 3300049659 Ga0501214_005437 Ga0501214_005437_57_947 280
276 3300049663 Ga0501223_010481 Ga0501223_010481_716_1582 280
277 3300049743 Ga0501081_0319373 Ga0501081_0319373_46_1011 280
278 3300049824 Ga0501045_0013046 Ga0501045_0013046_3317_4282 280
279 3300049850 Ga0501204_008886 Ga0501204_008886_64_1017 280
280 3300050507 nmdc:mga05p37_247402_c1 nmdc:mga05p37_247402_c1_121_984 280
281 3300050508 nmdc:mga09592_174435_c1 nmdc:mga09592_174435_c1_638_1606 280
282 3300050508 nmdc:mga09592_364177_c1 nmdc:mga09592_364177_c1_309_1169 280
283 3300050508 nmdc:mga09592_6669_c1 nmdc:mga09592_6669_c1_3560_4420 280
284 3300050509 nmdc:mga0qj67_17380_c1 nmdc:mga0qj67_17380_c1_4274_5242 280
285 3300050509 nmdc:mga0qj67_21847_c1 nmdc:mga0qj67_21847_c1_3695_4555 280
286 3300050510 nmdc:mga06r32_18980_c1 nmdc:mga06r32_18980_c1_4472_5332 280
287 3300050512 nmdc:mga0n895_5160_c1 nmdc:mga0n895_5160_c1_7035_7895 280
288 3300050514 nmdc:mga08x19_246235_c1 nmdc:mga08x19_246235_c1_51_911 280
289 3300054114 Ga0501084_0101500 Ga0501084_0101500_597_1457 280
290 3300060353 Ga0501082_0317027 Ga0501082_0317027_23_988 280
291 3300061734 Ga0530510_0006164 Ga0530510_0006164_6912_7877 280
292 3300046491 Ga0495584_0104808 Ga0495584_0104808_87_932 281
293 3300050507 nmdc:mga05p37_261238_c1 nmdc:mga05p37_261238_c1_337_1230 281
294 3300050515 nmdc:mga0a205_237903_c1 nmdc:mga0a205_237903_c1_53_916 281
295 3300011119 Ga0105246_10218616 Ga0105246_102186161 282
296 3300005329 Ga0070683_100560480 Ga0070683_1005604801 283
297 3300005336 Ga0070680_100089217 Ga0070680_1000892171 283
298 3300005337 Ga0070682_100041429 Ga0070682_1000414292 283
299 3300005338 Ga0068868_100216451 Ga0068868_1002164512 283
300 3300005440 Ga0070705_100394903 Ga0070705_1003949031 283
301 3300005456 Ga0070678_100249383 Ga0070678_1002493831 283
302 3300005535 Ga0070684_100105902 Ga0070684_1001059021 283
303 3300005547 Ga0070693_100059495 Ga0070693_1000594952 283
304 3300005614 Ga0068856_100385769 Ga0068856_1003857691 283
305 3300005615 Ga0070702_100021787 Ga0070702_1000217872 283
306 3300006237 Ga0097621_100039055 Ga0097621_1000390552 283
307 3300006852 Ga0075433_10112379 Ga0075433_101123792 283
308 3300006871 Ga0075434_100222263 Ga0075434_1002222633 283
309 3300007076 Ga0075435_100205128 Ga0075435_1002051281 283
310 3300009094 Ga0111539_10396443 Ga0111539_103964432 283
311 3300009147 Ga0114129_10279157 Ga0114129_102791572 283
312 3300025944 Ga0207661_10224785 Ga0207661_102247851 283
313 3300026078 Ga0207702_10477703 Ga0207702_104777031 283
314 3300026095 Ga0207676_10639019 Ga0207676_106390191 283
315 3300026121 Ga0207683_10085959 Ga0207683_100859591 283
316 3300050507 nmdc:mga05p37_350308_c1 nmdc:mga05p37_350308_c1_339_1190 283
317 3300050511 nmdc:mga08y16_272466_c1 nmdc:mga08y16_272466_c1_375_1226 283
318 3300050512 nmdc:mga0n895_296382_c1 nmdc:mga0n895_296382_c1_289_1140 283
319 3300050515 nmdc:mga0a205_96228_c1 nmdc:mga0a205_96228_c1_1037_1888 283
320 3300006846 Ga0075430_100263233 Ga0075430_1002632332 284
321 3300044901 Ga0466960_0123844 Ga0466960_0123844_356_1327 284
322 3300050509 nmdc:mga0qj67_227921_c1 nmdc:mga0qj67_227921_c1_29_904 284
323 3300003373 JGI25407J50210_10009088 JGI25407J50210_100090883 285
324 3300005536 Ga0070697_100175387 Ga0070697_1001753872 286
325 3300005981 Ga0081538_10023261 Ga0081538_100232615 286
326 3300005981 Ga0081538_10126833 Ga0081538_101268332 286
327 3300005518 Ga0070699_100200386 Ga0070699_1002003863 288
328 3300006871 Ga0075434_100014107 Ga0075434_1000141077 289
329 3300007076 Ga0075435_100203170 Ga0075435_1002031703 289
330 3300049592 Ga0501076_0396350 Ga0501076_0396350_153_1049 289
331 3300050512 nmdc:mga0n895_63691_c1 nmdc:mga0n895_63691_c1_447_1457 289
332 2162886007 SwRhRL2b_contig_817053 SwRhRL2b_0053.00003230 290
333 3300005295 Ga0065707_10003488 Ga0065707_100034883 290

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

35

228

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

41

279

0.94

PF08643

DUF1776

Fungal family of unknown function (DUF1776)

54

248

0.86

PF08659

KR

KR domain

36

213

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9574 15 260
7e6o-assembly1.cif.gz_B crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9522 15 196
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9497 15 262
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9309 15 266
3h7a-assembly1.cif.gz_D crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris 0.93 14 261
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.983 104 196 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9574 15 260 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9557 15 202 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9526 15 171 3.40.50.720
af_P0CU01_2_233_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9441 46 286 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q7FC86-F1-model_v4 Short-chain dehydrogenase/reductase 0.9939 15 254 GO:0016491
AF-A0A654LXI9-F1-model_v4 Cyclopentanol dehydrogenase (EC 1.1.1.163) 0.9926 15 288 GO:0055041
AF-A0A6G1YW08-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9924 45 290 GO:0016491
AF-A0A7D5RE04-F1-model_v4 Short-chain dehydrogenase 0.9882 15 288 GO:0016491
AF-A0A6G1YW08-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9844 45 290 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map