F410989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 332 | 149 | 332 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300031731|Ga0307405_10067871|Ga0307405_100678712 |
| Length | 279 |
| Sequence | MWTRRDTLPKSRRVTRQFHKMHGLGNDFVVLDARQQPVAMTSALAEALADRQLGIGCDQLILLEPSTTADVKMRIWNHDGGEVESCGNASRCVVALTGAKSIETGGGVVEGSSQGSEVEVSLPPPHFAWDEIPLTYPMDTADLPLAWNSLDHPMALNVGNPHLVFFVPDEKAIDLAAIGPSIEHDPAFPDRINVNVASVRDDGIHLRTWERGSGMTLACGTGACATAVAAIVQKKASSPIKVHMRGGELTISWAPGEPIRMRGAATHVFTGEIDLEQFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 101 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 102 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 120 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 121 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 122 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 123 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 124 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 125 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 130 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 137 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 138 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 139 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 140 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 141 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 142 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 143 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 144 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 145 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 146 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 147 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.3 |
| Rhizosphere | 99.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000683 | 3300001904 | Bacteria | 6201 |
| 2 | JGI24746J21847_1005670 | 3300001977 | Bacteria | 1946 |
| 3 | Ga0065715_10092828 | 3300005293 | Bacteria | 4919 |
| 4 | Ga0070658_10003530 | 3300005327 | Bacteria | 12834 |
| 5 | Ga0070658_10005606 | 3300005327 | Bacteria | 10181 |
| 6 | Ga0070658_10071760 | 3300005327 | Bacteria | 2836 |
| 7 | Ga0070658_10112721 | 3300005327 | Bacteria | 2254 |
| 8 | Ga0070658_10442446 | 3300005327 | Bacteria | 1119 |
| 9 | Ga0070658_10541274 | 3300005327 | Bacteria | 1007 |
| 10 | Ga0070683_100035586 | 3300005329 | Bacteria | 4551 |
| 11 | Ga0070670_100006155 | 3300005331 | Bacteria | 10144 |
| 12 | Ga0070670_100077623 | 3300005331 | Bacteria | 2853 |
| 13 | Ga0070677_10000734 | 3300005333 | Bacteria | 10929 |
| 14 | Ga0068869_100109659 | 3300005334 | Bacteria | 2098 |
| 15 | Ga0070680_100089243 | 3300005336 | Bacteria | 2551 |
| 16 | Ga0070660_100000378 | 3300005339 | Bacteria | 29634 |
| 17 | Ga0070660_100009409 | 3300005339 | Bacteria | 6870 |
| 18 | Ga0070660_100065751 | 3300005339 | Bacteria | 2822 |
| 19 | Ga0070660_100308009 | 3300005339 | Bacteria | 1299 |
| 20 | Ga0070661_100022524 | 3300005344 | Bacteria | 4511 |
| 21 | Ga0070661_100118420 | 3300005344 | Bacteria | 1982 |
| 22 | Ga0070692_10139066 | 3300005345 | Bacteria | 1372 |
| 23 | Ga0070692_10161108 | 3300005345 | Bacteria | 1285 |
| 24 | Ga0070668_100011377 | 3300005347 | Bacteria | 6628 |
| 25 | Ga0070669_100002456 | 3300005353 | Bacteria | 13414 |
| 26 | Ga0070669_100023747 | 3300005353 | Bacteria | 4394 |
| 27 | Ga0070675_100008845 | 3300005354 | Bacteria | 7827 |
| 28 | Ga0070675_100162285 | 3300005354 | Bacteria | 1922 |
| 29 | Ga0070671_100014767 | 3300005355 | Bacteria | 6310 |
| 30 | Ga0070671_100153178 | 3300005355 | Bacteria | 1947 |
| 31 | Ga0070671_100231651 | 3300005355 | Bacteria | 1567 |
| 32 | Ga0070671_100317520 | 3300005355 | Bacteria | 1327 |
| 33 | Ga0070674_100131430 | 3300005356 | Bacteria | 1867 |
| 34 | Ga0070673_100040957 | 3300005364 | Bacteria | 3557 |
| 35 | Ga0070659_100069029 | 3300005366 | Bacteria | 2805 |
| 36 | Ga0070659_100076922 | 3300005366 | Bacteria | 2661 |
| 37 | Ga0070659_100248601 | 3300005366 | Bacteria | 1473 |
| 38 | Ga0070667_100000763 | 3300005367 | Bacteria | 30599 |
| 39 | Ga0070667_100007799 | 3300005367 | Bacteria | 8876 |
| 40 | Ga0070663_100026659 | 3300005455 | Bacteria | 3916 |
| 41 | Ga0070663_100070244 | 3300005455 | Bacteria | 2546 |
| 42 | Ga0070663_100132481 | 3300005455 | Bacteria | 1894 |
| 43 | Ga0070678_100025284 | 3300005456 | Bacteria | 3992 |
| 44 | Ga0070662_100002737 | 3300005457 | Bacteria | 10895 |
| 45 | Ga0070662_100019234 | 3300005457 | Bacteria | 4635 |
| 46 | Ga0070662_100279473 | 3300005457 | Bacteria | 1351 |
| 47 | Ga0070681_10025117 | 3300005458 | Bacteria | 5995 |
| 48 | Ga0070681_10314599 | 3300005458 | Bacteria | 1475 |
| 49 | Ga0070679_100173411 | 3300005530 | Bacteria | 2129 |
| 50 | Ga0070679_100767825 | 3300005530 | Bacteria | 907 |
| 51 | Ga0068853_100096316 | 3300005539 | Bacteria | 2611 |
| 52 | Ga0068853_100231442 | 3300005539 | Bacteria | 1691 |
| 53 | Ga0068853_100248476 | 3300005539 | Bacteria | 1632 |
| 54 | Ga0068853_100277765 | 3300005539 | Bacteria | 1544 |
| 55 | Ga0070672_100006190 | 3300005543 | Bacteria | 8014 |
| 56 | Ga0068855_100000480 | 3300005563 | Bacteria | 49187 |
| 57 | Ga0068855_100063453 | 3300005563 | Bacteria | 4311 |
| 58 | Ga0068855_100280475 | 3300005563 | Bacteria | 1850 |
| 59 | Ga0070664_100220704 | 3300005564 | Bacteria | 1696 |
| 60 | Ga0068857_100221152 | 3300005577 | Bacteria | 1730 |
| 61 | Ga0068854_100002927 | 3300005578 | Bacteria | 10595 |
| 62 | Ga0068854_100007829 | 3300005578 | Bacteria | 6839 |
| 63 | Ga0068854_100124291 | 3300005578 | Bacteria | 1963 |
| 64 | Ga0068856_100039421 | 3300005614 | Bacteria | 4638 |
| 65 | Ga0068852_100082161 | 3300005616 | Bacteria | 2862 |
| 66 | Ga0068852_100177750 | 3300005616 | Bacteria | 1999 |
| 67 | Ga0068859_100035333 | 3300005617 | Bacteria | 5014 |
| 68 | Ga0068859_100530668 | 3300005617 | Bacteria | 1272 |
| 69 | Ga0068864_100517352 | 3300005618 | Bacteria | 1150 |
| 70 | Ga0068861_100010154 | 3300005719 | Bacteria | 6531 |
| 71 | Ga0068861_100179083 | 3300005719 | Bacteria | 1763 |
| 72 | Ga0068863_100123583 | 3300005841 | Bacteria | 2469 |
| 73 | Ga0068860_100094957 | 3300005843 | Bacteria | 2842 |
| 74 | Ga0068860_100764891 | 3300005843 | Bacteria | 978 |
| 75 | Ga0068862_100007623 | 3300005844 | Bacteria | 8964 |
| 76 | Ga0068862_100237462 | 3300005844 | Bacteria | 1656 |
| 77 | Ga0068862_100337629 | 3300005844 | Bacteria | 1395 |
| 78 | Ga0081539_10041970 | 3300005985 | Bacteria | 2668 |
| 79 | Ga0075428_100116894 | 3300006844 | Bacteria | 2905 |
| 80 | Ga0075431_100049972 | 3300006847 | Bacteria | 4312 |
| 81 | Ga0097620_100035333 | 3300006931 | Bacteria | 5014 |
| 82 | Ga0097620_100530638 | 3300006931 | Bacteria | 1272 |
| 83 | Ga0105240_10004421 | 3300009093 | Bacteria | 21431 |
| 84 | Ga0105240_10279524 | 3300009093 | Bacteria | 1918 |
| 85 | Ga0111539_10469994 | 3300009094 | Bacteria | 1464 |
| 86 | Ga0105241_10109930 | 3300009174 | Bacteria | 2205 |
| 87 | Ga0105248_10159990 | 3300009177 | Bacteria | 2540 |
| 88 | Ga0105237_10402139 | 3300009545 | Bacteria | 1374 |
| 89 | Ga0105249_10173531 | 3300009553 | Bacteria | 2092 |
| 90 | Ga0105239_10189540 | 3300010375 | Bacteria | 2302 |
| 91 | Ga0157371_10009971 | 3300013102 | Bacteria | 7434 |
| 92 | Ga0157371_10019621 | 3300013102 | Bacteria | 4980 |
| 93 | Ga0157371_10033435 | 3300013102 | Bacteria | 3695 |
| 94 | Ga0157371_10062039 | 3300013102 | Bacteria | 2650 |
| 95 | Ga0157371_10085528 | 3300013102 | Bacteria | 2234 |
| 96 | Ga0157370_10075208 | 3300013104 | Bacteria | 3185 |
| 97 | Ga0157370_10397431 | 3300013104 | Bacteria | 1269 |
| 98 | Ga0157370_10531470 | 3300013104 | Bacteria | 1079 |
| 99 | Ga0157369_10000185 | 3300013105 | Bacteria | 86285 |
| 100 | Ga0157369_10008454 | 3300013105 | Bacteria | 11806 |
| 101 | Ga0157369_10058888 | 3300013105 | Bacteria | 4143 |
| 102 | Ga0157369_10193997 | 3300013105 | Bacteria | 2133 |
| 103 | Ga0157369_10197057 | 3300013105 | Bacteria | 2114 |
| 104 | Ga0163162_10209823 | 3300013306 | Bacteria | 2077 |
| 105 | Ga0163162_10483825 | 3300013306 | Bacteria | 1369 |
| 106 | Ga0157372_10431349 | 3300013307 | Bacteria | 1536 |
| 107 | Ga0157380_10002596 | 3300014326 | Bacteria | 12212 |
| 108 | Ga0157380_10005862 | 3300014326 | Bacteria | 8598 |
| 109 | Ga0157380_10008816 | 3300014326 | Bacteria | 7206 |
| 110 | Ga0163161_10006108 | 3300017792 | Bacteria | 8346 |
| 111 | Ga0197907_10363088 | 3300020069 | Bacteria | 1288 |
| 112 | Ga0207666_1007261 | 3300025271 | Bacteria | 1456 |
| 113 | Ga0207697_10005045 | 3300025315 | Bacteria | 6187 |
| 114 | Ga0207697_10048699 | 3300025315 | Bacteria | 1749 |
| 115 | Ga0207682_10003569 | 3300025893 | Bacteria | 6729 |
| 116 | Ga0207688_10070327 | 3300025901 | Bacteria | 1984 |
| 117 | Ga0207647_10008216 | 3300025904 | Bacteria | 7500 |
| 118 | Ga0207645_10007557 | 3300025907 | Bacteria | 7665 |
| 119 | Ga0207643_10033732 | 3300025908 | Bacteria | 2865 |
| 120 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 121 | Ga0207705_10000131 | 3300025909 | Bacteria | 81639 |
| 122 | Ga0207705_10001308 | 3300025909 | Bacteria | 19980 |
| 123 | Ga0207705_10005607 | 3300025909 | Bacteria | 9379 |
| 124 | Ga0207654_10042401 | 3300025911 | Bacteria | 2575 |
| 125 | Ga0207707_10266894 | 3300025912 | Bacteria | 1484 |
| 126 | Ga0207707_10450516 | 3300025912 | Bacteria | 1101 |
| 127 | Ga0207695_10017848 | 3300025913 | Bacteria | 8226 |
| 128 | Ga0207695_10071775 | 3300025913 | Bacteria | 3536 |
| 129 | Ga0207660_10017556 | 3300025917 | Bacteria | 4756 |
| 130 | Ga0207660_10385452 | 3300025917 | Bacteria | 1127 |
| 131 | Ga0207657_10005362 | 3300025919 | Bacteria | 13431 |
| 132 | Ga0207657_10011998 | 3300025919 | Bacteria | 8570 |
| 133 | Ga0207657_10014079 | 3300025919 | Bacteria | 7827 |
| 134 | Ga0207657_10055419 | 3300025919 | Bacteria | 3424 |
| 135 | Ga0207657_10073034 | 3300025919 | Bacteria | 2900 |
| 136 | Ga0207649_10002482 | 3300025920 | Bacteria | 10310 |
| 137 | Ga0207681_10001934 | 3300025923 | Bacteria | 13274 |
| 138 | Ga0207681_10007817 | 3300025923 | Bacteria | 6550 |
| 139 | Ga0207681_10052604 | 3300025923 | Bacteria | 2762 |
| 140 | Ga0207650_10004848 | 3300025925 | Bacteria | 9191 |
| 141 | Ga0207650_10205500 | 3300025925 | Bacteria | 1579 |
| 142 | Ga0207659_10001721 | 3300025926 | Bacteria | 12974 |
| 143 | Ga0207659_10014533 | 3300025926 | Bacteria | 5080 |
| 144 | Ga0207659_10155051 | 3300025926 | Bacteria | 1792 |
| 145 | Ga0207644_10000452 | 3300025931 | Bacteria | 26514 |
| 146 | Ga0207644_10121439 | 3300025931 | Bacteria | 1989 |
| 147 | Ga0207690_10002067 | 3300025932 | Bacteria | 12299 |
| 148 | Ga0207690_10141917 | 3300025932 | Bacteria | 1771 |
| 149 | Ga0207690_10215734 | 3300025932 | Bacteria | 1465 |
| 150 | Ga0207706_10000187 | 3300025933 | Bacteria | 69090 |
| 151 | Ga0207706_10003204 | 3300025933 | Bacteria | 15707 |
| 152 | Ga0207706_10036104 | 3300025933 | Bacteria | 4391 |
| 153 | Ga0207706_10317283 | 3300025933 | Bacteria | 1357 |
| 154 | Ga0207691_10003907 | 3300025940 | Bacteria | 14475 |
| 155 | Ga0207691_10249572 | 3300025940 | Bacteria | 1532 |
| 156 | Ga0207691_10314081 | 3300025940 | Bacteria | 1344 |
| 157 | Ga0207689_10285083 | 3300025942 | Bacteria | 1368 |
| 158 | Ga0207661_10048878 | 3300025944 | Bacteria | 3364 |
| 159 | Ga0207679_10012419 | 3300025945 | Bacteria | 5554 |
| 160 | Ga0207679_10132535 | 3300025945 | Bacteria | 2002 |
| 161 | Ga0207667_10000586 | 3300025949 | Bacteria | 47384 |
| 162 | Ga0207667_10021254 | 3300025949 | Bacteria | 7193 |
| 163 | Ga0207667_10024405 | 3300025949 | Bacteria | 6638 |
| 164 | Ga0207667_10164626 | 3300025949 | Bacteria | 2280 |
| 165 | Ga0207651_10043650 | 3300025960 | Bacteria | 2994 |
| 166 | Ga0207651_10053486 | 3300025960 | Bacteria | 2760 |
| 167 | Ga0207668_10004109 | 3300025972 | Bacteria | 8547 |
| 168 | Ga0207668_10103754 | 3300025972 | Bacteria | 2118 |
| 169 | Ga0207640_10003065 | 3300025981 | Bacteria | 9004 |
| 170 | Ga0207640_10197028 | 3300025981 | Bacteria | 1523 |
| 171 | Ga0207640_10554761 | 3300025981 | Bacteria | 966 |
| 172 | Ga0207658_10000247 | 3300025986 | Bacteria | 56367 |
| 173 | Ga0207678_10006377 | 3300026067 | Bacteria | 10473 |
| 174 | Ga0207678_10042510 | 3300026067 | Bacteria | 3936 |
| 175 | Ga0207678_10166293 | 3300026067 | Bacteria | 1883 |
| 176 | Ga0207702_10101373 | 3300026078 | Bacteria | 2542 |
| 177 | Ga0207702_10524829 | 3300026078 | Bacteria | 1156 |
| 178 | Ga0207641_10108120 | 3300026088 | Bacteria | 2461 |
| 179 | Ga0207676_10309562 | 3300026095 | Bacteria | 1445 |
| 180 | Ga0207674_10102537 | 3300026116 | Bacteria | 2841 |
| 181 | Ga0207674_10131719 | 3300026116 | Bacteria | 2463 |
| 182 | Ga0207675_100021351 | 3300026118 | Bacteria | 6031 |
| 183 | Ga0207675_100111957 | 3300026118 | Bacteria | 2576 |
| 184 | Ga0207683_10061494 | 3300026121 | Bacteria | 3305 |
| 185 | Ga0207698_10006334 | 3300026142 | Bacteria | 7373 |
| 186 | Ga0207698_10010876 | 3300026142 | Bacteria | 5875 |
| 187 | Ga0209983_1027723 | 3300027665 | Bacteria | 1200 |
| 188 | Ga0209974_10015776 | 3300027876 | Bacteria | 2508 |
| 189 | Ga0268265_10008756 | 3300028380 | Bacteria | 6837 |
| 190 | Ga0268265_10023707 | 3300028380 | Bacteria | 4330 |
| 191 | Ga0268265_10300836 | 3300028380 | Bacteria | 1444 |
| 192 | Ga0268264_10749673 | 3300028381 | Bacteria | 973 |
| 193 | Ga0316181_1124342 | 3300030744 | Bacteria | 1237 |
| 194 | Ga0316182_1035623 | 3300030745 | Bacteria | 1625 |
| 195 | Ga0307408_100088007 | 3300031548 | Bacteria | 2338 |
| 196 | Ga0307408_100100932 | 3300031548 | Bacteria | 2198 |
| 197 | Ga0307408_100109997 | 3300031548 | Bacteria | 2115 |
| 198 | Ga0307408_100183159 | 3300031548 | Bacteria | 1681 |
| 199 | Ga0307408_100341722 | 3300031548 | Bacteria | 1267 |
| 200 | Ga0307405_10000956 | 3300031731 | Bacteria | 11553 |
| 201 | Ga0307405_10067871 | 3300031731 | Bacteria | 2280 |
| 202 | Ga0307405_10122350 | 3300031731 | Bacteria | 1783 |
| 203 | Ga0307405_10252311 | 3300031731 | Bacteria | 1313 |
| 204 | Ga0307413_10011683 | 3300031824 | Bacteria | 4333 |
| 205 | Ga0307413_10012570 | 3300031824 | Bacteria | 4218 |
| 206 | Ga0307413_10048937 | 3300031824 | Bacteria | 2530 |
| 207 | Ga0307413_10083087 | 3300031824 | Bacteria | 2059 |
| 208 | Ga0307413_10183631 | 3300031824 | Bacteria | 1494 |
| 209 | Ga0307413_10208511 | 3300031824 | Bacteria | 1417 |
| 210 | Ga0307413_10289644 | 3300031824 | Bacteria | 1236 |
| 211 | Ga0307410_10001803 | 3300031852 | Bacteria | 9928 |
| 212 | Ga0307410_10005881 | 3300031852 | Bacteria | 6552 |
| 213 | Ga0307410_10034416 | 3300031852 | Bacteria | 3281 |
| 214 | Ga0307410_10059241 | 3300031852 | Bacteria | 2613 |
| 215 | Ga0307410_10108695 | 3300031852 | Bacteria | 2003 |
| 216 | Ga0307410_10547786 | 3300031852 | Bacteria | 958 |
| 217 | Ga0307406_10001163 | 3300031901 | Bacteria | 14718 |
| 218 | Ga0307406_10045643 | 3300031901 | Bacteria | 2752 |
| 219 | Ga0307406_10111030 | 3300031901 | Bacteria | 1888 |
| 220 | Ga0307406_10473127 | 3300031901 | Bacteria | 1010 |
| 221 | Ga0307407_10015599 | 3300031903 | Bacteria | 3762 |
| 222 | Ga0307412_10006564 | 3300031911 | Bacteria | 6586 |
| 223 | Ga0307412_10131837 | 3300031911 | Bacteria | 1816 |
| 224 | Ga0307412_10325009 | 3300031911 | Bacteria | 1225 |
| 225 | Ga0307412_10353660 | 3300031911 | Bacteria | 1180 |
| 226 | Ga0307409_100005166 | 3300031995 | Bacteria | 7463 |
| 227 | Ga0307409_100014267 | 3300031995 | Bacteria | 5159 |
| 228 | Ga0307409_100014276 | 3300031995 | Bacteria | 5157 |
| 229 | Ga0307409_100080333 | 3300031995 | Bacteria | 2631 |
| 230 | Ga0307409_100220296 | 3300031995 | Bacteria | 1712 |
| 231 | Ga0307409_100222173 | 3300031995 | Bacteria | 1706 |
| 232 | Ga0307409_100230860 | 3300031995 | Bacteria | 1677 |
| 233 | Ga0307409_100339126 | 3300031995 | Bacteria | 1413 |
| 234 | Ga0307409_100423228 | 3300031995 | Unclassified | 1278 |
| 235 | Ga0307409_100477355 | 3300031995 | Bacteria | 1209 |
| 236 | Ga0307416_100000539 | 3300032002 | Bacteria | 19259 |
| 237 | Ga0307416_100017224 | 3300032002 | Bacteria | 5047 |
| 238 | Ga0307416_100354430 | 3300032002 | Bacteria | 1486 |
| 239 | Ga0307416_100365247 | 3300032002 | Bacteria | 1467 |
| 240 | Ga0307416_100389145 | 3300032002 | Bacteria | 1427 |
| 241 | Ga0307416_100626435 | 3300032002 | Bacteria | 1158 |
| 242 | Ga0307416_100901455 | 3300032002 | Bacteria | 984 |
| 243 | Ga0307414_10008273 | 3300032004 | Bacteria | 5887 |
| 244 | Ga0307414_10031185 | 3300032004 | Bacteria | 3493 |
| 245 | Ga0307414_10088932 | 3300032004 | Bacteria | 2287 |
| 246 | Ga0307414_10125125 | 3300032004 | Bacteria | 1984 |
| 247 | Ga0307414_10205009 | 3300032004 | Bacteria | 1607 |
| 248 | Ga0307414_10372063 | 3300032004 | Bacteria | 1233 |
| 249 | Ga0307414_10521676 | 3300032004 | Bacteria | 1054 |
| 250 | Ga0307411_10022792 | 3300032005 | Bacteria | 3695 |
| 251 | Ga0307411_10043185 | 3300032005 | Bacteria | 2883 |
| 252 | Ga0307411_10079048 | 3300032005 | Bacteria | 2257 |
| 253 | Ga0307411_10096499 | 3300032005 | Bacteria | 2078 |
| 254 | Ga0307411_10162606 | 3300032005 | Bacteria | 1674 |
| 255 | Ga0307411_10202894 | 3300032005 | Bacteria | 1524 |
| 256 | Ga0307411_10252071 | 3300032005 | Bacteria | 1388 |
| 257 | Ga0307411_10304279 | 3300032005 | Bacteria | 1280 |
| 258 | Ga0307411_10343851 | 3300032005 | Bacteria | 1213 |
| 259 | Ga0307411_10416394 | 3300032005 | Bacteria | 1115 |
| 260 | Ga0307411_10433538 | 3300032005 | Bacteria | 1095 |
| 261 | Ga0307415_100002134 | 3300032126 | Bacteria | 9793 |
| 262 | Ga0307415_100154551 | 3300032126 | Bacteria | 1770 |
| 263 | Ga0307415_100250729 | 3300032126 | Bacteria | 1438 |
| 264 | Ga0307415_100312565 | 3300032126 | Bacteria | 1306 |
| 265 | Ga0395899_0000261 | 3300037312 | Bacteria | 69173 |
| 266 | Ga0395899_0044573 | 3300037312 | Bacteria | 3305 |
| 267 | Ga0395899_0103901 | 3300037312 | Bacteria | 2048 |
| 268 | Ga0395899_0419859 | 3300037312 | Bacteria | 881 |
| 269 | Ga0395900_0000036 | 3300037418 | Bacteria | 250619 |
| 270 | Ga0395900_0000503 | 3300037418 | Bacteria | 54976 |
| 271 | Ga0395900_0026277 | 3300037418 | Bacteria | 5962 |
| 272 | Ga0395900_0029933 | 3300037418 | Bacteria | 5587 |
| 273 | Ga0395900_0088987 | 3300037418 | Bacteria | 3174 |
| 274 | Ga0395900_0093836 | 3300037418 | Bacteria | 3082 |
| 275 | Ga0395900_0106682 | 3300037418 | Bacteria | 2877 |
| 276 | Ga0395900_0123772 | 3300037418 | Bacteria | 2652 |
| 277 | Ga0395900_0147232 | 3300037418 | Bacteria | 2408 |
| 278 | Ga0395900_0296099 | 3300037418 | Bacteria | 1605 |
| 279 | Ga0395900_0358979 | 3300037418 | Bacteria | 1429 |
| 280 | Ga0395898_0011477 | 3300037466 | Bacteria | 9200 |
| 281 | Ga0395898_0019218 | 3300037466 | Bacteria | 6955 |
| 282 | Ga0395898_0020422 | 3300037466 | Bacteria | 6726 |
| 283 | Ga0395898_0185217 | 3300037466 | Bacteria | 1989 |
| 284 | Ga0395905_0005921 | 3300037471 | Bacteria | 12397 |
| 285 | Ga0395905_0064853 | 3300037471 | Bacteria | 3419 |
| 286 | Ga0395905_0151314 | 3300037471 | Bacteria | 2183 |
| 287 | Ga0395905_0183763 | 3300037471 | Bacteria | 1963 |
| 288 | Ga0395905_0590452 | 3300037471 | Bacteria | 1012 |
| 289 | Ga0395901_0000036 | 3300038443 | Bacteria | 214274 |
| 290 | Ga0395901_0000520 | 3300038443 | Bacteria | 44464 |
| 291 | Ga0395901_0064393 | 3300038443 | Bacteria | 3816 |
| 292 | Ga0395901_0065242 | 3300038443 | Bacteria | 3790 |
| 293 | Ga0395901_0124476 | 3300038443 | Bacteria | 2709 |
| 294 | Ga0395901_0185359 | 3300038443 | Bacteria | 2183 |
| 295 | Ga0395901_0288827 | 3300038443 | Bacteria | 1702 |
| 296 | Ga0439436_0063959 | 3300041404 | Bacteria | 1028 |
| 297 | Ga0439445_0000253 | 3300042004 | Bacteria | 10167 |
| 298 | Ga0466969_0032149 | 3300044656 | Bacteria | 2668 |
| 299 | Ga0466966_0000004 | 3300044684 | Bacteria | 223594 |
| 300 | Ga0466966_0005770 | 3300044684 | Bacteria | 8154 |
| 301 | Ga0466961_0001994 | 3300044693 | Bacteria | 12706 |
| 302 | Ga0466963_0007364 | 3300044694 | Bacteria | 6556 |
| 303 | Ga0466963_0010090 | 3300044694 | Bacteria | 5711 |
| 304 | Ga0466970_0003633 | 3300044765 | Bacteria | 7522 |
| 305 | Ga0466957_0001592 | 3300044842 | Bacteria | 11931 |
| 306 | Ga0466959_0163190 | 3300045049 | Bacteria | 1565 |
| 307 | Ga0466959_0366398 | 3300045049 | Bacteria | 981 |
| 308 | Ga0466958_0001099 | 3300045836 | Bacteria | 12466 |
| 309 | Ga0466967_0213001 | 3300045976 | Bacteria | 1833 |
| 310 | Ga0495663_0006082 | 3300046525 | Bacteria | 3337 |
| 311 | Ga0495621_0001509 | 3300046539 | Bacteria | 6042 |
| 312 | Ga0495621_0001791 | 3300046539 | Bacteria | 5644 |
| 313 | Ga0495621_0008741 | 3300046539 | Bacteria | 3046 |
| 314 | Ga0495633_0142346 | 3300046558 | Bacteria | 1109 |
| 315 | Ga0495659_0036834 | 3300046664 | Bacteria | 1730 |
| 316 | Ga0495669_0039150 | 3300046684 | Bacteria | 2099 |
| 317 | Ga0495670_0015548 | 3300046691 | Bacteria | 3739 |
| 318 | Ga0496111_0034991 | 3300048914 | Bacteria | 3588 |
| 319 | Ga0501202_024713 | 3300049652 | Bacteria | 1220 |
| 320 | Ga0501223_019664 | 3300049663 | Bacteria | 1326 |
| 321 | Ga0501249_008850 | 3300049679 | Bacteria | 2091 |
| 322 | Ga0501253_030468 | 3300049683 | Bacteria | 1025 |
| 323 | Ga0501259_010371 | 3300049688 | Bacteria | 1522 |
| 324 | Ga0501225_0019536 | 3300049705 | Bacteria | 1875 |
| 325 | Ga0501245_016587 | 3300049708 | Bacteria | 1118 |
| 326 | Ga0501267_004883 | 3300049764 | Bacteria | 1258 |
| 327 | Ga0501268_019420 | 3300049765 | Bacteria | 1151 |
| 328 | Ga0501273_014049 | 3300049770 | Bacteria | 1027 |
| 329 | nmdc:mga06r32_37406_c1 | 3300050510 | Bacteria | 4590 |
| 330 | nmdc:mga08y16_370608_c1 | 3300050511 | Bacteria | 1469 |
| 331 | nmdc:mga08y16_395552_c1 | 3300050511 | Bacteria | 1415 |
| 332 | Ga0466962_0030177 | 3300061719 | Bacteria | 2595 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100337629 | Ga0068862_1003376292 | 231 |
| 2 | 3300025972 | Ga0207668_10103754 | Ga0207668_101037542 | 231 |
| 3 | 3300028380 | Ga0268265_10300836 | Ga0268265_103008362 | 231 |
| 4 | 3300031901 | Ga0307406_10473127 | Ga0307406_104731272 | 231 |
| 5 | 3300046684 | Ga0495669_0039150 | Ga0495669_0039150_1361_2083 | 231 |
| 6 | 3300050511 | nmdc:mga08y16_395552_c1 | nmdc:mga08y16_395552_c1_13_735 | 231 |
| 7 | 3300031995 | Ga0307409_100423228 | Ga0307409_1004232282 | 240 |
| 8 | 3300046558 | Ga0495633_0142346 | Ga0495633_0142346_26_778 | 241 |
| 9 | 3300030745 | Ga0316182_1035623 | Ga0316182_10356233 | 246 |
| 10 | 3300037418 | Ga0395900_0123772 | Ga0395900_0123772_958_1737 | 246 |
| 11 | 3300005353 | Ga0070669_100023747 | Ga0070669_1000237474 | 248 |
| 12 | 3300005719 | Ga0068861_100179083 | Ga0068861_1001790832 | 248 |
| 13 | 3300009094 | Ga0111539_10469994 | Ga0111539_104699942 | 248 |
| 14 | 3300025923 | Ga0207681_10052604 | Ga0207681_100526042 | 248 |
| 15 | 3300026118 | Ga0207675_100111957 | Ga0207675_1001119573 | 248 |
| 16 | 3300050511 | nmdc:mga08y16_370608_c1 | nmdc:mga08y16_370608_c1_109_888 | 248 |
| 17 | 3300031731 | Ga0307405_10252311 | Ga0307405_102523112 | 249 |
| 18 | 3300032126 | Ga0307415_100154551 | Ga0307415_1001545512 | 249 |
| 19 | 3300001977 | JGI24746J21847_1005670 | JGI24746J21847_10056703 | 250 |
| 20 | 3300005293 | Ga0065715_10092828 | Ga0065715_100928285 | 250 |
| 21 | 3300005331 | Ga0070670_100006155 | Ga0070670_1000061558 | 250 |
| 22 | 3300005331 | Ga0070670_100077623 | Ga0070670_1000776231 | 250 |
| 23 | 3300005333 | Ga0070677_10000734 | Ga0070677_100007342 | 250 |
| 24 | 3300005334 | Ga0068869_100109659 | Ga0068869_1001096593 | 250 |
| 25 | 3300005347 | Ga0070668_100011377 | Ga0070668_1000113776 | 250 |
| 26 | 3300005353 | Ga0070669_100002456 | Ga0070669_1000024566 | 250 |
| 27 | 3300005354 | Ga0070675_100008845 | Ga0070675_1000088454 | 250 |
| 28 | 3300005355 | Ga0070671_100014767 | Ga0070671_1000147674 | 250 |
| 29 | 3300005356 | Ga0070674_100131430 | Ga0070674_1001314302 | 250 |
| 30 | 3300005367 | Ga0070667_100007799 | Ga0070667_10000779910 | 250 |
| 31 | 3300005456 | Ga0070678_100025284 | Ga0070678_1000252842 | 250 |
| 32 | 3300005457 | Ga0070662_100002737 | Ga0070662_1000027378 | 250 |
| 33 | 3300005539 | Ga0068853_100231442 | Ga0068853_1002314421 | 250 |
| 34 | 3300005543 | Ga0070672_100006190 | Ga0070672_1000061905 | 250 |
| 35 | 3300005564 | Ga0070664_100220704 | Ga0070664_1002207042 | 250 |
| 36 | 3300005577 | Ga0068857_100221152 | Ga0068857_1002211522 | 250 |
| 37 | 3300005578 | Ga0068854_100124291 | Ga0068854_1001242912 | 250 |
| 38 | 3300005617 | Ga0068859_100035333 | Ga0068859_1000353334 | 250 |
| 39 | 3300005719 | Ga0068861_100010154 | Ga0068861_1000101543 | 250 |
| 40 | 3300005843 | Ga0068860_100094957 | Ga0068860_1000949572 | 250 |
| 41 | 3300005844 | Ga0068862_100007623 | Ga0068862_1000076235 | 250 |
| 42 | 3300006844 | Ga0075428_100116894 | Ga0075428_1001168943 | 250 |
| 43 | 3300006847 | Ga0075431_100049972 | Ga0075431_1000499721 | 250 |
| 44 | 3300006931 | Ga0097620_100035333 | Ga0097620_1000353334 | 250 |
| 45 | 3300009553 | Ga0105249_10173531 | Ga0105249_101735312 | 250 |
| 46 | 3300013306 | Ga0163162_10483825 | Ga0163162_104838252 | 250 |
| 47 | 3300014326 | Ga0157380_10002596 | Ga0157380_1000259614 | 250 |
| 48 | 3300014326 | Ga0157380_10005862 | Ga0157380_100058627 | 250 |
| 49 | 3300014326 | Ga0157380_10008816 | Ga0157380_100088166 | 250 |
| 50 | 3300025271 | Ga0207666_1007261 | Ga0207666_10072612 | 250 |
| 51 | 3300025315 | Ga0207697_10005045 | Ga0207697_100050452 | 250 |
| 52 | 3300025893 | Ga0207682_10003569 | Ga0207682_100035696 | 250 |
| 53 | 3300025901 | Ga0207688_10070327 | Ga0207688_100703272 | 250 |
| 54 | 3300025907 | Ga0207645_10007557 | Ga0207645_100075575 | 250 |
| 55 | 3300025908 | Ga0207643_10033732 | Ga0207643_100337324 | 250 |
| 56 | 3300025923 | Ga0207681_10001934 | Ga0207681_100019348 | 250 |
| 57 | 3300025925 | Ga0207650_10004848 | Ga0207650_100048488 | 250 |
| 58 | 3300025926 | Ga0207659_10001721 | Ga0207659_1000172115 | 250 |
| 59 | 3300025933 | Ga0207706_10000187 | Ga0207706_1000018764 | 250 |
| 60 | 3300025940 | Ga0207691_10003907 | Ga0207691_1000390712 | 250 |
| 61 | 3300025942 | Ga0207689_10285083 | Ga0207689_102850832 | 250 |
| 62 | 3300025945 | Ga0207679_10012419 | Ga0207679_100124196 | 250 |
| 63 | 3300025960 | Ga0207651_10043650 | Ga0207651_100436502 | 250 |
| 64 | 3300025972 | Ga0207668_10004109 | Ga0207668_1000410910 | 250 |
| 65 | 3300025981 | Ga0207640_10197028 | Ga0207640_101970282 | 250 |
| 66 | 3300026116 | Ga0207674_10102537 | Ga0207674_101025372 | 250 |
| 67 | 3300026118 | Ga0207675_100021351 | Ga0207675_1000213516 | 250 |
| 68 | 3300026121 | Ga0207683_10061494 | Ga0207683_100614942 | 250 |
| 69 | 3300028380 | Ga0268265_10008756 | Ga0268265_100087568 | 250 |
| 70 | 3300028380 | Ga0268265_10023707 | Ga0268265_100237076 | 250 |
| 71 | 3300031824 | Ga0307413_10011683 | Ga0307413_100116832 | 250 |
| 72 | 3300031824 | Ga0307413_10012570 | Ga0307413_100125703 | 250 |
| 73 | 3300031824 | Ga0307413_10289644 | Ga0307413_102896442 | 250 |
| 74 | 3300031852 | Ga0307410_10001803 | Ga0307410_100018036 | 250 |
| 75 | 3300031852 | Ga0307410_10547786 | Ga0307410_105477861 | 250 |
| 76 | 3300031901 | Ga0307406_10111030 | Ga0307406_101110303 | 250 |
| 77 | 3300031995 | Ga0307409_100080333 | Ga0307409_1000803332 | 250 |
| 78 | 3300031995 | Ga0307409_100339126 | Ga0307409_1003391262 | 250 |
| 79 | 3300031995 | Ga0307409_100477355 | Ga0307409_1004773551 | 250 |
| 80 | 3300032002 | Ga0307416_100354430 | Ga0307416_1003544302 | 250 |
| 81 | 3300032002 | Ga0307416_100626435 | Ga0307416_1006264352 | 250 |
| 82 | 3300032004 | Ga0307414_10031185 | Ga0307414_100311854 | 250 |
| 83 | 3300032004 | Ga0307414_10372063 | Ga0307414_103720632 | 250 |
| 84 | 3300032005 | Ga0307411_10416394 | Ga0307411_104163942 | 250 |
| 85 | 3300037312 | Ga0395899_0044573 | Ga0395899_0044573_2045_2824 | 250 |
| 86 | 3300037418 | Ga0395900_0000503 | Ga0395900_0000503_2478_3257 | 250 |
| 87 | 3300037471 | Ga0395905_0005921 | Ga0395905_0005921_5073_5852 | 250 |
| 88 | 3300037471 | Ga0395905_0183763 | Ga0395905_0183763_1020_1799 | 250 |
| 89 | 3300038443 | Ga0395901_0000520 | Ga0395901_0000520_20587_21366 | 250 |
| 90 | 3300042004 | Ga0439445_0000253 | Ga0439445_0000253_5819_6598 | 250 |
| 91 | 3300046525 | Ga0495663_0006082 | Ga0495663_0006082_1466_2245 | 250 |
| 92 | 3300046539 | Ga0495621_0001509 | Ga0495621_0001509_2179_2958 | 250 |
| 93 | 3300046539 | Ga0495621_0001791 | Ga0495621_0001791_3191_3970 | 250 |
| 94 | 3300046539 | Ga0495621_0008741 | Ga0495621_0008741_1953_2732 | 250 |
| 95 | 3300046664 | Ga0495659_0036834 | Ga0495659_0036834_311_1090 | 250 |
| 96 | 3300046691 | Ga0495670_0015548 | Ga0495670_0015548_488_1267 | 250 |
| 97 | 3300049708 | Ga0501245_016587 | Ga0501245_016587_11_790 | 250 |
| 98 | 3300050510 | nmdc:mga06r32_37406_c1 | nmdc:mga06r32_37406_c1_3676_4455 | 250 |
| 99 | 3300005355 | Ga0070671_100317520 | Ga0070671_1003175202 | 253 |
| 100 | 3300005367 | Ga0070667_100000763 | Ga0070667_1000007634 | 253 |
| 101 | 3300005841 | Ga0068863_100123583 | Ga0068863_1001235831 | 253 |
| 102 | 3300005843 | Ga0068860_100764891 | Ga0068860_1007648911 | 253 |
| 103 | 3300025931 | Ga0207644_10121439 | Ga0207644_101214392 | 253 |
| 104 | 3300025986 | Ga0207658_10000247 | Ga0207658_1000024750 | 253 |
| 105 | 3300026088 | Ga0207641_10108120 | Ga0207641_101081201 | 253 |
| 106 | 3300027665 | Ga0209983_1027723 | Ga0209983_10277232 | 253 |
| 107 | 3300027876 | Ga0209974_10015776 | Ga0209974_100157762 | 253 |
| 108 | 3300028381 | Ga0268264_10749673 | Ga0268264_107496731 | 253 |
| 109 | 3300030744 | Ga0316181_1124342 | Ga0316181_11243422 | 253 |
| 110 | 3300031548 | Ga0307408_100109997 | Ga0307408_1001099972 | 253 |
| 111 | 3300031852 | Ga0307410_10034416 | Ga0307410_100344164 | 253 |
| 112 | 3300031911 | Ga0307412_10325009 | Ga0307412_103250092 | 253 |
| 113 | 3300031995 | Ga0307409_100230860 | Ga0307409_1002308602 | 253 |
| 114 | 3300032004 | Ga0307414_10205009 | Ga0307414_102050092 | 253 |
| 115 | 3300032005 | Ga0307411_10252071 | Ga0307411_102520712 | 253 |
| 116 | 3300032126 | Ga0307415_100312565 | Ga0307415_1003125652 | 253 |
| 117 | 3300005327 | Ga0070658_10005606 | Ga0070658_100056066 | 254 |
| 118 | 3300005339 | Ga0070660_100000378 | Ga0070660_10000037812 | 254 |
| 119 | 3300005344 | Ga0070661_100022524 | Ga0070661_1000225243 | 254 |
| 120 | 3300005354 | Ga0070675_100162285 | Ga0070675_1001622852 | 254 |
| 121 | 3300005355 | Ga0070671_100231651 | Ga0070671_1002316512 | 254 |
| 122 | 3300005366 | Ga0070659_100076922 | Ga0070659_1000769223 | 254 |
| 123 | 3300005539 | Ga0068853_100096316 | Ga0068853_1000963164 | 254 |
| 124 | 3300005563 | Ga0068855_100000480 | Ga0068855_10000048027 | 254 |
| 125 | 3300005617 | Ga0068859_100530668 | Ga0068859_1005306682 | 254 |
| 126 | 3300006931 | Ga0097620_100530638 | Ga0097620_1005306382 | 254 |
| 127 | 3300009177 | Ga0105248_10159990 | Ga0105248_101599902 | 254 |
| 128 | 3300013102 | Ga0157371_10009971 | Ga0157371_100099713 | 254 |
| 129 | 3300013102 | Ga0157371_10019621 | Ga0157371_100196216 | 254 |
| 130 | 3300013306 | Ga0163162_10209823 | Ga0163162_102098232 | 254 |
| 131 | 3300017792 | Ga0163161_10006108 | Ga0163161_100061084 | 254 |
| 132 | 3300025909 | Ga0207705_10000131 | Ga0207705_1000013181 | 254 |
| 133 | 3300025919 | Ga0207657_10005362 | Ga0207657_1000536210 | 254 |
| 134 | 3300025932 | Ga0207690_10141917 | Ga0207690_101419172 | 254 |
| 135 | 3300025940 | Ga0207691_10314081 | Ga0207691_103140812 | 254 |
| 136 | 3300025949 | Ga0207667_10000586 | Ga0207667_1000058644 | 254 |
| 137 | 3300048914 | Ga0496111_0034991 | Ga0496111_0034991_511_1311 | 254 |
| 138 | 3300005327 | Ga0070658_10112721 | Ga0070658_101127212 | 255 |
| 139 | 3300013104 | Ga0157370_10397431 | Ga0157370_103974312 | 255 |
| 140 | 3300031731 | Ga0307405_10122350 | Ga0307405_101223502 | 255 |
| 141 | 3300031824 | Ga0307413_10183631 | Ga0307413_101836312 | 255 |
| 142 | 3300031901 | Ga0307406_10045643 | Ga0307406_100456432 | 255 |
| 143 | 3300032002 | Ga0307416_100365247 | Ga0307416_1003652472 | 255 |
| 144 | 3300032004 | Ga0307414_10125125 | Ga0307414_101251252 | 255 |
| 145 | 3300032004 | Ga0307414_10521676 | Ga0307414_105216762 | 255 |
| 146 | 3300037312 | Ga0395899_0000261 | Ga0395899_0000261_52677_53471 | 255 |
| 147 | 3300037418 | Ga0395900_0000036 | Ga0395900_0000036_81416_82210 | 255 |
| 148 | 3300037418 | Ga0395900_0026277 | Ga0395900_0026277_2565_3359 | 255 |
| 149 | 3300037418 | Ga0395900_0029933 | Ga0395900_0029933_1195_1989 | 255 |
| 150 | 3300037466 | Ga0395898_0011477 | Ga0395898_0011477_5377_6171 | 255 |
| 151 | 3300037466 | Ga0395898_0185217 | Ga0395898_0185217_34_828 | 255 |
| 152 | 3300037471 | Ga0395905_0064853 | Ga0395905_0064853_1756_2550 | 255 |
| 153 | 3300037471 | Ga0395905_0590452 | Ga0395905_0590452_95_889 | 255 |
| 154 | 3300038443 | Ga0395901_0000036 | Ga0395901_0000036_137688_138482 | 255 |
| 155 | 3300038443 | Ga0395901_0065242 | Ga0395901_0065242_1228_2022 | 255 |
| 156 | 3300005327 | Ga0070658_10071760 | Ga0070658_100717602 | 256 |
| 157 | 3300005339 | Ga0070660_100065751 | Ga0070660_1000657512 | 256 |
| 158 | 3300005458 | Ga0070681_10314599 | Ga0070681_103145992 | 256 |
| 159 | 3300005539 | Ga0068853_100277765 | Ga0068853_1002777652 | 256 |
| 160 | 3300013104 | Ga0157370_10075208 | Ga0157370_100752082 | 256 |
| 161 | 3300025912 | Ga0207707_10266894 | Ga0207707_102668942 | 256 |
| 162 | 3300025917 | Ga0207660_10017556 | Ga0207660_100175566 | 256 |
| 163 | 3300025919 | Ga0207657_10011998 | Ga0207657_100119983 | 256 |
| 164 | 3300031548 | Ga0307408_100088007 | Ga0307408_1000880072 | 256 |
| 165 | 3300031548 | Ga0307408_100341722 | Ga0307408_1003417222 | 256 |
| 166 | 3300031852 | Ga0307410_10059241 | Ga0307410_100592415 | 256 |
| 167 | 3300031911 | Ga0307412_10131837 | Ga0307412_101318372 | 256 |
| 168 | 3300031911 | Ga0307412_10353660 | Ga0307412_103536602 | 256 |
| 169 | 3300031995 | Ga0307409_100220296 | Ga0307409_1002202962 | 256 |
| 170 | 3300032002 | Ga0307416_100389145 | Ga0307416_1003891451 | 256 |
| 171 | 3300032005 | Ga0307411_10096499 | Ga0307411_100964992 | 256 |
| 172 | 3300032005 | Ga0307411_10304279 | Ga0307411_103042792 | 256 |
| 173 | 3300032005 | Ga0307411_10343851 | Ga0307411_103438512 | 256 |
| 174 | 3300032126 | Ga0307415_100250729 | Ga0307415_1002507292 | 256 |
| 175 | 3300037418 | Ga0395900_0093836 | Ga0395900_0093836_1927_2727 | 256 |
| 176 | 3300049652 | Ga0501202_024713 | Ga0501202_024713_63_860 | 256 |
| 177 | 3300049663 | Ga0501223_019664 | Ga0501223_019664_96_893 | 256 |
| 178 | 3300049679 | Ga0501249_008850 | Ga0501249_008850_1152_1949 | 256 |
| 179 | 3300049683 | Ga0501253_030468 | Ga0501253_030468_53_850 | 256 |
| 180 | 3300049688 | Ga0501259_010371 | Ga0501259_010371_267_1064 | 256 |
| 181 | 3300049705 | Ga0501225_0019536 | Ga0501225_0019536_611_1408 | 256 |
| 182 | 3300049764 | Ga0501267_004883 | Ga0501267_004883_269_1066 | 256 |
| 183 | 3300049765 | Ga0501268_019420 | Ga0501268_019420_243_1040 | 256 |
| 184 | 3300049770 | Ga0501273_014049 | Ga0501273_014049_124_921 | 256 |
| 185 | 3300001904 | JGI24736J21556_1000683 | JGI24736J21556_10006837 | 257 |
| 186 | 3300005327 | Ga0070658_10003530 | Ga0070658_1000353019 | 257 |
| 187 | 3300005327 | Ga0070658_10442446 | Ga0070658_104424461 | 257 |
| 188 | 3300005327 | Ga0070658_10541274 | Ga0070658_105412741 | 257 |
| 189 | 3300005329 | Ga0070683_100035586 | Ga0070683_1000355862 | 257 |
| 190 | 3300005336 | Ga0070680_100089243 | Ga0070680_1000892431 | 257 |
| 191 | 3300005339 | Ga0070660_100009409 | Ga0070660_1000094093 | 257 |
| 192 | 3300005339 | Ga0070660_100308009 | Ga0070660_1003080091 | 257 |
| 193 | 3300005344 | Ga0070661_100118420 | Ga0070661_1001184202 | 257 |
| 194 | 3300005345 | Ga0070692_10139066 | Ga0070692_101390662 | 257 |
| 195 | 3300005345 | Ga0070692_10161108 | Ga0070692_101611082 | 257 |
| 196 | 3300005355 | Ga0070671_100153178 | Ga0070671_1001531782 | 257 |
| 197 | 3300005364 | Ga0070673_100040957 | Ga0070673_1000409572 | 257 |
| 198 | 3300005366 | Ga0070659_100069029 | Ga0070659_1000690293 | 257 |
| 199 | 3300005366 | Ga0070659_100248601 | Ga0070659_1002486012 | 257 |
| 200 | 3300005455 | Ga0070663_100026659 | Ga0070663_1000266592 | 257 |
| 201 | 3300005455 | Ga0070663_100070244 | Ga0070663_1000702442 | 257 |
| 202 | 3300005455 | Ga0070663_100132481 | Ga0070663_1001324812 | 257 |
| 203 | 3300005457 | Ga0070662_100019234 | Ga0070662_1000192345 | 257 |
| 204 | 3300005457 | Ga0070662_100279473 | Ga0070662_1002794732 | 257 |
| 205 | 3300005458 | Ga0070681_10025117 | Ga0070681_100251172 | 257 |
| 206 | 3300005530 | Ga0070679_100173411 | Ga0070679_1001734112 | 257 |
| 207 | 3300005530 | Ga0070679_100767825 | Ga0070679_1007678251 | 257 |
| 208 | 3300005539 | Ga0068853_100248476 | Ga0068853_1002484761 | 257 |
| 209 | 3300005563 | Ga0068855_100063453 | Ga0068855_1000634531 | 257 |
| 210 | 3300005563 | Ga0068855_100280475 | Ga0068855_1002804752 | 257 |
| 211 | 3300005578 | Ga0068854_100002927 | Ga0068854_1000029276 | 257 |
| 212 | 3300005578 | Ga0068854_100007829 | Ga0068854_1000078294 | 257 |
| 213 | 3300005614 | Ga0068856_100039421 | Ga0068856_1000394212 | 257 |
| 214 | 3300005616 | Ga0068852_100082161 | Ga0068852_1000821612 | 257 |
| 215 | 3300005616 | Ga0068852_100177750 | Ga0068852_1001777502 | 257 |
| 216 | 3300005618 | Ga0068864_100517352 | Ga0068864_1005173522 | 257 |
| 217 | 3300005844 | Ga0068862_100237462 | Ga0068862_1002374622 | 257 |
| 218 | 3300005985 | Ga0081539_10041970 | Ga0081539_100419702 | 257 |
| 219 | 3300009093 | Ga0105240_10004421 | Ga0105240_1000442110 | 257 |
| 220 | 3300009093 | Ga0105240_10279524 | Ga0105240_102795242 | 257 |
| 221 | 3300009174 | Ga0105241_10109930 | Ga0105241_101099302 | 257 |
| 222 | 3300009545 | Ga0105237_10402139 | Ga0105237_104021392 | 257 |
| 223 | 3300010375 | Ga0105239_10189540 | Ga0105239_101895403 | 257 |
| 224 | 3300013102 | Ga0157371_10033435 | Ga0157371_100334353 | 257 |
| 225 | 3300013102 | Ga0157371_10062039 | Ga0157371_100620393 | 257 |
| 226 | 3300013102 | Ga0157371_10085528 | Ga0157371_100855281 | 257 |
| 227 | 3300013104 | Ga0157370_10531470 | Ga0157370_105314702 | 257 |
| 228 | 3300013105 | Ga0157369_10000185 | Ga0157369_1000018510 | 257 |
| 229 | 3300013105 | Ga0157369_10008454 | Ga0157369_100084548 | 257 |
| 230 | 3300013105 | Ga0157369_10058888 | Ga0157369_100588885 | 257 |
| 231 | 3300013105 | Ga0157369_10193997 | Ga0157369_101939972 | 257 |
| 232 | 3300013105 | Ga0157369_10197057 | Ga0157369_101970571 | 257 |
| 233 | 3300013307 | Ga0157372_10431349 | Ga0157372_104313492 | 257 |
| 234 | 3300020069 | Ga0197907_10363088 | Ga0197907_103630881 | 257 |
| 235 | 3300025315 | Ga0207697_10048699 | Ga0207697_100486992 | 257 |
| 236 | 3300025904 | Ga0207647_10008216 | Ga0207647_100082163 | 257 |
| 237 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003282 | 257 |
| 238 | 3300025909 | Ga0207705_10001308 | Ga0207705_1000130813 | 257 |
| 239 | 3300025909 | Ga0207705_10005607 | Ga0207705_100056075 | 257 |
| 240 | 3300025911 | Ga0207654_10042401 | Ga0207654_100424012 | 257 |
| 241 | 3300025912 | Ga0207707_10450516 | Ga0207707_104505162 | 257 |
| 242 | 3300025913 | Ga0207695_10017848 | Ga0207695_100178483 | 257 |
| 243 | 3300025913 | Ga0207695_10071775 | Ga0207695_100717752 | 257 |
| 244 | 3300025917 | Ga0207660_10385452 | Ga0207660_103854521 | 257 |
| 245 | 3300025919 | Ga0207657_10014079 | Ga0207657_100140793 | 257 |
| 246 | 3300025919 | Ga0207657_10055419 | Ga0207657_100554194 | 257 |
| 247 | 3300025919 | Ga0207657_10073034 | Ga0207657_100730341 | 257 |
| 248 | 3300025920 | Ga0207649_10002482 | Ga0207649_100024823 | 257 |
| 249 | 3300025923 | Ga0207681_10007817 | Ga0207681_100078176 | 257 |
| 250 | 3300025925 | Ga0207650_10205500 | Ga0207650_102055001 | 257 |
| 251 | 3300025926 | Ga0207659_10014533 | Ga0207659_100145332 | 257 |
| 252 | 3300025926 | Ga0207659_10155051 | Ga0207659_101550512 | 257 |
| 253 | 3300025931 | Ga0207644_10000452 | Ga0207644_1000045227 | 257 |
| 254 | 3300025932 | Ga0207690_10002067 | Ga0207690_100020672 | 257 |
| 255 | 3300025932 | Ga0207690_10215734 | Ga0207690_102157342 | 257 |
| 256 | 3300025933 | Ga0207706_10003204 | Ga0207706_100032046 | 257 |
| 257 | 3300025933 | Ga0207706_10036104 | Ga0207706_100361043 | 257 |
| 258 | 3300025933 | Ga0207706_10317283 | Ga0207706_103172832 | 257 |
| 259 | 3300025940 | Ga0207691_10249572 | Ga0207691_102495722 | 257 |
| 260 | 3300025944 | Ga0207661_10048878 | Ga0207661_100488782 | 257 |
| 261 | 3300025945 | Ga0207679_10132535 | Ga0207679_101325352 | 257 |
| 262 | 3300025949 | Ga0207667_10021254 | Ga0207667_100212544 | 257 |
| 263 | 3300025949 | Ga0207667_10024405 | Ga0207667_100244055 | 257 |
| 264 | 3300025949 | Ga0207667_10164626 | Ga0207667_101646263 | 257 |
| 265 | 3300025960 | Ga0207651_10053486 | Ga0207651_100534862 | 257 |
| 266 | 3300025981 | Ga0207640_10003065 | Ga0207640_100030654 | 257 |
| 267 | 3300025981 | Ga0207640_10554761 | Ga0207640_105547612 | 257 |
| 268 | 3300026067 | Ga0207678_10006377 | Ga0207678_100063772 | 257 |
| 269 | 3300026067 | Ga0207678_10042510 | Ga0207678_100425103 | 257 |
| 270 | 3300026067 | Ga0207678_10166293 | Ga0207678_101662932 | 257 |
| 271 | 3300026078 | Ga0207702_10101373 | Ga0207702_101013732 | 257 |
| 272 | 3300026078 | Ga0207702_10524829 | Ga0207702_105248292 | 257 |
| 273 | 3300026095 | Ga0207676_10309562 | Ga0207676_103095622 | 257 |
| 274 | 3300026116 | Ga0207674_10131719 | Ga0207674_101317191 | 257 |
| 275 | 3300026142 | Ga0207698_10006334 | Ga0207698_100063344 | 257 |
| 276 | 3300026142 | Ga0207698_10010876 | Ga0207698_100108764 | 257 |
| 277 | 3300031548 | Ga0307408_100100932 | Ga0307408_1001009323 | 257 |
| 278 | 3300031548 | Ga0307408_100183159 | Ga0307408_1001831592 | 257 |
| 279 | 3300031731 | Ga0307405_10000956 | Ga0307405_1000095611 | 257 |
| 280 | 3300031731 | Ga0307405_10067871 | Ga0307405_100678712 | 257 |
| 281 | 3300031824 | Ga0307413_10048937 | Ga0307413_100489372 | 257 |
| 282 | 3300031824 | Ga0307413_10083087 | Ga0307413_100830872 | 257 |
| 283 | 3300031824 | Ga0307413_10208511 | Ga0307413_102085111 | 257 |
| 284 | 3300031852 | Ga0307410_10005881 | Ga0307410_100058818 | 257 |
| 285 | 3300031852 | Ga0307410_10108695 | Ga0307410_101086952 | 257 |
| 286 | 3300031901 | Ga0307406_10001163 | Ga0307406_1000116314 | 257 |
| 287 | 3300031903 | Ga0307407_10015599 | Ga0307407_100155995 | 257 |
| 288 | 3300031911 | Ga0307412_10006564 | Ga0307412_100065643 | 257 |
| 289 | 3300031995 | Ga0307409_100005166 | Ga0307409_1000051666 | 257 |
| 290 | 3300031995 | Ga0307409_100014267 | Ga0307409_1000142672 | 257 |
| 291 | 3300031995 | Ga0307409_100014276 | Ga0307409_1000142765 | 257 |
| 292 | 3300031995 | Ga0307409_100222173 | Ga0307409_1002221732 | 257 |
| 293 | 3300032002 | Ga0307416_100000539 | Ga0307416_1000005398 | 257 |
| 294 | 3300032002 | Ga0307416_100017224 | Ga0307416_1000172246 | 257 |
| 295 | 3300032002 | Ga0307416_100901455 | Ga0307416_1009014551 | 257 |
| 296 | 3300032004 | Ga0307414_10008273 | Ga0307414_100082733 | 257 |
| 297 | 3300032004 | Ga0307414_10088932 | Ga0307414_100889323 | 257 |
| 298 | 3300032005 | Ga0307411_10022792 | Ga0307411_100227921 | 257 |
| 299 | 3300032005 | Ga0307411_10043185 | Ga0307411_100431853 | 257 |
| 300 | 3300032005 | Ga0307411_10079048 | Ga0307411_100790482 | 257 |
| 301 | 3300032005 | Ga0307411_10162606 | Ga0307411_101626062 | 257 |
| 302 | 3300032005 | Ga0307411_10202894 | Ga0307411_102028941 | 257 |
| 303 | 3300032005 | Ga0307411_10433538 | Ga0307411_104335381 | 257 |
| 304 | 3300032126 | Ga0307415_100002134 | Ga0307415_1000021348 | 257 |
| 305 | 3300037312 | Ga0395899_0103901 | Ga0395899_0103901_1186_1986 | 257 |
| 306 | 3300037312 | Ga0395899_0419859 | Ga0395899_0419859_63_863 | 257 |
| 307 | 3300037418 | Ga0395900_0088987 | Ga0395900_0088987_2007_2807 | 257 |
| 308 | 3300037418 | Ga0395900_0106682 | Ga0395900_0106682_185_985 | 257 |
| 309 | 3300037418 | Ga0395900_0147232 | Ga0395900_0147232_1580_2380 | 257 |
| 310 | 3300037418 | Ga0395900_0296099 | Ga0395900_0296099_743_1543 | 257 |
| 311 | 3300037418 | Ga0395900_0358979 | Ga0395900_0358979_30_830 | 257 |
| 312 | 3300037466 | Ga0395898_0019218 | Ga0395898_0019218_1911_2711 | 257 |
| 313 | 3300037466 | Ga0395898_0020422 | Ga0395898_0020422_4988_5788 | 257 |
| 314 | 3300037471 | Ga0395905_0151314 | Ga0395905_0151314_1026_1826 | 257 |
| 315 | 3300038443 | Ga0395901_0064393 | Ga0395901_0064393_1078_1878 | 257 |
| 316 | 3300038443 | Ga0395901_0124476 | Ga0395901_0124476_992_1792 | 257 |
| 317 | 3300038443 | Ga0395901_0185359 | Ga0395901_0185359_1151_1951 | 257 |
| 318 | 3300038443 | Ga0395901_0288827 | Ga0395901_0288827_63_863 | 257 |
| 319 | 3300041404 | Ga0439436_0063959 | Ga0439436_0063959_138_938 | 257 |
| 320 | 3300044656 | Ga0466969_0032149 | Ga0466969_0032149_1594_2394 | 257 |
| 321 | 3300044684 | Ga0466966_0000004 | Ga0466966_0000004_134266_135066 | 257 |
| 322 | 3300044684 | Ga0466966_0005770 | Ga0466966_0005770_6030_6830 | 257 |
| 323 | 3300044693 | Ga0466961_0001994 | Ga0466961_0001994_6611_7411 | 257 |
| 324 | 3300044694 | Ga0466963_0007364 | Ga0466963_0007364_1572_2372 | 257 |
| 325 | 3300044694 | Ga0466963_0010090 | Ga0466963_0010090_1194_1994 | 257 |
| 326 | 3300044765 | Ga0466970_0003633 | Ga0466970_0003633_371_1171 | 257 |
| 327 | 3300044842 | Ga0466957_0001592 | Ga0466957_0001592_2483_3283 | 257 |
| 328 | 3300045049 | Ga0466959_0163190 | Ga0466959_0163190_566_1366 | 257 |
| 329 | 3300045049 | Ga0466959_0366398 | Ga0466959_0366398_40_840 | 257 |
| 330 | 3300045836 | Ga0466958_0001099 | Ga0466958_0001099_7431_8231 | 257 |
| 331 | 3300045976 | Ga0466967_0213001 | Ga0466967_0213001_770_1570 | 257 |
| 332 | 3300061719 | Ga0466962_0030177 | Ga0466962_0030177_925_1725 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.8865 | 1 | 250 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.8726 | 2 | 250 |
| 3ejx-assembly5.cif.gz_D | crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap | 0.8604 | 1 | 250 |
| 7vdy-assembly1.cif.gz_B | crystal structure of o-ureidoserine racemase | 0.8442 | 2 | 250 |
| 1gqz-assembly1.cif.gz_A | refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a | 0.8375 | 3 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6K1_1_112_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9335 | 5 | 95 | 3.10.310.10 |
| af_Q55GS8_377_492_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8953 | 140 | 239 | 3.10.310.10 |
| af_I1NA10_49_204_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8914 | 3 | 120 | 3.10.310.10 |
| af_Q58519_1_127_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8892 | 5 | 101 | 3.10.310.10 |
| 3ejxD01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.8708 | 1 | 98 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0S0S5-F1-model_v4 | diaminopimelate epimerase (EC 5.1.1.7) | 0.9823 | 5 | 83 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A3N5HK81-F1-model_v4 | Diaminopimelate epimerase | 0.9813 | 3 | 83 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-X1PSZ4-F1-model_v4 | diaminopimelate epimerase (EC 5.1.1.7) | 0.9648 | 3 | 78 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A7V2T792-F1-model_v4 | diaminopimelate epimerase (EC 5.1.1.7) | 0.9559 | 1 | 85 |
GO:0005829
GO:0008837 GO:0009089 |
| AF-A0A3B9CL21-F1-model_v4 | deleted | 0.9557 | 1 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar