F410989

General Info

Members Datasets Scaffolds Average Seq Length
332 149 332 259

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10067871|Ga0307405_100678712
Length 279
Sequence MWTRRDTLPKSRRVTRQFHKMHGLGNDFVVLDARQQPVAMTSALAEALADRQLGIGCDQLILLEPSTTADVKMRIWNHDGGEVESCGNASRCVVALTGAKSIETGGGVVEGSSQGSEVEVSLPPPHFAWDEIPLTYPMDTADLPLAWNSLDHPMALNVGNPHLVFFVPDEKAIDLAAIGPSIEHDPAFPDRINVNVASVRDDGIHLRTWERGSGMTLACGTGACATAVAAIVQKKASSPIKVHMRGGELTISWAPGEPIRMRGAATHVFTGEIDLEQFA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
101 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
138 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
139 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
140 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
141 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
142 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
143 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
144 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
145 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
146 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 99.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000683 3300001904 Bacteria 6201
2 JGI24746J21847_1005670 3300001977 Bacteria 1946
3 Ga0065715_10092828 3300005293 Bacteria 4919
4 Ga0070658_10003530 3300005327 Bacteria 12834
5 Ga0070658_10005606 3300005327 Bacteria 10181
6 Ga0070658_10071760 3300005327 Bacteria 2836
7 Ga0070658_10112721 3300005327 Bacteria 2254
8 Ga0070658_10442446 3300005327 Bacteria 1119
9 Ga0070658_10541274 3300005327 Bacteria 1007
10 Ga0070683_100035586 3300005329 Bacteria 4551
11 Ga0070670_100006155 3300005331 Bacteria 10144
12 Ga0070670_100077623 3300005331 Bacteria 2853
13 Ga0070677_10000734 3300005333 Bacteria 10929
14 Ga0068869_100109659 3300005334 Bacteria 2098
15 Ga0070680_100089243 3300005336 Bacteria 2551
16 Ga0070660_100000378 3300005339 Bacteria 29634
17 Ga0070660_100009409 3300005339 Bacteria 6870
18 Ga0070660_100065751 3300005339 Bacteria 2822
19 Ga0070660_100308009 3300005339 Bacteria 1299
20 Ga0070661_100022524 3300005344 Bacteria 4511
21 Ga0070661_100118420 3300005344 Bacteria 1982
22 Ga0070692_10139066 3300005345 Bacteria 1372
23 Ga0070692_10161108 3300005345 Bacteria 1285
24 Ga0070668_100011377 3300005347 Bacteria 6628
25 Ga0070669_100002456 3300005353 Bacteria 13414
26 Ga0070669_100023747 3300005353 Bacteria 4394
27 Ga0070675_100008845 3300005354 Bacteria 7827
28 Ga0070675_100162285 3300005354 Bacteria 1922
29 Ga0070671_100014767 3300005355 Bacteria 6310
30 Ga0070671_100153178 3300005355 Bacteria 1947
31 Ga0070671_100231651 3300005355 Bacteria 1567
32 Ga0070671_100317520 3300005355 Bacteria 1327
33 Ga0070674_100131430 3300005356 Bacteria 1867
34 Ga0070673_100040957 3300005364 Bacteria 3557
35 Ga0070659_100069029 3300005366 Bacteria 2805
36 Ga0070659_100076922 3300005366 Bacteria 2661
37 Ga0070659_100248601 3300005366 Bacteria 1473
38 Ga0070667_100000763 3300005367 Bacteria 30599
39 Ga0070667_100007799 3300005367 Bacteria 8876
40 Ga0070663_100026659 3300005455 Bacteria 3916
41 Ga0070663_100070244 3300005455 Bacteria 2546
42 Ga0070663_100132481 3300005455 Bacteria 1894
43 Ga0070678_100025284 3300005456 Bacteria 3992
44 Ga0070662_100002737 3300005457 Bacteria 10895
45 Ga0070662_100019234 3300005457 Bacteria 4635
46 Ga0070662_100279473 3300005457 Bacteria 1351
47 Ga0070681_10025117 3300005458 Bacteria 5995
48 Ga0070681_10314599 3300005458 Bacteria 1475
49 Ga0070679_100173411 3300005530 Bacteria 2129
50 Ga0070679_100767825 3300005530 Bacteria 907
51 Ga0068853_100096316 3300005539 Bacteria 2611
52 Ga0068853_100231442 3300005539 Bacteria 1691
53 Ga0068853_100248476 3300005539 Bacteria 1632
54 Ga0068853_100277765 3300005539 Bacteria 1544
55 Ga0070672_100006190 3300005543 Bacteria 8014
56 Ga0068855_100000480 3300005563 Bacteria 49187
57 Ga0068855_100063453 3300005563 Bacteria 4311
58 Ga0068855_100280475 3300005563 Bacteria 1850
59 Ga0070664_100220704 3300005564 Bacteria 1696
60 Ga0068857_100221152 3300005577 Bacteria 1730
61 Ga0068854_100002927 3300005578 Bacteria 10595
62 Ga0068854_100007829 3300005578 Bacteria 6839
63 Ga0068854_100124291 3300005578 Bacteria 1963
64 Ga0068856_100039421 3300005614 Bacteria 4638
65 Ga0068852_100082161 3300005616 Bacteria 2862
66 Ga0068852_100177750 3300005616 Bacteria 1999
67 Ga0068859_100035333 3300005617 Bacteria 5014
68 Ga0068859_100530668 3300005617 Bacteria 1272
69 Ga0068864_100517352 3300005618 Bacteria 1150
70 Ga0068861_100010154 3300005719 Bacteria 6531
71 Ga0068861_100179083 3300005719 Bacteria 1763
72 Ga0068863_100123583 3300005841 Bacteria 2469
73 Ga0068860_100094957 3300005843 Bacteria 2842
74 Ga0068860_100764891 3300005843 Bacteria 978
75 Ga0068862_100007623 3300005844 Bacteria 8964
76 Ga0068862_100237462 3300005844 Bacteria 1656
77 Ga0068862_100337629 3300005844 Bacteria 1395
78 Ga0081539_10041970 3300005985 Bacteria 2668
79 Ga0075428_100116894 3300006844 Bacteria 2905
80 Ga0075431_100049972 3300006847 Bacteria 4312
81 Ga0097620_100035333 3300006931 Bacteria 5014
82 Ga0097620_100530638 3300006931 Bacteria 1272
83 Ga0105240_10004421 3300009093 Bacteria 21431
84 Ga0105240_10279524 3300009093 Bacteria 1918
85 Ga0111539_10469994 3300009094 Bacteria 1464
86 Ga0105241_10109930 3300009174 Bacteria 2205
87 Ga0105248_10159990 3300009177 Bacteria 2540
88 Ga0105237_10402139 3300009545 Bacteria 1374
89 Ga0105249_10173531 3300009553 Bacteria 2092
90 Ga0105239_10189540 3300010375 Bacteria 2302
91 Ga0157371_10009971 3300013102 Bacteria 7434
92 Ga0157371_10019621 3300013102 Bacteria 4980
93 Ga0157371_10033435 3300013102 Bacteria 3695
94 Ga0157371_10062039 3300013102 Bacteria 2650
95 Ga0157371_10085528 3300013102 Bacteria 2234
96 Ga0157370_10075208 3300013104 Bacteria 3185
97 Ga0157370_10397431 3300013104 Bacteria 1269
98 Ga0157370_10531470 3300013104 Bacteria 1079
99 Ga0157369_10000185 3300013105 Bacteria 86285
100 Ga0157369_10008454 3300013105 Bacteria 11806
101 Ga0157369_10058888 3300013105 Bacteria 4143
102 Ga0157369_10193997 3300013105 Bacteria 2133
103 Ga0157369_10197057 3300013105 Bacteria 2114
104 Ga0163162_10209823 3300013306 Bacteria 2077
105 Ga0163162_10483825 3300013306 Bacteria 1369
106 Ga0157372_10431349 3300013307 Bacteria 1536
107 Ga0157380_10002596 3300014326 Bacteria 12212
108 Ga0157380_10005862 3300014326 Bacteria 8598
109 Ga0157380_10008816 3300014326 Bacteria 7206
110 Ga0163161_10006108 3300017792 Bacteria 8346
111 Ga0197907_10363088 3300020069 Bacteria 1288
112 Ga0207666_1007261 3300025271 Bacteria 1456
113 Ga0207697_10005045 3300025315 Bacteria 6187
114 Ga0207697_10048699 3300025315 Bacteria 1749
115 Ga0207682_10003569 3300025893 Bacteria 6729
116 Ga0207688_10070327 3300025901 Bacteria 1984
117 Ga0207647_10008216 3300025904 Bacteria 7500
118 Ga0207645_10007557 3300025907 Bacteria 7665
119 Ga0207643_10033732 3300025908 Bacteria 2865
120 Ga0207705_10000003 3300025909 Bacteria 709270
121 Ga0207705_10000131 3300025909 Bacteria 81639
122 Ga0207705_10001308 3300025909 Bacteria 19980
123 Ga0207705_10005607 3300025909 Bacteria 9379
124 Ga0207654_10042401 3300025911 Bacteria 2575
125 Ga0207707_10266894 3300025912 Bacteria 1484
126 Ga0207707_10450516 3300025912 Bacteria 1101
127 Ga0207695_10017848 3300025913 Bacteria 8226
128 Ga0207695_10071775 3300025913 Bacteria 3536
129 Ga0207660_10017556 3300025917 Bacteria 4756
130 Ga0207660_10385452 3300025917 Bacteria 1127
131 Ga0207657_10005362 3300025919 Bacteria 13431
132 Ga0207657_10011998 3300025919 Bacteria 8570
133 Ga0207657_10014079 3300025919 Bacteria 7827
134 Ga0207657_10055419 3300025919 Bacteria 3424
135 Ga0207657_10073034 3300025919 Bacteria 2900
136 Ga0207649_10002482 3300025920 Bacteria 10310
137 Ga0207681_10001934 3300025923 Bacteria 13274
138 Ga0207681_10007817 3300025923 Bacteria 6550
139 Ga0207681_10052604 3300025923 Bacteria 2762
140 Ga0207650_10004848 3300025925 Bacteria 9191
141 Ga0207650_10205500 3300025925 Bacteria 1579
142 Ga0207659_10001721 3300025926 Bacteria 12974
143 Ga0207659_10014533 3300025926 Bacteria 5080
144 Ga0207659_10155051 3300025926 Bacteria 1792
145 Ga0207644_10000452 3300025931 Bacteria 26514
146 Ga0207644_10121439 3300025931 Bacteria 1989
147 Ga0207690_10002067 3300025932 Bacteria 12299
148 Ga0207690_10141917 3300025932 Bacteria 1771
149 Ga0207690_10215734 3300025932 Bacteria 1465
150 Ga0207706_10000187 3300025933 Bacteria 69090
151 Ga0207706_10003204 3300025933 Bacteria 15707
152 Ga0207706_10036104 3300025933 Bacteria 4391
153 Ga0207706_10317283 3300025933 Bacteria 1357
154 Ga0207691_10003907 3300025940 Bacteria 14475
155 Ga0207691_10249572 3300025940 Bacteria 1532
156 Ga0207691_10314081 3300025940 Bacteria 1344
157 Ga0207689_10285083 3300025942 Bacteria 1368
158 Ga0207661_10048878 3300025944 Bacteria 3364
159 Ga0207679_10012419 3300025945 Bacteria 5554
160 Ga0207679_10132535 3300025945 Bacteria 2002
161 Ga0207667_10000586 3300025949 Bacteria 47384
162 Ga0207667_10021254 3300025949 Bacteria 7193
163 Ga0207667_10024405 3300025949 Bacteria 6638
164 Ga0207667_10164626 3300025949 Bacteria 2280
165 Ga0207651_10043650 3300025960 Bacteria 2994
166 Ga0207651_10053486 3300025960 Bacteria 2760
167 Ga0207668_10004109 3300025972 Bacteria 8547
168 Ga0207668_10103754 3300025972 Bacteria 2118
169 Ga0207640_10003065 3300025981 Bacteria 9004
170 Ga0207640_10197028 3300025981 Bacteria 1523
171 Ga0207640_10554761 3300025981 Bacteria 966
172 Ga0207658_10000247 3300025986 Bacteria 56367
173 Ga0207678_10006377 3300026067 Bacteria 10473
174 Ga0207678_10042510 3300026067 Bacteria 3936
175 Ga0207678_10166293 3300026067 Bacteria 1883
176 Ga0207702_10101373 3300026078 Bacteria 2542
177 Ga0207702_10524829 3300026078 Bacteria 1156
178 Ga0207641_10108120 3300026088 Bacteria 2461
179 Ga0207676_10309562 3300026095 Bacteria 1445
180 Ga0207674_10102537 3300026116 Bacteria 2841
181 Ga0207674_10131719 3300026116 Bacteria 2463
182 Ga0207675_100021351 3300026118 Bacteria 6031
183 Ga0207675_100111957 3300026118 Bacteria 2576
184 Ga0207683_10061494 3300026121 Bacteria 3305
185 Ga0207698_10006334 3300026142 Bacteria 7373
186 Ga0207698_10010876 3300026142 Bacteria 5875
187 Ga0209983_1027723 3300027665 Bacteria 1200
188 Ga0209974_10015776 3300027876 Bacteria 2508
189 Ga0268265_10008756 3300028380 Bacteria 6837
190 Ga0268265_10023707 3300028380 Bacteria 4330
191 Ga0268265_10300836 3300028380 Bacteria 1444
192 Ga0268264_10749673 3300028381 Bacteria 973
193 Ga0316181_1124342 3300030744 Bacteria 1237
194 Ga0316182_1035623 3300030745 Bacteria 1625
195 Ga0307408_100088007 3300031548 Bacteria 2338
196 Ga0307408_100100932 3300031548 Bacteria 2198
197 Ga0307408_100109997 3300031548 Bacteria 2115
198 Ga0307408_100183159 3300031548 Bacteria 1681
199 Ga0307408_100341722 3300031548 Bacteria 1267
200 Ga0307405_10000956 3300031731 Bacteria 11553
201 Ga0307405_10067871 3300031731 Bacteria 2280
202 Ga0307405_10122350 3300031731 Bacteria 1783
203 Ga0307405_10252311 3300031731 Bacteria 1313
204 Ga0307413_10011683 3300031824 Bacteria 4333
205 Ga0307413_10012570 3300031824 Bacteria 4218
206 Ga0307413_10048937 3300031824 Bacteria 2530
207 Ga0307413_10083087 3300031824 Bacteria 2059
208 Ga0307413_10183631 3300031824 Bacteria 1494
209 Ga0307413_10208511 3300031824 Bacteria 1417
210 Ga0307413_10289644 3300031824 Bacteria 1236
211 Ga0307410_10001803 3300031852 Bacteria 9928
212 Ga0307410_10005881 3300031852 Bacteria 6552
213 Ga0307410_10034416 3300031852 Bacteria 3281
214 Ga0307410_10059241 3300031852 Bacteria 2613
215 Ga0307410_10108695 3300031852 Bacteria 2003
216 Ga0307410_10547786 3300031852 Bacteria 958
217 Ga0307406_10001163 3300031901 Bacteria 14718
218 Ga0307406_10045643 3300031901 Bacteria 2752
219 Ga0307406_10111030 3300031901 Bacteria 1888
220 Ga0307406_10473127 3300031901 Bacteria 1010
221 Ga0307407_10015599 3300031903 Bacteria 3762
222 Ga0307412_10006564 3300031911 Bacteria 6586
223 Ga0307412_10131837 3300031911 Bacteria 1816
224 Ga0307412_10325009 3300031911 Bacteria 1225
225 Ga0307412_10353660 3300031911 Bacteria 1180
226 Ga0307409_100005166 3300031995 Bacteria 7463
227 Ga0307409_100014267 3300031995 Bacteria 5159
228 Ga0307409_100014276 3300031995 Bacteria 5157
229 Ga0307409_100080333 3300031995 Bacteria 2631
230 Ga0307409_100220296 3300031995 Bacteria 1712
231 Ga0307409_100222173 3300031995 Bacteria 1706
232 Ga0307409_100230860 3300031995 Bacteria 1677
233 Ga0307409_100339126 3300031995 Bacteria 1413
234 Ga0307409_100423228 3300031995 Unclassified 1278
235 Ga0307409_100477355 3300031995 Bacteria 1209
236 Ga0307416_100000539 3300032002 Bacteria 19259
237 Ga0307416_100017224 3300032002 Bacteria 5047
238 Ga0307416_100354430 3300032002 Bacteria 1486
239 Ga0307416_100365247 3300032002 Bacteria 1467
240 Ga0307416_100389145 3300032002 Bacteria 1427
241 Ga0307416_100626435 3300032002 Bacteria 1158
242 Ga0307416_100901455 3300032002 Bacteria 984
243 Ga0307414_10008273 3300032004 Bacteria 5887
244 Ga0307414_10031185 3300032004 Bacteria 3493
245 Ga0307414_10088932 3300032004 Bacteria 2287
246 Ga0307414_10125125 3300032004 Bacteria 1984
247 Ga0307414_10205009 3300032004 Bacteria 1607
248 Ga0307414_10372063 3300032004 Bacteria 1233
249 Ga0307414_10521676 3300032004 Bacteria 1054
250 Ga0307411_10022792 3300032005 Bacteria 3695
251 Ga0307411_10043185 3300032005 Bacteria 2883
252 Ga0307411_10079048 3300032005 Bacteria 2257
253 Ga0307411_10096499 3300032005 Bacteria 2078
254 Ga0307411_10162606 3300032005 Bacteria 1674
255 Ga0307411_10202894 3300032005 Bacteria 1524
256 Ga0307411_10252071 3300032005 Bacteria 1388
257 Ga0307411_10304279 3300032005 Bacteria 1280
258 Ga0307411_10343851 3300032005 Bacteria 1213
259 Ga0307411_10416394 3300032005 Bacteria 1115
260 Ga0307411_10433538 3300032005 Bacteria 1095
261 Ga0307415_100002134 3300032126 Bacteria 9793
262 Ga0307415_100154551 3300032126 Bacteria 1770
263 Ga0307415_100250729 3300032126 Bacteria 1438
264 Ga0307415_100312565 3300032126 Bacteria 1306
265 Ga0395899_0000261 3300037312 Bacteria 69173
266 Ga0395899_0044573 3300037312 Bacteria 3305
267 Ga0395899_0103901 3300037312 Bacteria 2048
268 Ga0395899_0419859 3300037312 Bacteria 881
269 Ga0395900_0000036 3300037418 Bacteria 250619
270 Ga0395900_0000503 3300037418 Bacteria 54976
271 Ga0395900_0026277 3300037418 Bacteria 5962
272 Ga0395900_0029933 3300037418 Bacteria 5587
273 Ga0395900_0088987 3300037418 Bacteria 3174
274 Ga0395900_0093836 3300037418 Bacteria 3082
275 Ga0395900_0106682 3300037418 Bacteria 2877
276 Ga0395900_0123772 3300037418 Bacteria 2652
277 Ga0395900_0147232 3300037418 Bacteria 2408
278 Ga0395900_0296099 3300037418 Bacteria 1605
279 Ga0395900_0358979 3300037418 Bacteria 1429
280 Ga0395898_0011477 3300037466 Bacteria 9200
281 Ga0395898_0019218 3300037466 Bacteria 6955
282 Ga0395898_0020422 3300037466 Bacteria 6726
283 Ga0395898_0185217 3300037466 Bacteria 1989
284 Ga0395905_0005921 3300037471 Bacteria 12397
285 Ga0395905_0064853 3300037471 Bacteria 3419
286 Ga0395905_0151314 3300037471 Bacteria 2183
287 Ga0395905_0183763 3300037471 Bacteria 1963
288 Ga0395905_0590452 3300037471 Bacteria 1012
289 Ga0395901_0000036 3300038443 Bacteria 214274
290 Ga0395901_0000520 3300038443 Bacteria 44464
291 Ga0395901_0064393 3300038443 Bacteria 3816
292 Ga0395901_0065242 3300038443 Bacteria 3790
293 Ga0395901_0124476 3300038443 Bacteria 2709
294 Ga0395901_0185359 3300038443 Bacteria 2183
295 Ga0395901_0288827 3300038443 Bacteria 1702
296 Ga0439436_0063959 3300041404 Bacteria 1028
297 Ga0439445_0000253 3300042004 Bacteria 10167
298 Ga0466969_0032149 3300044656 Bacteria 2668
299 Ga0466966_0000004 3300044684 Bacteria 223594
300 Ga0466966_0005770 3300044684 Bacteria 8154
301 Ga0466961_0001994 3300044693 Bacteria 12706
302 Ga0466963_0007364 3300044694 Bacteria 6556
303 Ga0466963_0010090 3300044694 Bacteria 5711
304 Ga0466970_0003633 3300044765 Bacteria 7522
305 Ga0466957_0001592 3300044842 Bacteria 11931
306 Ga0466959_0163190 3300045049 Bacteria 1565
307 Ga0466959_0366398 3300045049 Bacteria 981
308 Ga0466958_0001099 3300045836 Bacteria 12466
309 Ga0466967_0213001 3300045976 Bacteria 1833
310 Ga0495663_0006082 3300046525 Bacteria 3337
311 Ga0495621_0001509 3300046539 Bacteria 6042
312 Ga0495621_0001791 3300046539 Bacteria 5644
313 Ga0495621_0008741 3300046539 Bacteria 3046
314 Ga0495633_0142346 3300046558 Bacteria 1109
315 Ga0495659_0036834 3300046664 Bacteria 1730
316 Ga0495669_0039150 3300046684 Bacteria 2099
317 Ga0495670_0015548 3300046691 Bacteria 3739
318 Ga0496111_0034991 3300048914 Bacteria 3588
319 Ga0501202_024713 3300049652 Bacteria 1220
320 Ga0501223_019664 3300049663 Bacteria 1326
321 Ga0501249_008850 3300049679 Bacteria 2091
322 Ga0501253_030468 3300049683 Bacteria 1025
323 Ga0501259_010371 3300049688 Bacteria 1522
324 Ga0501225_0019536 3300049705 Bacteria 1875
325 Ga0501245_016587 3300049708 Bacteria 1118
326 Ga0501267_004883 3300049764 Bacteria 1258
327 Ga0501268_019420 3300049765 Bacteria 1151
328 Ga0501273_014049 3300049770 Bacteria 1027
329 nmdc:mga06r32_37406_c1 3300050510 Bacteria 4590
330 nmdc:mga08y16_370608_c1 3300050511 Bacteria 1469
331 nmdc:mga08y16_395552_c1 3300050511 Bacteria 1415
332 Ga0466962_0030177 3300061719 Bacteria 2595

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100337629 Ga0068862_1003376292 231
2 3300025972 Ga0207668_10103754 Ga0207668_101037542 231
3 3300028380 Ga0268265_10300836 Ga0268265_103008362 231
4 3300031901 Ga0307406_10473127 Ga0307406_104731272 231
5 3300046684 Ga0495669_0039150 Ga0495669_0039150_1361_2083 231
6 3300050511 nmdc:mga08y16_395552_c1 nmdc:mga08y16_395552_c1_13_735 231
7 3300031995 Ga0307409_100423228 Ga0307409_1004232282 240
8 3300046558 Ga0495633_0142346 Ga0495633_0142346_26_778 241
9 3300030745 Ga0316182_1035623 Ga0316182_10356233 246
10 3300037418 Ga0395900_0123772 Ga0395900_0123772_958_1737 246
11 3300005353 Ga0070669_100023747 Ga0070669_1000237474 248
12 3300005719 Ga0068861_100179083 Ga0068861_1001790832 248
13 3300009094 Ga0111539_10469994 Ga0111539_104699942 248
14 3300025923 Ga0207681_10052604 Ga0207681_100526042 248
15 3300026118 Ga0207675_100111957 Ga0207675_1001119573 248
16 3300050511 nmdc:mga08y16_370608_c1 nmdc:mga08y16_370608_c1_109_888 248
17 3300031731 Ga0307405_10252311 Ga0307405_102523112 249
18 3300032126 Ga0307415_100154551 Ga0307415_1001545512 249
19 3300001977 JGI24746J21847_1005670 JGI24746J21847_10056703 250
20 3300005293 Ga0065715_10092828 Ga0065715_100928285 250
21 3300005331 Ga0070670_100006155 Ga0070670_1000061558 250
22 3300005331 Ga0070670_100077623 Ga0070670_1000776231 250
23 3300005333 Ga0070677_10000734 Ga0070677_100007342 250
24 3300005334 Ga0068869_100109659 Ga0068869_1001096593 250
25 3300005347 Ga0070668_100011377 Ga0070668_1000113776 250
26 3300005353 Ga0070669_100002456 Ga0070669_1000024566 250
27 3300005354 Ga0070675_100008845 Ga0070675_1000088454 250
28 3300005355 Ga0070671_100014767 Ga0070671_1000147674 250
29 3300005356 Ga0070674_100131430 Ga0070674_1001314302 250
30 3300005367 Ga0070667_100007799 Ga0070667_10000779910 250
31 3300005456 Ga0070678_100025284 Ga0070678_1000252842 250
32 3300005457 Ga0070662_100002737 Ga0070662_1000027378 250
33 3300005539 Ga0068853_100231442 Ga0068853_1002314421 250
34 3300005543 Ga0070672_100006190 Ga0070672_1000061905 250
35 3300005564 Ga0070664_100220704 Ga0070664_1002207042 250
36 3300005577 Ga0068857_100221152 Ga0068857_1002211522 250
37 3300005578 Ga0068854_100124291 Ga0068854_1001242912 250
38 3300005617 Ga0068859_100035333 Ga0068859_1000353334 250
39 3300005719 Ga0068861_100010154 Ga0068861_1000101543 250
40 3300005843 Ga0068860_100094957 Ga0068860_1000949572 250
41 3300005844 Ga0068862_100007623 Ga0068862_1000076235 250
42 3300006844 Ga0075428_100116894 Ga0075428_1001168943 250
43 3300006847 Ga0075431_100049972 Ga0075431_1000499721 250
44 3300006931 Ga0097620_100035333 Ga0097620_1000353334 250
45 3300009553 Ga0105249_10173531 Ga0105249_101735312 250
46 3300013306 Ga0163162_10483825 Ga0163162_104838252 250
47 3300014326 Ga0157380_10002596 Ga0157380_1000259614 250
48 3300014326 Ga0157380_10005862 Ga0157380_100058627 250
49 3300014326 Ga0157380_10008816 Ga0157380_100088166 250
50 3300025271 Ga0207666_1007261 Ga0207666_10072612 250
51 3300025315 Ga0207697_10005045 Ga0207697_100050452 250
52 3300025893 Ga0207682_10003569 Ga0207682_100035696 250
53 3300025901 Ga0207688_10070327 Ga0207688_100703272 250
54 3300025907 Ga0207645_10007557 Ga0207645_100075575 250
55 3300025908 Ga0207643_10033732 Ga0207643_100337324 250
56 3300025923 Ga0207681_10001934 Ga0207681_100019348 250
57 3300025925 Ga0207650_10004848 Ga0207650_100048488 250
58 3300025926 Ga0207659_10001721 Ga0207659_1000172115 250
59 3300025933 Ga0207706_10000187 Ga0207706_1000018764 250
60 3300025940 Ga0207691_10003907 Ga0207691_1000390712 250
61 3300025942 Ga0207689_10285083 Ga0207689_102850832 250
62 3300025945 Ga0207679_10012419 Ga0207679_100124196 250
63 3300025960 Ga0207651_10043650 Ga0207651_100436502 250
64 3300025972 Ga0207668_10004109 Ga0207668_1000410910 250
65 3300025981 Ga0207640_10197028 Ga0207640_101970282 250
66 3300026116 Ga0207674_10102537 Ga0207674_101025372 250
67 3300026118 Ga0207675_100021351 Ga0207675_1000213516 250
68 3300026121 Ga0207683_10061494 Ga0207683_100614942 250
69 3300028380 Ga0268265_10008756 Ga0268265_100087568 250
70 3300028380 Ga0268265_10023707 Ga0268265_100237076 250
71 3300031824 Ga0307413_10011683 Ga0307413_100116832 250
72 3300031824 Ga0307413_10012570 Ga0307413_100125703 250
73 3300031824 Ga0307413_10289644 Ga0307413_102896442 250
74 3300031852 Ga0307410_10001803 Ga0307410_100018036 250
75 3300031852 Ga0307410_10547786 Ga0307410_105477861 250
76 3300031901 Ga0307406_10111030 Ga0307406_101110303 250
77 3300031995 Ga0307409_100080333 Ga0307409_1000803332 250
78 3300031995 Ga0307409_100339126 Ga0307409_1003391262 250
79 3300031995 Ga0307409_100477355 Ga0307409_1004773551 250
80 3300032002 Ga0307416_100354430 Ga0307416_1003544302 250
81 3300032002 Ga0307416_100626435 Ga0307416_1006264352 250
82 3300032004 Ga0307414_10031185 Ga0307414_100311854 250
83 3300032004 Ga0307414_10372063 Ga0307414_103720632 250
84 3300032005 Ga0307411_10416394 Ga0307411_104163942 250
85 3300037312 Ga0395899_0044573 Ga0395899_0044573_2045_2824 250
86 3300037418 Ga0395900_0000503 Ga0395900_0000503_2478_3257 250
87 3300037471 Ga0395905_0005921 Ga0395905_0005921_5073_5852 250
88 3300037471 Ga0395905_0183763 Ga0395905_0183763_1020_1799 250
89 3300038443 Ga0395901_0000520 Ga0395901_0000520_20587_21366 250
90 3300042004 Ga0439445_0000253 Ga0439445_0000253_5819_6598 250
91 3300046525 Ga0495663_0006082 Ga0495663_0006082_1466_2245 250
92 3300046539 Ga0495621_0001509 Ga0495621_0001509_2179_2958 250
93 3300046539 Ga0495621_0001791 Ga0495621_0001791_3191_3970 250
94 3300046539 Ga0495621_0008741 Ga0495621_0008741_1953_2732 250
95 3300046664 Ga0495659_0036834 Ga0495659_0036834_311_1090 250
96 3300046691 Ga0495670_0015548 Ga0495670_0015548_488_1267 250
97 3300049708 Ga0501245_016587 Ga0501245_016587_11_790 250
98 3300050510 nmdc:mga06r32_37406_c1 nmdc:mga06r32_37406_c1_3676_4455 250
99 3300005355 Ga0070671_100317520 Ga0070671_1003175202 253
100 3300005367 Ga0070667_100000763 Ga0070667_1000007634 253
101 3300005841 Ga0068863_100123583 Ga0068863_1001235831 253
102 3300005843 Ga0068860_100764891 Ga0068860_1007648911 253
103 3300025931 Ga0207644_10121439 Ga0207644_101214392 253
104 3300025986 Ga0207658_10000247 Ga0207658_1000024750 253
105 3300026088 Ga0207641_10108120 Ga0207641_101081201 253
106 3300027665 Ga0209983_1027723 Ga0209983_10277232 253
107 3300027876 Ga0209974_10015776 Ga0209974_100157762 253
108 3300028381 Ga0268264_10749673 Ga0268264_107496731 253
109 3300030744 Ga0316181_1124342 Ga0316181_11243422 253
110 3300031548 Ga0307408_100109997 Ga0307408_1001099972 253
111 3300031852 Ga0307410_10034416 Ga0307410_100344164 253
112 3300031911 Ga0307412_10325009 Ga0307412_103250092 253
113 3300031995 Ga0307409_100230860 Ga0307409_1002308602 253
114 3300032004 Ga0307414_10205009 Ga0307414_102050092 253
115 3300032005 Ga0307411_10252071 Ga0307411_102520712 253
116 3300032126 Ga0307415_100312565 Ga0307415_1003125652 253
117 3300005327 Ga0070658_10005606 Ga0070658_100056066 254
118 3300005339 Ga0070660_100000378 Ga0070660_10000037812 254
119 3300005344 Ga0070661_100022524 Ga0070661_1000225243 254
120 3300005354 Ga0070675_100162285 Ga0070675_1001622852 254
121 3300005355 Ga0070671_100231651 Ga0070671_1002316512 254
122 3300005366 Ga0070659_100076922 Ga0070659_1000769223 254
123 3300005539 Ga0068853_100096316 Ga0068853_1000963164 254
124 3300005563 Ga0068855_100000480 Ga0068855_10000048027 254
125 3300005617 Ga0068859_100530668 Ga0068859_1005306682 254
126 3300006931 Ga0097620_100530638 Ga0097620_1005306382 254
127 3300009177 Ga0105248_10159990 Ga0105248_101599902 254
128 3300013102 Ga0157371_10009971 Ga0157371_100099713 254
129 3300013102 Ga0157371_10019621 Ga0157371_100196216 254
130 3300013306 Ga0163162_10209823 Ga0163162_102098232 254
131 3300017792 Ga0163161_10006108 Ga0163161_100061084 254
132 3300025909 Ga0207705_10000131 Ga0207705_1000013181 254
133 3300025919 Ga0207657_10005362 Ga0207657_1000536210 254
134 3300025932 Ga0207690_10141917 Ga0207690_101419172 254
135 3300025940 Ga0207691_10314081 Ga0207691_103140812 254
136 3300025949 Ga0207667_10000586 Ga0207667_1000058644 254
137 3300048914 Ga0496111_0034991 Ga0496111_0034991_511_1311 254
138 3300005327 Ga0070658_10112721 Ga0070658_101127212 255
139 3300013104 Ga0157370_10397431 Ga0157370_103974312 255
140 3300031731 Ga0307405_10122350 Ga0307405_101223502 255
141 3300031824 Ga0307413_10183631 Ga0307413_101836312 255
142 3300031901 Ga0307406_10045643 Ga0307406_100456432 255
143 3300032002 Ga0307416_100365247 Ga0307416_1003652472 255
144 3300032004 Ga0307414_10125125 Ga0307414_101251252 255
145 3300032004 Ga0307414_10521676 Ga0307414_105216762 255
146 3300037312 Ga0395899_0000261 Ga0395899_0000261_52677_53471 255
147 3300037418 Ga0395900_0000036 Ga0395900_0000036_81416_82210 255
148 3300037418 Ga0395900_0026277 Ga0395900_0026277_2565_3359 255
149 3300037418 Ga0395900_0029933 Ga0395900_0029933_1195_1989 255
150 3300037466 Ga0395898_0011477 Ga0395898_0011477_5377_6171 255
151 3300037466 Ga0395898_0185217 Ga0395898_0185217_34_828 255
152 3300037471 Ga0395905_0064853 Ga0395905_0064853_1756_2550 255
153 3300037471 Ga0395905_0590452 Ga0395905_0590452_95_889 255
154 3300038443 Ga0395901_0000036 Ga0395901_0000036_137688_138482 255
155 3300038443 Ga0395901_0065242 Ga0395901_0065242_1228_2022 255
156 3300005327 Ga0070658_10071760 Ga0070658_100717602 256
157 3300005339 Ga0070660_100065751 Ga0070660_1000657512 256
158 3300005458 Ga0070681_10314599 Ga0070681_103145992 256
159 3300005539 Ga0068853_100277765 Ga0068853_1002777652 256
160 3300013104 Ga0157370_10075208 Ga0157370_100752082 256
161 3300025912 Ga0207707_10266894 Ga0207707_102668942 256
162 3300025917 Ga0207660_10017556 Ga0207660_100175566 256
163 3300025919 Ga0207657_10011998 Ga0207657_100119983 256
164 3300031548 Ga0307408_100088007 Ga0307408_1000880072 256
165 3300031548 Ga0307408_100341722 Ga0307408_1003417222 256
166 3300031852 Ga0307410_10059241 Ga0307410_100592415 256
167 3300031911 Ga0307412_10131837 Ga0307412_101318372 256
168 3300031911 Ga0307412_10353660 Ga0307412_103536602 256
169 3300031995 Ga0307409_100220296 Ga0307409_1002202962 256
170 3300032002 Ga0307416_100389145 Ga0307416_1003891451 256
171 3300032005 Ga0307411_10096499 Ga0307411_100964992 256
172 3300032005 Ga0307411_10304279 Ga0307411_103042792 256
173 3300032005 Ga0307411_10343851 Ga0307411_103438512 256
174 3300032126 Ga0307415_100250729 Ga0307415_1002507292 256
175 3300037418 Ga0395900_0093836 Ga0395900_0093836_1927_2727 256
176 3300049652 Ga0501202_024713 Ga0501202_024713_63_860 256
177 3300049663 Ga0501223_019664 Ga0501223_019664_96_893 256
178 3300049679 Ga0501249_008850 Ga0501249_008850_1152_1949 256
179 3300049683 Ga0501253_030468 Ga0501253_030468_53_850 256
180 3300049688 Ga0501259_010371 Ga0501259_010371_267_1064 256
181 3300049705 Ga0501225_0019536 Ga0501225_0019536_611_1408 256
182 3300049764 Ga0501267_004883 Ga0501267_004883_269_1066 256
183 3300049765 Ga0501268_019420 Ga0501268_019420_243_1040 256
184 3300049770 Ga0501273_014049 Ga0501273_014049_124_921 256
185 3300001904 JGI24736J21556_1000683 JGI24736J21556_10006837 257
186 3300005327 Ga0070658_10003530 Ga0070658_1000353019 257
187 3300005327 Ga0070658_10442446 Ga0070658_104424461 257
188 3300005327 Ga0070658_10541274 Ga0070658_105412741 257
189 3300005329 Ga0070683_100035586 Ga0070683_1000355862 257
190 3300005336 Ga0070680_100089243 Ga0070680_1000892431 257
191 3300005339 Ga0070660_100009409 Ga0070660_1000094093 257
192 3300005339 Ga0070660_100308009 Ga0070660_1003080091 257
193 3300005344 Ga0070661_100118420 Ga0070661_1001184202 257
194 3300005345 Ga0070692_10139066 Ga0070692_101390662 257
195 3300005345 Ga0070692_10161108 Ga0070692_101611082 257
196 3300005355 Ga0070671_100153178 Ga0070671_1001531782 257
197 3300005364 Ga0070673_100040957 Ga0070673_1000409572 257
198 3300005366 Ga0070659_100069029 Ga0070659_1000690293 257
199 3300005366 Ga0070659_100248601 Ga0070659_1002486012 257
200 3300005455 Ga0070663_100026659 Ga0070663_1000266592 257
201 3300005455 Ga0070663_100070244 Ga0070663_1000702442 257
202 3300005455 Ga0070663_100132481 Ga0070663_1001324812 257
203 3300005457 Ga0070662_100019234 Ga0070662_1000192345 257
204 3300005457 Ga0070662_100279473 Ga0070662_1002794732 257
205 3300005458 Ga0070681_10025117 Ga0070681_100251172 257
206 3300005530 Ga0070679_100173411 Ga0070679_1001734112 257
207 3300005530 Ga0070679_100767825 Ga0070679_1007678251 257
208 3300005539 Ga0068853_100248476 Ga0068853_1002484761 257
209 3300005563 Ga0068855_100063453 Ga0068855_1000634531 257
210 3300005563 Ga0068855_100280475 Ga0068855_1002804752 257
211 3300005578 Ga0068854_100002927 Ga0068854_1000029276 257
212 3300005578 Ga0068854_100007829 Ga0068854_1000078294 257
213 3300005614 Ga0068856_100039421 Ga0068856_1000394212 257
214 3300005616 Ga0068852_100082161 Ga0068852_1000821612 257
215 3300005616 Ga0068852_100177750 Ga0068852_1001777502 257
216 3300005618 Ga0068864_100517352 Ga0068864_1005173522 257
217 3300005844 Ga0068862_100237462 Ga0068862_1002374622 257
218 3300005985 Ga0081539_10041970 Ga0081539_100419702 257
219 3300009093 Ga0105240_10004421 Ga0105240_1000442110 257
220 3300009093 Ga0105240_10279524 Ga0105240_102795242 257
221 3300009174 Ga0105241_10109930 Ga0105241_101099302 257
222 3300009545 Ga0105237_10402139 Ga0105237_104021392 257
223 3300010375 Ga0105239_10189540 Ga0105239_101895403 257
224 3300013102 Ga0157371_10033435 Ga0157371_100334353 257
225 3300013102 Ga0157371_10062039 Ga0157371_100620393 257
226 3300013102 Ga0157371_10085528 Ga0157371_100855281 257
227 3300013104 Ga0157370_10531470 Ga0157370_105314702 257
228 3300013105 Ga0157369_10000185 Ga0157369_1000018510 257
229 3300013105 Ga0157369_10008454 Ga0157369_100084548 257
230 3300013105 Ga0157369_10058888 Ga0157369_100588885 257
231 3300013105 Ga0157369_10193997 Ga0157369_101939972 257
232 3300013105 Ga0157369_10197057 Ga0157369_101970571 257
233 3300013307 Ga0157372_10431349 Ga0157372_104313492 257
234 3300020069 Ga0197907_10363088 Ga0197907_103630881 257
235 3300025315 Ga0207697_10048699 Ga0207697_100486992 257
236 3300025904 Ga0207647_10008216 Ga0207647_100082163 257
237 3300025909 Ga0207705_10000003 Ga0207705_10000003282 257
238 3300025909 Ga0207705_10001308 Ga0207705_1000130813 257
239 3300025909 Ga0207705_10005607 Ga0207705_100056075 257
240 3300025911 Ga0207654_10042401 Ga0207654_100424012 257
241 3300025912 Ga0207707_10450516 Ga0207707_104505162 257
242 3300025913 Ga0207695_10017848 Ga0207695_100178483 257
243 3300025913 Ga0207695_10071775 Ga0207695_100717752 257
244 3300025917 Ga0207660_10385452 Ga0207660_103854521 257
245 3300025919 Ga0207657_10014079 Ga0207657_100140793 257
246 3300025919 Ga0207657_10055419 Ga0207657_100554194 257
247 3300025919 Ga0207657_10073034 Ga0207657_100730341 257
248 3300025920 Ga0207649_10002482 Ga0207649_100024823 257
249 3300025923 Ga0207681_10007817 Ga0207681_100078176 257
250 3300025925 Ga0207650_10205500 Ga0207650_102055001 257
251 3300025926 Ga0207659_10014533 Ga0207659_100145332 257
252 3300025926 Ga0207659_10155051 Ga0207659_101550512 257
253 3300025931 Ga0207644_10000452 Ga0207644_1000045227 257
254 3300025932 Ga0207690_10002067 Ga0207690_100020672 257
255 3300025932 Ga0207690_10215734 Ga0207690_102157342 257
256 3300025933 Ga0207706_10003204 Ga0207706_100032046 257
257 3300025933 Ga0207706_10036104 Ga0207706_100361043 257
258 3300025933 Ga0207706_10317283 Ga0207706_103172832 257
259 3300025940 Ga0207691_10249572 Ga0207691_102495722 257
260 3300025944 Ga0207661_10048878 Ga0207661_100488782 257
261 3300025945 Ga0207679_10132535 Ga0207679_101325352 257
262 3300025949 Ga0207667_10021254 Ga0207667_100212544 257
263 3300025949 Ga0207667_10024405 Ga0207667_100244055 257
264 3300025949 Ga0207667_10164626 Ga0207667_101646263 257
265 3300025960 Ga0207651_10053486 Ga0207651_100534862 257
266 3300025981 Ga0207640_10003065 Ga0207640_100030654 257
267 3300025981 Ga0207640_10554761 Ga0207640_105547612 257
268 3300026067 Ga0207678_10006377 Ga0207678_100063772 257
269 3300026067 Ga0207678_10042510 Ga0207678_100425103 257
270 3300026067 Ga0207678_10166293 Ga0207678_101662932 257
271 3300026078 Ga0207702_10101373 Ga0207702_101013732 257
272 3300026078 Ga0207702_10524829 Ga0207702_105248292 257
273 3300026095 Ga0207676_10309562 Ga0207676_103095622 257
274 3300026116 Ga0207674_10131719 Ga0207674_101317191 257
275 3300026142 Ga0207698_10006334 Ga0207698_100063344 257
276 3300026142 Ga0207698_10010876 Ga0207698_100108764 257
277 3300031548 Ga0307408_100100932 Ga0307408_1001009323 257
278 3300031548 Ga0307408_100183159 Ga0307408_1001831592 257
279 3300031731 Ga0307405_10000956 Ga0307405_1000095611 257
280 3300031731 Ga0307405_10067871 Ga0307405_100678712 257
281 3300031824 Ga0307413_10048937 Ga0307413_100489372 257
282 3300031824 Ga0307413_10083087 Ga0307413_100830872 257
283 3300031824 Ga0307413_10208511 Ga0307413_102085111 257
284 3300031852 Ga0307410_10005881 Ga0307410_100058818 257
285 3300031852 Ga0307410_10108695 Ga0307410_101086952 257
286 3300031901 Ga0307406_10001163 Ga0307406_1000116314 257
287 3300031903 Ga0307407_10015599 Ga0307407_100155995 257
288 3300031911 Ga0307412_10006564 Ga0307412_100065643 257
289 3300031995 Ga0307409_100005166 Ga0307409_1000051666 257
290 3300031995 Ga0307409_100014267 Ga0307409_1000142672 257
291 3300031995 Ga0307409_100014276 Ga0307409_1000142765 257
292 3300031995 Ga0307409_100222173 Ga0307409_1002221732 257
293 3300032002 Ga0307416_100000539 Ga0307416_1000005398 257
294 3300032002 Ga0307416_100017224 Ga0307416_1000172246 257
295 3300032002 Ga0307416_100901455 Ga0307416_1009014551 257
296 3300032004 Ga0307414_10008273 Ga0307414_100082733 257
297 3300032004 Ga0307414_10088932 Ga0307414_100889323 257
298 3300032005 Ga0307411_10022792 Ga0307411_100227921 257
299 3300032005 Ga0307411_10043185 Ga0307411_100431853 257
300 3300032005 Ga0307411_10079048 Ga0307411_100790482 257
301 3300032005 Ga0307411_10162606 Ga0307411_101626062 257
302 3300032005 Ga0307411_10202894 Ga0307411_102028941 257
303 3300032005 Ga0307411_10433538 Ga0307411_104335381 257
304 3300032126 Ga0307415_100002134 Ga0307415_1000021348 257
305 3300037312 Ga0395899_0103901 Ga0395899_0103901_1186_1986 257
306 3300037312 Ga0395899_0419859 Ga0395899_0419859_63_863 257
307 3300037418 Ga0395900_0088987 Ga0395900_0088987_2007_2807 257
308 3300037418 Ga0395900_0106682 Ga0395900_0106682_185_985 257
309 3300037418 Ga0395900_0147232 Ga0395900_0147232_1580_2380 257
310 3300037418 Ga0395900_0296099 Ga0395900_0296099_743_1543 257
311 3300037418 Ga0395900_0358979 Ga0395900_0358979_30_830 257
312 3300037466 Ga0395898_0019218 Ga0395898_0019218_1911_2711 257
313 3300037466 Ga0395898_0020422 Ga0395898_0020422_4988_5788 257
314 3300037471 Ga0395905_0151314 Ga0395905_0151314_1026_1826 257
315 3300038443 Ga0395901_0064393 Ga0395901_0064393_1078_1878 257
316 3300038443 Ga0395901_0124476 Ga0395901_0124476_992_1792 257
317 3300038443 Ga0395901_0185359 Ga0395901_0185359_1151_1951 257
318 3300038443 Ga0395901_0288827 Ga0395901_0288827_63_863 257
319 3300041404 Ga0439436_0063959 Ga0439436_0063959_138_938 257
320 3300044656 Ga0466969_0032149 Ga0466969_0032149_1594_2394 257
321 3300044684 Ga0466966_0000004 Ga0466966_0000004_134266_135066 257
322 3300044684 Ga0466966_0005770 Ga0466966_0005770_6030_6830 257
323 3300044693 Ga0466961_0001994 Ga0466961_0001994_6611_7411 257
324 3300044694 Ga0466963_0007364 Ga0466963_0007364_1572_2372 257
325 3300044694 Ga0466963_0010090 Ga0466963_0010090_1194_1994 257
326 3300044765 Ga0466970_0003633 Ga0466970_0003633_371_1171 257
327 3300044842 Ga0466957_0001592 Ga0466957_0001592_2483_3283 257
328 3300045049 Ga0466959_0163190 Ga0466959_0163190_566_1366 257
329 3300045049 Ga0466959_0366398 Ga0466959_0366398_40_840 257
330 3300045836 Ga0466958_0001099 Ga0466958_0001099_7431_8231 257
331 3300045976 Ga0466967_0213001 Ga0466967_0213001_770_1570 257
332 3300061719 Ga0466962_0030177 Ga0466962_0030177_925_1725 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

154

268

0.95

PF01678

DAP_epimerase

Diaminopimelate epimerase

18

123

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.8865 1 250
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8726 2 250
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.8604 1 250
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.8442 2 250
1gqz-assembly1.cif.gz_A refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a 0.8375 3 252
ID Description Score Start End Superfamily
af_P0A6K1_1_112_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9335 5 95 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8953 140 239 3.10.310.10
af_I1NA10_49_204_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8914 3 120 3.10.310.10
af_Q58519_1_127_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8892 5 101 3.10.310.10
3ejxD01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8708 1 98 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A3B0S0S5-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.9823 5 83 GO:0005829
GO:0008837
GO:0009089
AF-A0A3N5HK81-F1-model_v4 Diaminopimelate epimerase 0.9813 3 83 GO:0005829
GO:0008837
GO:0009089
AF-X1PSZ4-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.9648 3 78 GO:0005829
GO:0008837
GO:0009089
AF-A0A7V2T792-F1-model_v4 diaminopimelate epimerase (EC 5.1.1.7) 0.9559 1 85 GO:0005829
GO:0008837
GO:0009089
AF-A0A3B9CL21-F1-model_v4 deleted 0.9557 1 85

Feature Viewer

pLDDT pTM Quality
83.12 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map