F410588

General Info

Members Datasets Scaffolds Average Seq Length
331 167 662 304

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_205508|Ga0400483_205508_49_1038
Length 329
Sequence MNWKIGWKAFRCPTSRLNEERPMSPLDNKDLMRRAAGVPRIKGEDGEGSVQVHMDPTATIDTAKVFSVYGKGGIGKSTTSSNLSAAFSKLGKRVLQIGCDPKHDSTFTLTKSLVPTVIDTLKEVDFHAEELRPEDFVYEGYNGVMCVEAGGPPAGTGCGGYVVGQTVKLLKAHHLLDDTDVVIFDVLGDVVCGGFAAPLQHADRAVVVTANDFDSIYAMNRIIAAVQAKSKNYQVRLAGCVANRSKDTEQVDKYCDTVGFKRIAHMPDVDAIRRSRLMKCTVFEMPEHEDIVQVQKEYVRLAETLWNGTEPLAPAPMEDRDIFELLGFD

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
5 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
15 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
20 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
23 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
24 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
25 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
27 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
28 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
46 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
47 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
50 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
51 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
59 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
60 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
61 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
67 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
68 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
71 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
72 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
75 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
76 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
77 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
86 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
87 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
116 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
134 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
135 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
136 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
137 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
138 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
139 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
140 2512875024
141 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
142 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
143 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
144 2643221719 Rhizobium sp. Root274 Isolate Unclassified
145 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
146 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
147 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
148 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
149 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
150 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
151 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
152 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
153 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
154 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
155 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
156 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
157 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
158 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
159 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
160 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
161 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
162 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
163 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
164 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
165 641522639 Methylobacterium sp. 4-46 Isolate Nodule
166 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
167 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.31
Metatranscriptomes 4.23
Isolates 8.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.04
Nodule 1.21
Rhizoplane 1.51
Rhizosphere 77.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_205508 3300039062 Bacteria 4904
2 Ga0065165_1000694 3300005262 Bacteria 48071
3 Ga0065165_1037598 3300005262 Bacteria 1466
4 Ga0070673_100026943 3300005364 Bacteria 4254
5 Ga0070663_100059079 3300005455 Bacteria 2756
6 Ga0068867_100328122 3300005459 Bacteria 1270
7 Ga0068853_100278461 3300005539 Bacteria 1542
8 Ga0070665_100003595 3300005548 Bacteria 16416
9 Ga0070665_100012151 3300005548 Bacteria 8682
10 Ga0068856_100191314 3300005614 Bacteria 2060
11 Ga0068852_100077712 3300005616 Bacteria 2935
12 Ga0068858_100096081 3300005842 Bacteria 2761
13 Ga0081540_1000942 3300005983 Bacteria 26195
14 Ga0081540_1021032 3300005983 Bacteria 3903
15 Ga0075365_10005379 3300006038 Bacteria 6897
16 Ga0075367_10121118 3300006178 Bacteria 1612
17 Ga0068871_100320844 3300006358 Bacteria 1364
18 Ga0068865_100273998 3300006881 Bacteria 1341
19 Ga0105247_10127256 3300009101 Bacteria 1657
20 Ga0105248_10177285 3300009177 Bacteria 2402
21 Ga0105248_10179971 3300009177 Bacteria 2382
22 Ga0105237_10677721 3300009545 Bacteria 1038
23 Ga0163162_10042980 3300013306 Bacteria 4523
24 Ga0157375_10134282 3300013308 Bacteria 2596
25 Ga0157380_10021644 3300014326 Bacteria 4825
26 Ga0157379_10344553 3300014968 Bacteria 1363
27 Ga0163161_10291503 3300017792 Bacteria 1283
28 Ga0163161_10388687 3300017792 Bacteria 1116
29 Ga0213876_10027478 3300021384 Bacteria 3001
30 Ga0213876_10045582 3300021384 Bacteria 2318
31 Ga0209563_104214 3300025230 Bacteria 2785
32 Ga0209758_1000557 3300025297 Bacteria 58827
33 Ga0209758_1020736 3300025297 Bacteria 3093
34 Ga0207426_1000328 3300025302 Bacteria 90659
35 Ga0207426_1015397 3300025302 Bacteria 2773
36 Ga0207710_10075405 3300025900 Bacteria 1554
37 Ga0207688_10182700 3300025901 Bacteria 1251
38 Ga0207688_10232576 3300025901 Bacteria 1113
39 Ga0207705_10013825 3300025909 Bacteria 5822
40 Ga0207693_10183984 3300025915 Bacteria 1645
41 Ga0207681_10077482 3300025923 Bacteria 2337
42 Ga0207659_10035125 3300025926 Bacteria 3462
43 Ga0207644_10018669 3300025931 Bacteria 4694
44 Ga0207691_10027902 3300025940 Bacteria 5289
45 Ga0207711_10340448 3300025941 Bacteria 1388
46 Ga0207703_10011526 3300026035 Bacteria 6877
47 Ga0207639_10053999 3300026041 Bacteria 3069
48 Ga0207678_10050192 3300026067 Bacteria 3605
49 Ga0207708_10330621 3300026075 Bacteria 1246
50 Ga0207641_10061197 3300026088 Bacteria 3211
51 Ga0207648_10409013 3300026089 Bacteria 1230
52 Ga0207698_10063802 3300026142 Bacteria 2885
53 Ga0268266_10000539 3300028379 Bacteria 52742
54 Ga0268266_10006555 3300028379 Bacteria 10643
55 Ga0265337_1003714 3300028556 Bacteria 6525
56 Ga0265326_10004924 3300028558 Bacteria 4232
57 Ga0265319_1004858 3300028563 Bacteria 6577
58 Ga0265319_1006950 3300028563 Bacteria 5156
59 Ga0265334_10000294 3300028573 Bacteria 27911
60 Ga0265334_10001855 3300028573 Bacteria 10057
61 Ga0265318_10000555 3300028577 Bacteria 26355
62 Ga0265318_10013917 3300028577 Bacteria 3387
63 Ga0265323_10001594 3300028653 Bacteria 10940
64 Ga0265322_10003363 3300028654 Bacteria 4843
65 Ga0265336_10001303 3300028666 Bacteria 11675
66 Ga0265338_10000081 3300028800 Bacteria 176402
67 Ga0265338_10022179 3300028800 Bacteria 6586
68 Ga0265324_10006214 3300029957 Bacteria 5026
69 Ga0265332_10001519 3300031238 Bacteria 12887
70 Ga0265332_10002671 3300031238 Bacteria 8945
71 Ga0265328_10000102 3300031239 Bacteria 41869
72 Ga0265328_10002882 3300031239 Bacteria 7674
73 Ga0265328_10004435 3300031239 Bacteria 6096
74 Ga0265328_10069337 3300031239 Bacteria 1296
75 Ga0265320_10003895 3300031240 Bacteria 9869
76 Ga0265325_10000622 3300031241 Bacteria 25870
77 Ga0265325_10058014 3300031241 Bacteria 1973
78 Ga0265329_10002274 3300031242 Bacteria 8806
79 Ga0265329_10016617 3300031242 Bacteria 2546
80 Ga0265340_10010477 3300031247 Bacteria 4957
81 Ga0265340_10096538 3300031247 Bacteria 1377
82 Ga0265339_10006906 3300031249 Bacteria 7395
83 Ga0265339_10011463 3300031249 Bacteria 5454
84 Ga0265339_10023213 3300031249 Bacteria 3588
85 Ga0265331_10001308 3300031250 Bacteria 18466
86 Ga0265331_10018853 3300031250 Bacteria 3567
87 Ga0265327_10000613 3300031251 Bacteria 58852
88 Ga0265327_10003082 3300031251 Bacteria 16448
89 Ga0265327_10009227 3300031251 Bacteria 7156
90 Ga0265327_10052664 3300031251 Bacteria 2118
91 Ga0265316_10010270 3300031344 Bacteria 8542
92 Ga0265316_10021153 3300031344 Bacteria 5519
93 Ga0265316_10026794 3300031344 Bacteria 4787
94 Ga0265316_10062307 3300031344 Bacteria 2895
95 Ga0265316_10099461 3300031344 Bacteria 2212
96 Ga0265316_10337353 3300031344 Bacteria 1093
97 Ga0265313_10001758 3300031595 Bacteria 19875
98 Ga0265313_10006553 3300031595 Bacteria 8211
99 Ga0316575_10000918 3300031665 Bacteria 9060
100 Ga0316575_10001405 3300031665 Bacteria 7734
101 Ga0316575_10018043 3300031665 Bacteria 2687
102 Ga0316575_10032389 3300031665 Bacteria 2047
103 Ga0316579_10000187 3300031691 Bacteria 18075
104 Ga0316579_10004244 3300031691 Bacteria 5675
105 Ga0316579_10028192 3300031691 Bacteria 2556
106 Ga0316579_10089893 3300031691 Bacteria 1466
107 Ga0265314_10011867 3300031711 Bacteria 7157
108 Ga0265314_10030612 3300031711 Bacteria 3981
109 Ga0265342_10000087 3300031712 Bacteria 100045
110 Ga0265342_10001283 3300031712 Bacteria 23626
111 Ga0316576_10001052 3300031727 Bacteria 14328
112 Ga0316576_10001077 3300031727 Bacteria 14188
113 Ga0316576_10001976 3300031727 Bacteria 11457
114 Ga0316576_10002831 3300031727 Bacteria 9988
115 Ga0316576_10004118 3300031727 Bacteria 8673
116 Ga0316576_10006399 3300031727 Bacteria 7330
117 Ga0316576_10011132 3300031727 Bacteria 5877
118 Ga0316576_10016504 3300031727 Bacteria 4990
119 Ga0316576_10022263 3300031727 Bacteria 4399
120 Ga0316576_10027573 3300031727 Bacteria 3995
121 Ga0316576_10028623 3300031727 Bacteria 3930
122 Ga0316576_10059012 3300031727 Bacteria 2807
123 Ga0316576_10095707 3300031727 Bacteria 2215
124 Ga0316576_10108635 3300031727 Bacteria 2078
125 Ga0316576_10166089 3300031727 Bacteria 1665
126 Ga0316578_10001626 3300031728 Bacteria 9307
127 Ga0316578_10002963 3300031728 Bacteria 7636
128 Ga0316578_10024977 3300031728 Bacteria 3355
129 Ga0316578_10041116 3300031728 Bacteria 2676
130 Ga0316578_10059539 3300031728 Bacteria 2247
131 Ga0316578_10098708 3300031728 Bacteria 1749
132 Ga0316578_10182920 3300031728 Bacteria 1263
133 Ga0316577_10000604 3300031733 Bacteria 14818
134 Ga0316577_10000984 3300031733 Bacteria 12723
135 Ga0316577_10003065 3300031733 Bacteria 8387
136 Ga0316577_10004906 3300031733 Bacteria 6969
137 Ga0316577_10010399 3300031733 Bacteria 5023
138 Ga0316577_10033949 3300031733 Bacteria 2851
139 Ga0316577_10040167 3300031733 Bacteria 2617
140 Ga0316577_10056017 3300031733 Bacteria 2200
141 Ga0316577_10096860 3300031733 Bacteria 1653
142 Ga0307409_100199244 3300031995 Bacteria 1790
143 Ga0316583_10001453 3300032133 Bacteria 7913
144 Ga0316583_10062443 3300032133 Bacteria 1305
145 Ga0316585_10000076 3300032137 Bacteria 16627
146 Ga0316585_10002131 3300032137 Bacteria 5315
147 Ga0316585_10005593 3300032137 Bacteria 3553
148 Ga0316580_10000517 3300032139 Bacteria 8904
149 Ga0316580_10001555 3300032139 Bacteria 6051
150 Ga0316580_10001759 3300032139 Bacteria 5788
151 Ga0316580_10003647 3300032139 Bacteria 4399
152 Ga0316580_10006722 3300032139 Bacteria 3399
153 Ga0316593_10001023 3300032168 Bacteria 5797
154 Ga0316592_1002850 3300033524 Bacteria 3040
155 Ga0316592_1005216 3300033524 Bacteria 2456
156 Ga0316592_1007322 3300033524 Bacteria 2153
157 Ga0316586_1008655 3300033527 Bacteria 1511
158 Ga0316588_1000004 3300033528 Bacteria 16160
159 Ga0316588_1000087 3300033528 Bacteria 8414
160 Ga0316588_1002102 3300033528 Bacteria 3417
161 Ga0316588_1032440 3300033528 Bacteria 1229
162 Ga0316587_1010532 3300033529 Bacteria 1481
163 Ga0316596_1001115 3300033541 Bacteria 5242
164 Ga0316596_1008108 3300033541 Bacteria 2497
165 Ga0316596_1019536 3300033541 Bacteria 1719
166 Ga0316596_1029543 3300033541 Bacteria 1419
167 Ga0316574_0000045 3300035398 Bacteria 30677
168 Ga0316574_0000209 3300035398 Bacteria 20562
169 Ga0316574_0000719 3300035398 Bacteria 14168
170 Ga0316574_0001681 3300035398 Bacteria 10678
171 Ga0316574_0044264 3300035398 Bacteria 2753
172 Ga0316574_0060614 3300035398 Bacteria 2375
173 Ga0316574_0062180 3300035398 Bacteria 2346
174 Ga0316574_0066257 3300035398 Bacteria 2275
175 Ga0316574_0077319 3300035398 Bacteria 2109
176 Ga0316574_0107269 3300035398 Bacteria 1789
177 Ga0316574_0113780 3300035398 Bacteria 1735
178 Ga0316574_0128733 3300035398 Bacteria 1628
179 Ga0316574_0136523 3300035398 Bacteria 1579
180 Ga0316574_0268722 3300035398 Bacteria 1088
181 Ga0316574_0275567 3300035398 Bacteria 1072
182 Ga0373931_0014933 3300035691 Bacteria 3805
183 Ga0316582_0000025 3300036647 Bacteria 35921
184 Ga0316582_0005432 3300036647 Bacteria 6564
185 Ga0316582_0055766 3300036647 Bacteria 2519
186 Ga0316582_0114772 3300036647 Bacteria 1796
187 Ga0316582_0217947 3300036647 Bacteria 1305
188 Ga0316584_0000497 3300036712 Bacteria 20762
189 Ga0316584_0002621 3300036712 Bacteria 11464
190 Ga0316584_0005336 3300036712 Bacteria 8614
191 Ga0316584_0005357 3300036712 Bacteria 8604
192 Ga0316584_0007244 3300036712 Bacteria 7570
193 Ga0316584_0011263 3300036712 Bacteria 6278
194 Ga0316584_0014580 3300036712 Bacteria 5600
195 Ga0316584_0020106 3300036712 Bacteria 4835
196 Ga0316584_0026836 3300036712 Bacteria 4236
197 Ga0316584_0030051 3300036712 Bacteria 4012
198 Ga0316584_0038041 3300036712 Bacteria 3579
199 Ga0316584_0050869 3300036712 Bacteria 3098
200 Ga0316584_0069465 3300036712 Bacteria 2641
201 Ga0316584_0091873 3300036712 Bacteria 2272
202 Ga0316584_0092269 3300036712 Bacteria 2267
203 Ga0316584_0106696 3300036712 Bacteria 2096
204 Ga0316584_0111447 3300036712 Bacteria 2047
205 Ga0316584_0133001 3300036712 Bacteria 1857
206 Ga0316581_0000159 3300037588 Bacteria 10712
207 Ga0316581_0004659 3300037588 Bacteria 3516
208 Ga0436364_0172505 3300037853 Bacteria 2980
209 Ga0436364_0328296 3300037853 Bacteria 143298
210 Ga0436364_0380522 3300037853 Bacteria 5185
211 Ga0436364_0863492 3300037853 Bacteria 2138
212 Ga0436364_1351907 3300037853 Bacteria 2140
213 Ga0400483_001472 3300039062 Bacteria 3786
214 Ga0400483_076476 3300039062 Bacteria 10411
215 Ga0400483_124066 3300039062 Bacteria 2630
216 Ga0400483_128477 3300039062 Bacteria 1625
217 Ga0400483_151156 3300039062 Bacteria 4962
218 Ga0400483_190444 3300039062 Bacteria 1821
219 Ga0400483_191493 3300039062 Bacteria 1101
220 Ga0400483_212777 3300039062 Bacteria 18396
221 Ga0400483_276143 3300039062 Bacteria 1427
222 Ga0436365_0511385 3300039437 Bacteria 9079
223 Ga0436365_0964055 3300039437 Bacteria 6640
224 Ga0436365_1865259 3300039437 Bacteria 3076
225 Ga0436360_0781047 3300039438 Bacteria 4024
226 Ga0436360_0781768 3300039438 Bacteria 11744
227 Ga0436361_0118422 3300039447 Bacteria 1824
228 Ga0436363_0067218 3300039450 Bacteria 4914
229 Ga0436363_0145112 3300039450 Bacteria 1296
230 Ga0436362_0073110 3300039453 Bacteria 4157
231 Ga0451849_1504496 3300041505 Bacteria 865
232 Ga0451577_0000001 3300042876 Bacteria 2461803
233 Ga0451577_0003534 3300042876 Bacteria 17289
234 Ga0451577_0003807 3300042876 Bacteria 16426
235 Ga0451577_0010718 3300042876 Bacteria 8727
236 Ga0451577_0017460 3300042876 Bacteria 6629
237 Ga0451577_0017482 3300042876 Bacteria 6624
238 Ga0451577_0018795 3300042876 Bacteria 6358
239 Ga0451577_0019570 3300042876 Bacteria 6222
240 Ga0451577_0032084 3300042876 Bacteria 4732
241 Ga0451577_0049869 3300042876 Bacteria 3737
242 Ga0451577_0146233 3300042876 Bacteria 2125
243 Ga0451577_0230653 3300042876 Bacteria 1674
244 Ga0453684_0021891 3300044712 Bacteria 9513
245 Ga0453684_0037442 3300044712 Bacteria 6658
246 Ga0453684_0179779 3300044712 Bacteria 2484
247 Ga0451576_0000122 3300045051 Bacteria 197797
248 Ga0451576_0001261 3300045051 Bacteria 44384
249 Ga0451576_0002473 3300045051 Bacteria 27484
250 Ga0451576_0003215 3300045051 Bacteria 22783
251 Ga0451576_0004629 3300045051 Bacteria 17752
252 Ga0451576_0007693 3300045051 Bacteria 12818
253 Ga0451576_0053936 3300045051 Bacteria 4209
254 Ga0451576_0073557 3300045051 Bacteria 3556
255 Ga0451576_0416157 3300045051 Bacteria 1410
256 Ga0451576_0648495 3300045051 Bacteria 1109
257 Ga0495603_0165727 3300046455 Bacteria 1281
258 Ga0495651_0020868 3300046462 Bacteria 5085
259 Ga0495650_0015208 3300046471 Bacteria 3957
260 Ga0495628_0282544 3300046516 Bacteria 1232
261 Ga0495652_0180102 3300046529 Bacteria 1623
262 Ga0495667_0136407 3300046559 Bacteria 1582
263 Ga0495604_0019769 3300047317 Bacteria 5388
264 Ga0495674_0095937 3300047319 Bacteria 2528
265 Ga0495680_0087023 3300047322 Bacteria 2351
266 Ga0495675_0246384 3300047444 Bacteria 1074
267 Ga0496109_0385243 3300048912 Bacteria 1325
268 Ga0496110_0079590 3300048913 Bacteria 2918
269 Ga0496112_0121317 3300048915 Bacteria 2584
270 Ga0496113_0513461 3300048916 Bacteria 962
271 Ga0496114_0264944 3300048917 Bacteria 1514
272 Ga0496121_0038826 3300048924 Bacteria 4208
273 Ga0496126_0046459 3300048929 Bacteria 3982
274 Ga0496126_0081377 3300048929 Bacteria 2863
275 Ga0501300_003970 3300049523 Bacteria 2201
276 Ga0501031_0007872 3300049568 Bacteria 6936
277 Ga0501034_0036082 3300049571 Bacteria 5012
278 Ga0501036_0144542 3300049572 Bacteria 2006
279 Ga0501036_0147550 3300049572 Bacteria 1984
280 Ga0501039_0042442 3300049575 Bacteria 3514
281 Ga0501069_0099255 3300049585 Bacteria 1652
282 Ga0501070_0000428 3300049586 Bacteria 38253
283 Ga0501073_0124293 3300049589 Bacteria 1788
284 Ga0501074_0186664 3300049590 Bacteria 1478
285 Ga0501080_0019671 3300049742 Bacteria 6253
286 Ga0501280_000833 3300049776 Bacteria 6673
287 Ga0501280_001048 3300049776 Bacteria 5658
288 Ga0501035_0003508 3300049822 Bacteria 14989
289 Ga0501044_0097558 3300049823 Bacteria 2960
290 Ga0501044_0139617 3300049823 Bacteria 2412
291 nmdc:mga0yw44_2439_c1 3300050492 Bacteria 7927
292 nmdc:mga06z11_96559_c1 3300050494 Bacteria 1614
293 nmdc:mga0qj67_248150_c1 3300050509 Bacteria 1444
294 Ga0500635_0000034 3300053080 Bacteria 96919
295 Ga0500641_0001445 3300053096 Bacteria 8463
296 Ga0500641_0011127 3300053096 Bacteria 3262
297 Ga0500595_000084 3300053119 Bacteria 66292
298 Ga0500614_006295 3300053123 Bacteria 2492
299 Ga0500559_0012826 3300053136 Bacteria 3556
300 Ga0500577_0000235 3300053142 Bacteria 14718
301 Ga0500589_000253 3300053147 Bacteria 10579
302 Ga0500604_0011768 3300053151 Bacteria 2356
303 Ga0501082_0224231 3300060353 Bacteria 1636
304 2512963797 2512875024 Bacteria 7195110
305 2545674131 2545555834 Bacteria 8130841
306 2596371369 2595698237 Bacteria 6712432
307 2644299552 2643221653 Bacteria 4569637
308 2644657780 2643221719 Bacteria 4568197
309 2738744044 2738541281 Bacteria 5112672
310 2739353274 2738543032 Bacteria 5115625
311 2819244964 2818991272 Bacteria 4622173
312 2829750143 2829745981 Bacteria 5406054
313 2837681406 2837678835 Bacteria 5252418
314 2842336638 2842333319 Bacteria 8899485
315 2842701509 2842698319 Bacteria 5190321
316 2844315632 2844315083 Bacteria 8138177
317 2854685484 2854681122 Bacteria 4548679
318 2861692883 2861691609 Bacteria 5628931
319 2888389538 2888388044 Bacteria 7304136
320 2889306707 2889306138 Bacteria 6358934
321 2894777049 2894772417 Bacteria 5305674
322 2902409645 2902405164 Bacteria 6784948
323 2903732674 2903727486 Bacteria 8281579
324 2906605442 2906602504 Bacteria 8295279
325 2919681544 2919679072 Bacteria 4629602
326 2928126303 2928125067 Bacteria 5937560
327 2989780662 2989776772 Bacteria 4843317
328 3003671106 3003665799 Bacteria 7279786
329 641643891 641522639 Bacteria 7737025
330 8005250627 8005246636 Bacteria 4933972
331 8045864964 8045864390 Bacteria 5043873
332 Ga0400483_205508
333 Ga0065165_1000694
334 Ga0065165_1037598
335 Ga0070673_100026943
336 Ga0070663_100059079
337 Ga0068867_100328122
338 Ga0068853_100278461
339 Ga0070665_100003595
340 Ga0070665_100012151
341 Ga0068856_100191314
342 Ga0068852_100077712
343 Ga0068858_100096081
344 Ga0081540_1000942
345 Ga0081540_1021032
346 Ga0075365_10005379
347 Ga0075367_10121118
348 Ga0068871_100320844
349 Ga0068865_100273998
350 Ga0105247_10127256
351 Ga0105248_10177285
352 Ga0105248_10179971
353 Ga0105237_10677721
354 Ga0163162_10042980
355 Ga0157375_10134282
356 Ga0157380_10021644
357 Ga0157379_10344553
358 Ga0163161_10291503
359 Ga0163161_10388687
360 Ga0213876_10027478
361 Ga0213876_10045582
362 Ga0209563_104214
363 Ga0209758_1000557
364 Ga0209758_1020736
365 Ga0207426_1000328
366 Ga0207426_1015397
367 Ga0207710_10075405
368 Ga0207688_10182700
369 Ga0207688_10232576
370 Ga0207705_10013825
371 Ga0207693_10183984
372 Ga0207681_10077482
373 Ga0207659_10035125
374 Ga0207644_10018669
375 Ga0207691_10027902
376 Ga0207711_10340448
377 Ga0207703_10011526
378 Ga0207639_10053999
379 Ga0207678_10050192
380 Ga0207708_10330621
381 Ga0207641_10061197
382 Ga0207648_10409013
383 Ga0207698_10063802
384 Ga0268266_10000539
385 Ga0268266_10006555
386 Ga0265337_1003714
387 Ga0265326_10004924
388 Ga0265319_1004858
389 Ga0265319_1006950
390 Ga0265334_10000294
391 Ga0265334_10001855
392 Ga0265318_10000555
393 Ga0265318_10013917
394 Ga0265323_10001594
395 Ga0265322_10003363
396 Ga0265336_10001303
397 Ga0265338_10000081
398 Ga0265338_10022179
399 Ga0265324_10006214
400 Ga0265332_10001519
401 Ga0265332_10002671
402 Ga0265328_10000102
403 Ga0265328_10002882
404 Ga0265328_10004435
405 Ga0265328_10069337
406 Ga0265320_10003895
407 Ga0265325_10000622
408 Ga0265325_10058014
409 Ga0265329_10002274
410 Ga0265329_10016617
411 Ga0265340_10010477
412 Ga0265340_10096538
413 Ga0265339_10006906
414 Ga0265339_10011463
415 Ga0265339_10023213
416 Ga0265331_10001308
417 Ga0265331_10018853
418 Ga0265327_10000613
419 Ga0265327_10003082
420 Ga0265327_10009227
421 Ga0265327_10052664
422 Ga0265316_10010270
423 Ga0265316_10021153
424 Ga0265316_10026794
425 Ga0265316_10062307
426 Ga0265316_10099461
427 Ga0265316_10337353
428 Ga0265313_10001758
429 Ga0265313_10006553
430 Ga0316575_10000918
431 Ga0316575_10001405
432 Ga0316575_10018043
433 Ga0316575_10032389
434 Ga0316579_10000187
435 Ga0316579_10004244
436 Ga0316579_10028192
437 Ga0316579_10089893
438 Ga0265314_10011867
439 Ga0265314_10030612
440 Ga0265342_10000087
441 Ga0265342_10001283
442 Ga0316576_10001052
443 Ga0316576_10001077
444 Ga0316576_10001976
445 Ga0316576_10002831
446 Ga0316576_10004118
447 Ga0316576_10006399
448 Ga0316576_10011132
449 Ga0316576_10016504
450 Ga0316576_10022263
451 Ga0316576_10027573
452 Ga0316576_10028623
453 Ga0316576_10059012
454 Ga0316576_10095707
455 Ga0316576_10108635
456 Ga0316576_10166089
457 Ga0316578_10001626
458 Ga0316578_10002963
459 Ga0316578_10024977
460 Ga0316578_10041116
461 Ga0316578_10059539
462 Ga0316578_10098708
463 Ga0316578_10182920
464 Ga0316577_10000604
465 Ga0316577_10000984
466 Ga0316577_10003065
467 Ga0316577_10004906
468 Ga0316577_10010399
469 Ga0316577_10033949
470 Ga0316577_10040167
471 Ga0316577_10056017
472 Ga0316577_10096860
473 Ga0307409_100199244
474 Ga0316583_10001453
475 Ga0316583_10062443
476 Ga0316585_10000076
477 Ga0316585_10002131
478 Ga0316585_10005593
479 Ga0316580_10000517
480 Ga0316580_10001555
481 Ga0316580_10001759
482 Ga0316580_10003647
483 Ga0316580_10006722
484 Ga0316593_10001023
485 Ga0316592_1002850
486 Ga0316592_1005216
487 Ga0316592_1007322
488 Ga0316586_1008655
489 Ga0316588_1000004
490 Ga0316588_1000087
491 Ga0316588_1002102
492 Ga0316588_1032440
493 Ga0316587_1010532
494 Ga0316596_1001115
495 Ga0316596_1008108
496 Ga0316596_1019536
497 Ga0316596_1029543
498 Ga0316574_0000045
499 Ga0316574_0000209
500 Ga0316574_0000719
501 Ga0316574_0001681
502 Ga0316574_0044264
503 Ga0316574_0060614
504 Ga0316574_0062180
505 Ga0316574_0066257
506 Ga0316574_0077319
507 Ga0316574_0107269
508 Ga0316574_0113780
509 Ga0316574_0128733
510 Ga0316574_0136523
511 Ga0316574_0268722
512 Ga0316574_0275567
513 Ga0373931_0014933
514 Ga0316582_0000025
515 Ga0316582_0005432
516 Ga0316582_0055766
517 Ga0316582_0114772
518 Ga0316582_0217947
519 Ga0316584_0000497
520 Ga0316584_0002621
521 Ga0316584_0005336
522 Ga0316584_0005357
523 Ga0316584_0007244
524 Ga0316584_0011263
525 Ga0316584_0014580
526 Ga0316584_0020106
527 Ga0316584_0026836
528 Ga0316584_0030051
529 Ga0316584_0038041
530 Ga0316584_0050869
531 Ga0316584_0069465
532 Ga0316584_0091873
533 Ga0316584_0092269
534 Ga0316584_0106696
535 Ga0316584_0111447
536 Ga0316584_0133001
537 Ga0316581_0000159
538 Ga0316581_0004659
539 Ga0436364_0172505
540 Ga0436364_0328296
541 Ga0436364_0380522
542 Ga0436364_0863492
543 Ga0436364_1351907
544 Ga0400483_001472
545 Ga0400483_076476
546 Ga0400483_124066
547 Ga0400483_128477
548 Ga0400483_151156
549 Ga0400483_190444
550 Ga0400483_191493
551 Ga0400483_212777
552 Ga0400483_276143
553 Ga0436365_0511385
554 Ga0436365_0964055
555 Ga0436365_1865259
556 Ga0436360_0781047
557 Ga0436360_0781768
558 Ga0436361_0118422
559 Ga0436363_0067218
560 Ga0436363_0145112
561 Ga0436362_0073110
562 Ga0451849_1504496
563 Ga0451577_0000001
564 Ga0451577_0003534
565 Ga0451577_0003807
566 Ga0451577_0010718
567 Ga0451577_0017460
568 Ga0451577_0017482
569 Ga0451577_0018795
570 Ga0451577_0019570
571 Ga0451577_0032084
572 Ga0451577_0049869
573 Ga0451577_0146233
574 Ga0451577_0230653
575 Ga0453684_0021891
576 Ga0453684_0037442
577 Ga0453684_0179779
578 Ga0451576_0000122
579 Ga0451576_0001261
580 Ga0451576_0002473
581 Ga0451576_0003215
582 Ga0451576_0004629
583 Ga0451576_0007693
584 Ga0451576_0053936
585 Ga0451576_0073557
586 Ga0451576_0416157
587 Ga0451576_0648495
588 Ga0495603_0165727
589 Ga0495651_0020868
590 Ga0495650_0015208
591 Ga0495628_0282544
592 Ga0495652_0180102
593 Ga0495667_0136407
594 Ga0495604_0019769
595 Ga0495674_0095937
596 Ga0495680_0087023
597 Ga0495675_0246384
598 Ga0496109_0385243
599 Ga0496110_0079590
600 Ga0496112_0121317
601 Ga0496113_0513461
602 Ga0496114_0264944
603 Ga0496121_0038826
604 Ga0496126_0046459
605 Ga0496126_0081377
606 Ga0501300_003970
607 Ga0501031_0007872
608 Ga0501034_0036082
609 Ga0501036_0144542
610 Ga0501036_0147550
611 Ga0501039_0042442
612 Ga0501069_0099255
613 Ga0501070_0000428
614 Ga0501073_0124293
615 Ga0501074_0186664
616 Ga0501080_0019671
617 Ga0501280_000833
618 Ga0501280_001048
619 Ga0501035_0003508
620 Ga0501044_0097558
621 Ga0501044_0139617
622 nmdc:mga0yw44_2439_c1
623 nmdc:mga06z11_96559_c1
624 nmdc:mga0qj67_248150_c1
625 Ga0500635_0000034
626 Ga0500641_0001445
627 Ga0500641_0011127
628 Ga0500595_000084
629 Ga0500614_006295
630 Ga0500559_0012826
631 Ga0500577_0000235
632 Ga0500589_000253
633 Ga0500604_0011768
634 Ga0501082_0224231
635 2512963797
636 2545674131
637 2596371369
638 2644299552
639 2644657780
640 2738744044
641 2739353274
642 2819244964
643 2829750143
644 2837681406
645 2842336638
646 2842701509
647 2844315632
648 2854685484
649 2861692883
650 2888389538
651 2889306707
652 2894777049
653 2902409645
654 2903732674
655 2906605442
656 2919681544
657 2928126303
658 2989780662
659 3003671106
660 641643891
661 8005250627
662 8045864964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00142

Fer4_NifH

4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family

64

328

0.97

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

65

279

0.89

PF13614

AAA_31

AAA domain

63

140

0.8

PF02374

ArsA_ATPase

Anion-transporting ATPase

63

150

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uyk-assembly1.cif.gz_B dark-operative protochlorophyllide oxidoreductase in the nucleotide-free form. 0.9501 35 300
3fwy-assembly1.cif.gz_B crystal structure of the l protein of rhodobacter sphaeroides light-independent protochlorophyllide reductase (bchl) with mgadp bound: a homologue of the nitrogenase fe protein 0.9481 36 302
6uyk-assembly1.cif.gz_A dark-operative protochlorophyllide oxidoreductase in the nucleotide-free form. 0.948 36 294
6uyk-assembly2.cif.gz_D dark-operative protochlorophyllide oxidoreductase in the nucleotide-free form. 0.9461 36 296
2ynm-assembly1.cif.gz_B structure of the adpxalf3-stabilized transition state of the nitrogenase-like dark-operative protochlorophyllide oxidoreductase complex from prochlorococcus marinus with its substrate protochlorophyllide a 0.9412 36 301
ID Description Score Start End Superfamily
3endA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9417 36 302 3.40.50.300
3endA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9349 36 302 3.40.50.300
6q93B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8926 36 299 3.40.50.300
6q93B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.859 36 299 3.40.50.300
1hyqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8333 36 278 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N3CJY1-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein 0.9821 187 302 GO:0005524
GO:0016491
AF-A0A2N3CJY1-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein 0.9657 187 302 GO:0005524
GO:0016491
AF-A0A2D6IR42-F1-model_v4 Ferredoxin:protochlorophyllide reductase (ATP-dependent) iron-sulfur ATP-binding protein 0.9558 133 302 GO:0005524
GO:0016491
GO:0046872
GO:0051536
AF-A0A2D5BGB8-F1-model_v4 deleted 0.9548 42 302
AF-A0A7W2C3W4-F1-model_v4 deleted 0.9539 16 302

Map