F410273

General Info

Members Datasets Scaffolds Average Seq Length
330 219 309 398

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000182|Ga0501034_0000182_79805_81178
Length 457
Sequence LRNVTVSRETVRAENAETCIPLYHVYKIVRSADREEESSMHKGAAEQAGVAGMEATGGGAAPLPLSGLRVLDLSQVMAGPFCCMLLGDMGADVIKVEPPGVGDQTRKSMGFRMKGEDSPGFLALNRNKRSITLNLKTEAGRAVFYELVKTADIMVENSRPGVARKLGIDYPTLNAINPRLVYASISGFGQTGPWSQRPGFDLIAQAMSGIISAMGLPGAEPVKSGVPVGDLGAGLFAMYGILSAVIGRQHTGRGQYIDTSLFDAALALSVWETTELWATGNSPGPLGTANRMSAPYQAFSGSDGRFVVGAANQRLWLRFLEVIGRPELASDPRYLDNKDRVAHRRELADELAPTFATRSALDWVDAFLDAGVPAGPINSYVEAFDNDHARARGAMIEIEHPVEGKFKALGFPVKMSGPGPDVRMPPPLLGQHTADIVGRLGLGPRYGELEAAGAFSE

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2643221733 Bosea sp. Root381 Isolate Unclassified
4 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
5 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
6 2842733646 Variovorax sp. R-72446 Isolate Unclassified
7 2855730933 Achromobacter sp. HZ28 Isolate Nodule
8 2855767633 Achromobacter sp. HZ34 Isolate Nodule
9 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
10 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
11 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
12 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
13 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
14 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
15 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
16 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
168 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
217 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
218 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
219 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.64
Metatranscriptomes 0
Isolates 6.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.52
Nodule 1.52
Rhizoplane 0.61
Rhizosphere 74.55
Stem 0
Stem Tuber 0
Unclassified 11.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005614 3300001904 Bacteria 2119
2 JGI24739J22299_10000316 3300001989 Bacteria 16524
3 JGI24737J22298_10004420 3300001990 Bacteria 4902
4 JGI24743J22301_10007606 3300001991 Bacteria 1884
5 JGI24735J21928_10007359 3300002067 Bacteria 3592
6 JGI24735J21928_10013052 3300002067 Bacteria 2618
7 JGI24735J21928_10016623 3300002067 Bacteria 2279
8 JGI24735J21928_10017105 3300002067 Bacteria 2244
9 JGI25151J46595_10001280 3300003187 Bacteria 17745
10 JGI25151J46595_10003813 3300003187 Bacteria 8172
11 JGI25151J46595_10006982 3300003187 Bacteria 5592
12 JGI25406J46586_10001541 3300003203 Bacteria 10888
13 Ga0055526_1000318 3300003771 Bacteria 40039
14 Ga0055526_1021360 3300003771 Bacteria 2255
15 Ga0055537_1004061 3300003773 Bacteria 4292
16 Ga0055524_1001068 3300003775 Bacteria 16849
17 Ga0070658_10000106 3300005327 Bacteria 74827
18 Ga0070658_10007041 3300005327 Bacteria 9073
19 Ga0070666_10226131 3300005335 Bacteria 1321
20 Ga0070660_100005028 3300005339 Bacteria 9141
21 Ga0070675_100006461 3300005354 Bacteria 8999
22 Ga0070671_100016127 3300005355 Bacteria 6040
23 Ga0070673_100000008 3300005364 Bacteria 166844
24 Ga0070659_100127205 3300005366 Bacteria 2068
25 Ga0070667_100010667 3300005367 Bacteria 7590
26 Ga0070701_10011535 3300005438 Bacteria 3955
27 Ga0070694_100133407 3300005444 Bacteria 1796
28 Ga0070663_100010470 3300005455 Bacteria 5779
29 Ga0070662_100056688 3300005457 Bacteria 2845
30 Ga0068867_100000003 3300005459 Bacteria 217886
31 Ga0070707_100263084 3300005468 Bacteria 1678
32 Ga0068853_100011610 3300005539 Bacteria 7160
33 Ga0070672_100211813 3300005543 Bacteria 1623
34 Ga0070695_100138345 3300005545 Bacteria 1685
35 Ga0070665_100014961 3300005548 Bacteria 7788
36 Ga0070665_100198611 3300005548 Bacteria 2006
37 Ga0068855_100000183 3300005563 Bacteria 80725
38 Ga0068855_100084440 3300005563 Bacteria 3676
39 Ga0068854_100000151 3300005578 Bacteria 48172
40 Ga0068856_100044040 3300005614 Bacteria 4391
41 Ga0068852_100000537 3300005616 Bacteria 24919
42 Ga0068859_100000474 3300005617 Bacteria 39638
43 Ga0068859_100027858 3300005617 Bacteria 5666
44 Ga0068864_100095362 3300005618 Bacteria 2631
45 Ga0068861_100000402 3300005719 Bacteria 25029
46 Ga0068863_100003804 3300005841 Bacteria 14918
47 Ga0068863_100013216 3300005841 Bacteria 7962
48 Ga0068858_100004261 3300005842 Bacteria 14061
49 Ga0068858_100010601 3300005842 Bacteria 8724
50 Ga0068860_100001809 3300005843 Bacteria 22764
51 Ga0081538_10003622 3300005981 Bacteria 14521
52 Ga0081539_10000310 3300005985 Bacteria 109306
53 Ga0081539_10000606 3300005985 Bacteria 72943
54 Ga0081539_10009060 3300005985 Bacteria 8437
55 Ga0097621_100007819 3300006237 Bacteria 7671
56 Ga0068871_100074443 3300006358 Bacteria 2801
57 Ga0068865_100000002 3300006881 Bacteria 285745
58 Ga0097620_100000474 3300006931 Bacteria 39638
59 Ga0097620_100027856 3300006931 Bacteria 5666
60 Ga0105251_10052120 3300009011 Bacteria 1949
61 Ga0105240_10013168 3300009093 Bacteria 11377
62 Ga0105240_10108169 3300009093 Bacteria 3369
63 Ga0105245_10271756 3300009098 Bacteria 1653
64 Ga0105247_10011606 3300009101 Bacteria 5307
65 Ga0105247_10031420 3300009101 Bacteria 3222
66 Ga0105247_10206469 3300009101 Bacteria 1323
67 Ga0114129_10097495 3300009147 Bacteria 4070
68 Ga0105243_10000031 3300009148 Bacteria 185825
69 Ga0105241_10127900 3300009174 Bacteria 2053
70 Ga0105242_10000193 3300009176 Bacteria 47293
71 Ga0105248_10000361 3300009177 Bacteria 53041
72 Ga0105248_10005925 3300009177 Bacteria 13438
73 Ga0105237_10000130 3300009545 Bacteria 105282
74 Ga0105237_10156131 3300009545 Bacteria 2279
75 Ga0105237_10239822 3300009545 Bacteria 1814
76 Ga0105238_10118204 3300009551 Bacteria 2631
77 Ga0105238_10144072 3300009551 Bacteria 2359
78 Ga0105249_10034409 3300009553 Bacteria 4592
79 Ga0105249_10044724 3300009553 Bacteria 4026
80 Ga0105249_10213653 3300009553 Bacteria 1894
81 Ga0105249_10292731 3300009553 Bacteria 1630
82 Ga0105239_10000605 3300010375 Bacteria 51086
83 Ga0105239_10050131 3300010375 Bacteria 4579
84 Ga0105246_10006967 3300011119 Bacteria 6913
85 Ga0157373_10010252 3300013100 Bacteria 6903
86 Ga0157370_10148287 3300013104 Bacteria 2184
87 Ga0157369_10166394 3300013105 Bacteria 2325
88 Ga0157369_10261578 3300013105 Bacteria 1804
89 Ga0157374_10030085 3300013296 Bacteria 4927
90 Ga0157374_10159772 3300013296 Bacteria 2195
91 Ga0157378_10048774 3300013297 Bacteria 3766
92 Ga0163162_10054226 3300013306 Bacteria 4032
93 Ga0163162_10168684 3300013306 Bacteria 2313
94 Ga0157372_10004526 3300013307 Bacteria 14816
95 Ga0157372_10103698 3300013307 Bacteria 3250
96 Ga0157372_10106368 3300013307 Bacteria 3209
97 Ga0157372_10120689 3300013307 Bacteria 3010
98 Ga0157375_10000990 3300013308 Bacteria 24534
99 Ga0163163_10048187 3300014325 Bacteria 4189
100 Ga0182008_10000219 3300014497 Bacteria 44976
101 Ga0157379_10015521 3300014968 Bacteria 6684
102 Ga0157379_10020201 3300014968 Bacteria 5886
103 Ga0157379_10126147 3300014968 Bacteria 2303
104 Ga0157379_10140072 3300014968 Bacteria 2180
105 Ga0157376_10000172 3300014969 Bacteria 44803
106 Ga0163161_10007504 3300017792 Bacteria 7537
107 Ga0163161_10074985 3300017792 Bacteria 2482
108 Ga0209148_1000160 3300025254 Bacteria 139522
109 Ga0209148_1000579 3300025254 Bacteria 33716
110 Ga0209129_1001343 3300025258 Bacteria 13905
111 Ga0209565_1000021 3300025263 Bacteria 406281
112 Ga0209455_1002767 3300025272 Bacteria 6565
113 Ga0209025_1000029 3300025294 Bacteria 488571
114 Ga0209025_1000141 3300025294 Bacteria 184281
115 Ga0209025_1002851 3300025294 Bacteria 17343
116 Ga0209025_1008454 3300025294 Bacteria 7407
117 Ga0209025_1037017 3300025294 Bacteria 2173
118 Ga0209564_1000054 3300025295 Bacteria 350653
119 Ga0209564_1000452 3300025295 Bacteria 69505
120 Ga0209256_1000330 3300025299 Bacteria 79958
121 Ga0209256_1000501 3300025299 Bacteria 57500
122 Ga0209256_1003754 3300025299 Bacteria 10255
123 Ga0207710_10001989 3300025900 Bacteria 9751
124 Ga0207710_10021535 3300025900 Bacteria 2763
125 Ga0207680_10053138 3300025903 Bacteria 2431
126 Ga0207680_10149865 3300025903 Bacteria 1554
127 Ga0207647_10000314 3300025904 Bacteria 40279
128 Ga0207645_10000940 3300025907 Bacteria 24200
129 Ga0207705_10000078 3300025909 Bacteria 120247
130 Ga0207705_10000354 3300025909 Bacteria 41477
131 Ga0207705_10005730 3300025909 Bacteria 9277
132 Ga0207695_10013634 3300025913 Bacteria 9679
133 Ga0207695_10027428 3300025913 Bacteria 6343
134 Ga0207695_10031626 3300025913 Bacteria 5801
135 Ga0207671_10001177 3300025914 Bacteria 31119
136 Ga0207671_10020229 3300025914 Bacteria 5070
137 Ga0207671_10087798 3300025914 Bacteria 2339
138 Ga0207671_10113037 3300025914 Bacteria 2068
139 Ga0207657_10002458 3300025919 Bacteria 20026
140 Ga0207657_10003588 3300025919 Bacteria 16563
141 Ga0207646_10186875 3300025922 Bacteria 1871
142 Ga0207681_10162242 3300025923 Bacteria 1686
143 Ga0207694_10027265 3300025924 Bacteria 4350
144 Ga0207694_10078694 3300025924 Bacteria 2585
145 Ga0207659_10026637 3300025926 Bacteria 3903
146 Ga0207644_10015655 3300025931 Bacteria 5095
147 Ga0207644_10195059 3300025931 Bacteria 1594
148 Ga0207690_10058517 3300025932 Bacteria 2607
149 Ga0207706_10009378 3300025933 Bacteria 8985
150 Ga0207706_10028241 3300025933 Bacteria 5011
151 Ga0207686_10000821 3300025934 Bacteria 18958
152 Ga0207709_10000237 3300025935 Bacteria 69190
153 Ga0207704_10000003 3300025938 Bacteria 285808
154 Ga0207691_10062443 3300025940 Bacteria 3380
155 Ga0207691_10146941 3300025940 Bacteria 2075
156 Ga0207711_10000649 3300025941 Bacteria 34680
157 Ga0207661_10176348 3300025944 Bacteria 1864
158 Ga0207667_10000007 3300025949 Bacteria 630590
159 Ga0207667_10007580 3300025949 Bacteria 13018
160 Ga0207667_10063192 3300025949 Bacteria 3868
161 Ga0207651_10000003 3300025960 Bacteria 308050
162 Ga0207712_10055586 3300025961 Bacteria 2785
163 Ga0207712_10162508 3300025961 Bacteria 1737
164 Ga0207712_10242107 3300025961 Bacteria 1453
165 Ga0207640_10000263 3300025981 Bacteria 35443
166 Ga0207640_10039331 3300025981 Bacteria 2993
167 Ga0207658_10008131 3300025986 Bacteria 7144
168 Ga0207658_10034694 3300025986 Bacteria 3607
169 Ga0207677_10000628 3300026023 Bacteria 21418
170 Ga0207703_10001419 3300026035 Bacteria 21845
171 Ga0207703_10002123 3300026035 Bacteria 17434
172 Ga0207639_10012254 3300026041 Bacteria 5969
173 Ga0207639_10015159 3300026041 Bacteria 5431
174 Ga0207639_10095073 3300026041 Bacteria 2394
175 Ga0207678_10020521 3300026067 Bacteria 5792
176 Ga0207678_10122875 3300026067 Bacteria 2215
177 Ga0207708_10282300 3300026075 Bacteria 1346
178 Ga0207702_10048181 3300026078 Bacteria 3593
179 Ga0207641_10000650 3300026088 Bacteria 37805
180 Ga0207641_10141594 3300026088 Bacteria 2170
181 Ga0207648_10000007 3300026089 Bacteria 217865
182 Ga0207676_10141860 3300026095 Bacteria 2058
183 Ga0207676_10178286 3300026095 Bacteria 1858
184 Ga0207676_10299461 3300026095 Bacteria 1468
185 Ga0207674_10026672 3300026116 Bacteria 6129
186 Ga0207675_100000285 3300026118 Bacteria 48665
187 Ga0207675_100230678 3300026118 Bacteria 1786
188 Ga0207698_10013684 3300026142 Bacteria 5362
189 Ga0268266_10003131 3300028379 Bacteria 16826
190 Ga0268265_10166845 3300028380 Bacteria 1877
191 Ga0268264_10000188 3300028381 Bacteria 129042
192 Ga0268264_10071105 3300028381 Bacteria 2947
193 Ga0265334_10023511 3300028573 Bacteria 2505
194 Ga0265318_10014941 3300028577 Bacteria 3246
195 Ga0307515_10000208 3300028794 Bacteria 144484
196 Ga0307515_10059020 3300028794 Bacteria 5509
197 Ga0307512_10010122 3300030522 Bacteria 9020
198 Ga0316182_1040504 3300030745 Bacteria 9069
199 Ga0265331_10004682 3300031250 Bacteria 8470
200 Ga0307513_10050556 3300031456 Bacteria 4492
201 Ga0307513_10099079 3300031456 Bacteria 2944
202 Ga0307513_10130827 3300031456 Bacteria 2456
203 Ga0307408_100285236 3300031548 Bacteria 1377
204 Ga0307508_10000251 3300031616 Bacteria 65275
205 Ga0307410_10072225 3300031852 Bacteria 2396
206 Ga0307406_10053599 3300031901 Bacteria 2570
207 Ga0307412_10137175 3300031911 Bacteria 1786
208 Ga0307412_10193272 3300031911 Bacteria 1540
209 Ga0307414_10001453 3300032004 Bacteria 12302
210 Ga0307414_10006866 3300032004 Bacteria 6369
211 Ga0307411_10127466 3300032005 Bacteria 1854
212 Ga0307411_10136331 3300032005 Bacteria 1803
213 Ga0307415_100235108 3300032126 Bacteria 1478
214 Ga0395900_0114031 3300037418 Bacteria 2774
215 Ga0395905_0003260 3300037471 Bacteria 17452
216 Ga0395905_0026644 3300037471 Bacteria 5450
217 Ga0395905_0054790 3300037471 Bacteria 3732
218 Ga0395901_0023083 3300038443 Bacteria 6376
219 Ga0395901_0114610 3300038443 Bacteria 2831
220 Ga0395901_0254294 3300038443 Bacteria 1830
221 Ga0439448_0002098 3300042005 Bacteria 5355
222 Ga0439458_0001788 3300042157 Bacteria 5351
223 Ga0439464_0009845 3300042439 Bacteria 2519
224 Ga0466965_0016816 3300044683 Bacteria 3488
225 Ga0466961_0010796 3300044693 Bacteria 5834
226 Ga0466963_0001878 3300044694 Bacteria 11460
227 Ga0466964_0000784 3300044706 Bacteria 10345
228 Ga0466971_0010331 3300044719 Bacteria 4078
229 Ga0466968_0031011 3300044735 Bacteria 2217
230 Ga0466957_0015835 3300044842 Bacteria 4406
231 Ga0466959_0100460 3300045049 Unclassified 2071
232 Ga0466958_0004157 3300045836 Bacteria 7604
233 Ga0466967_0002434 3300045976 Bacteria 11583
234 Ga0466967_0202844 3300045976 Bacteria 1879
235 Ga0495638_0000253 3300046460 Bacteria 72446
236 Ga0495610_0002065 3300046512 Bacteria 17145
237 Ga0495616_0002734 3300046513 Bacteria 11547
238 Ga0495620_0014120 3300046515 Bacteria 4069
239 Ga0495620_0091423 3300046515 Bacteria 1221
240 Ga0495631_0000042 3300046518 Bacteria 78766
241 Ga0495637_0007319 3300046520 Bacteria 5483
242 Ga0495621_0003790 3300046539 Bacteria 4193
243 Ga0495597_0076904 3300046542 Bacteria 1431
244 Ga0495625_0000031 3300046660 Bacteria 238193
245 Ga0495625_0012889 3300046660 Bacteria 6755
246 Ga0495670_0024644 3300046691 Bacteria 2974
247 Ga0495670_0049727 3300046691 Bacteria 2098
248 Ga0495686_0002011 3300047472 Bacteria 20108
249 Ga0495686_0002084 3300047472 Bacteria 19662
250 Ga0496112_0027529 3300048915 Bacteria 5481
251 Ga0496113_0204081 3300048916 Bacteria 1572
252 Ga0496117_0000035 3300048920 Bacteria 326449
253 Ga0496117_0027593 3300048920 Bacteria 4418
254 Ga0496118_0000054 3300048921 Bacteria 233617
255 Ga0496118_0065230 3300048921 Bacteria 2665
256 Ga0496119_0000260 3300048922 Bacteria 74908
257 Ga0496119_0004560 3300048922 Bacteria 13709
258 Ga0496119_0017040 3300048922 Bacteria 5492
259 Ga0496120_0000061 3300048923 Bacteria 172817
260 Ga0496121_0000114 3300048924 Bacteria 179427
261 Ga0496121_0002192 3300048924 Bacteria 30563
262 Ga0496121_0052306 3300048924 Bacteria 3432
263 Ga0496121_0114911 3300048924 Bacteria 2045
264 Ga0496122_0000531 3300048925 Bacteria 79144
265 Ga0496122_0001585 3300048925 Bacteria 35726
266 Ga0496122_0058812 3300048925 Bacteria 2842
267 Ga0496123_0010976 3300048926 Bacteria 7922
268 Ga0496124_0005523 3300048927 Bacteria 14188
269 Ga0496125_0001169 3300048928 Bacteria 39735
270 Ga0496125_0003275 3300048928 Bacteria 19914
271 Ga0496125_0007617 3300048928 Bacteria 11491
272 Ga0496125_0020333 3300048928 Bacteria 6231
273 Ga0496125_0106181 3300048928 Bacteria 2050
274 Ga0496126_0096214 3300048929 Bacteria 2596
275 Ga0501034_0000182 3300049571 Bacteria 117605
276 Ga0501034_0042861 3300049571 Bacteria 4581
277 Ga0501034_0051000 3300049571 Bacteria 4173
278 Ga0501034_0291441 3300049571 Bacteria 1570
279 Ga0501034_0367991 3300049571 Bacteria 1364
280 Ga0501036_0095467 3300049572 Bacteria 2513
281 Ga0501037_0046968 3300049573 Bacteria 3165
282 Ga0501040_0065584 3300049576 Bacteria 2501
283 Ga0501042_0153344 3300049578 Bacteria 1661
284 Ga0501043_0137094 3300049579 Bacteria 1917
285 Ga0501046_0219354 3300049580 Bacteria 1409
286 Ga0501073_0046377 3300049589 Bacteria 3057
287 Ga0501074_0077546 3300049590 Bacteria 2385
288 Ga0501074_0088088 3300049590 Bacteria 2223
289 Ga0501075_0024361 3300049591 Bacteria 4437
290 Ga0501081_0081018 3300049743 Bacteria 2273
291 nmdc:mga00v17_29975_c1 3300050491 Bacteria 3196
292 nmdc:mga05p37_132839_c1 3300050507 Bacteria 3053
293 Ga0500610_0000161 3300053079 Bacteria 19927
294 Ga0500646_0014559 3300053090 Bacteria 2042
295 Ga0500583_0000478 3300053092 Bacteria 12431
296 Ga0500583_0000701 3300053092 Bacteria 9778
297 Ga0500641_0011430 3300053096 Bacteria 3222
298 Ga0500555_000086 3300053103 Bacteria 44938
299 Ga0500562_000459 3300053108 Bacteria 9883
300 Ga0500562_006861 3300053108 Bacteria 2873
301 Ga0500592_001495 3300053116 Bacteria 3788
302 Ga0500607_020093 3300053121 Bacteria 3774
303 Ga0500658_0001311 3300053134 Bacteria 10071
304 Ga0500568_0007511 3300053139 Bacteria 5341
305 Ga0500616_0005654 3300053153 Bacteria 8433
306 Ga0500622_0000698 3300053156 Bacteria 29555
307 Ga0500622_0001442 3300053156 Bacteria 19051
308 Ga0466962_0009209 3300061719 Bacteria 4731
309 Ga0530510_0024405 3300061734 Bacteria 4313

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0291441 Ga0501034_0291441_511_1548 324
2 3300031852 Ga0307410_10072225 Ga0307410_100722252 360
3 3300049576 Ga0501040_0065584 Ga0501040_0065584_102_1301 363
4 3300049578 Ga0501042_0153344 Ga0501042_0153344_149_1348 363
5 3300049591 Ga0501075_0024361 Ga0501075_0024361_2001_3200 363
6 3300049743 Ga0501081_0081018 Ga0501081_0081018_735_1934 363
7 3300061734 Ga0530510_0024405 Ga0530510_0024405_3002_4201 363
8 3300005468 Ga0070707_100263084 Ga0070707_1002630841 365
9 3300025922 Ga0207646_10186875 Ga0207646_101868751 365
10 3300031548 Ga0307408_100285236 Ga0307408_1002852362 365
11 3300005438 Ga0070701_10011535 Ga0070701_100115354 369
12 3300005444 Ga0070694_100133407 Ga0070694_1001334071 369
13 3300005545 Ga0070695_100138345 Ga0070695_1001383452 369
14 3300005617 Ga0068859_100027858 Ga0068859_1000278584 369
15 3300006931 Ga0097620_100027856 Ga0097620_1000278564 369
16 3300009553 Ga0105249_10213653 Ga0105249_102136532 369
17 3300014968 Ga0157379_10126147 Ga0157379_101261471 369
18 3300026095 Ga0207676_10141860 Ga0207676_101418601 369
19 3300028381 Ga0268264_10071105 Ga0268264_100711052 369
20 3300032005 Ga0307411_10136331 Ga0307411_101363312 373
21 3300009098 Ga0105245_10271756 Ga0105245_102717562 374
22 3300025940 Ga0207691_10062443 Ga0207691_100624433 374
23 3300025944 Ga0207661_10176348 Ga0207661_101763482 374
24 3300026118 Ga0207675_100230678 Ga0207675_1002306782 374
25 3300042439 Ga0439464_0009845 Ga0439464_0009845_1320_2471 374
26 3300049580 Ga0501046_0219354 Ga0501046_0219354_211_1335 374
27 3300049590 Ga0501074_0088088 Ga0501074_0088088_29_1198 377
28 3300046515 Ga0495620_0091423 Ga0495620_0091423_41_1195 379
29 3300009101 Ga0105247_10206469 Ga0105247_102064691 381
30 3300026075 Ga0207708_10282300 Ga0207708_102823002 381
31 3300028380 Ga0268265_10166845 Ga0268265_101668452 381
32 iso_pu_bacteria 2791354901 2791915625 383
33 iso_pu_bacteria 2866612099 2866617890 383
34 iso_pu_bacteria 2899359706 2899364374 383
35 3300048924 Ga0496121_0052306 Ga0496121_0052306_1186_2364 384
36 iso_pu_bacteria 2508501114 2509078487 384
37 iso_pu_bacteria 8054563764 8054566780 384
38 3300005985 Ga0081539_10000606 Ga0081539_1000060623 385
39 3300005985 Ga0081539_10009060 Ga0081539_100090608 385
40 3300031911 Ga0307412_10137175 Ga0307412_101371752 385
41 3300032126 Ga0307415_100235108 Ga0307415_1002351081 385
42 3300005981 Ga0081538_10003622 Ga0081538_100036226 386
43 3300047472 Ga0495686_0002084 Ga0495686_0002084_11386_12549 386
44 3300003203 JGI25406J46586_10001541 JGI25406J46586_100015419 387
45 3300005985 Ga0081539_10000310 Ga0081539_1000031065 387
46 3300009093 Ga0105240_10108169 Ga0105240_101081692 387
47 3300009147 Ga0114129_10097495 Ga0114129_100974952 387
48 3300013104 Ga0157370_10148287 Ga0157370_101482872 387
49 3300013105 Ga0157369_10261578 Ga0157369_102615782 387
50 3300025258 Ga0209129_1001343 Ga0209129_100134313 387
51 3300030522 Ga0307512_10010122 Ga0307512_100101224 387
52 3300045976 Ga0466967_0202844 Ga0466967_0202844_191_1423 387
53 3300050507 nmdc:mga05p37_132839_c1 nmdc:mga05p37_132839_c1_1627_2820 387
54 3300053092 Ga0500583_0000701 Ga0500583_0000701_6076_7245 387
55 3300005355 Ga0070671_100016127 Ga0070671_1000161275 388
56 3300005367 Ga0070667_100010667 Ga0070667_1000106673 388
57 3300005548 Ga0070665_100014961 Ga0070665_1000149617 388
58 3300005548 Ga0070665_100198611 Ga0070665_1001986112 388
59 3300005841 Ga0068863_100013216 Ga0068863_1000132166 388
60 3300005842 Ga0068858_100010601 Ga0068858_1000106014 388
61 3300009101 Ga0105247_10011606 Ga0105247_100116062 388
62 3300009553 Ga0105249_10044724 Ga0105249_100447244 388
63 3300013306 Ga0163162_10054226 Ga0163162_100542264 388
64 3300014325 Ga0163163_10048187 Ga0163163_100481873 388
65 3300014968 Ga0157379_10015521 Ga0157379_100155213 388
66 3300025900 Ga0207710_10001989 Ga0207710_100019895 388
67 3300025903 Ga0207680_10053138 Ga0207680_100531382 388
68 3300025914 Ga0207671_10087798 Ga0207671_100877982 388
69 3300025931 Ga0207644_10195059 Ga0207644_101950591 388
70 3300025986 Ga0207658_10008131 Ga0207658_100081315 388
71 3300026035 Ga0207703_10001419 Ga0207703_100014194 388
72 3300026088 Ga0207641_10141594 Ga0207641_101415942 388
73 3300028379 Ga0268266_10003131 Ga0268266_100031317 388
74 3300028794 Ga0307515_10059020 Ga0307515_100590202 388
75 3300037471 Ga0395905_0026644 Ga0395905_0026644_2128_3327 388
76 3300046691 Ga0495670_0049727 Ga0495670_0049727_353_1552 388
77 3300048915 Ga0496112_0027529 Ga0496112_0027529_819_2003 388
78 3300048924 Ga0496121_0002192 Ga0496121_0002192_17222_18406 388
79 3300048928 Ga0496125_0007617 Ga0496125_0007617_4791_5975 388
80 iso_pu_bacteria 2939631187 2939632040 388
81 iso_pu_bacteria 644736347 644747960 388
82 3300003187 JGI25151J46595_10003813 JGI25151J46595_100038134 389
83 3300003771 Ga0055526_1021360 Ga0055526_10213602 389
84 3300003773 Ga0055537_1004061 Ga0055537_10040613 389
85 3300003775 Ga0055524_1001068 Ga0055524_10010684 389
86 3300025263 Ga0209565_1000021 Ga0209565_1000021105 389
87 3300025294 Ga0209025_1002851 Ga0209025_100285115 389
88 3300025294 Ga0209025_1008454 Ga0209025_10084546 389
89 3300025295 Ga0209564_1000452 Ga0209564_100045223 389
90 3300025299 Ga0209256_1000501 Ga0209256_10005019 389
91 3300025299 Ga0209256_1003754 Ga0209256_10037545 389
92 3300030745 Ga0316182_1040504 Ga0316182_10405042 389
93 3300031911 Ga0307412_10193272 Ga0307412_101932721 389
94 3300032004 Ga0307414_10001453 Ga0307414_100014536 389
95 3300032005 Ga0307411_10127466 Ga0307411_101274662 389
96 3300038443 Ga0395901_0114610 Ga0395901_0114610_832_2127 389
97 3300038443 Ga0395901_0254294 Ga0395901_0254294_177_1436 389
98 3300049571 Ga0501034_0000182 Ga0501034_0000182_79805_81178 389
99 3300049571 Ga0501034_0042861 Ga0501034_0042861_1085_2341 389
100 3300049571 Ga0501034_0367991 Ga0501034_0367991_96_1340 389
101 3300049572 Ga0501036_0095467 Ga0501036_0095467_993_2255 389
102 3300049579 Ga0501043_0137094 Ga0501043_0137094_81_1343 389
103 3300049589 Ga0501073_0046377 Ga0501073_0046377_786_2048 389
104 3300049590 Ga0501074_0077546 Ga0501074_0077546_388_1650 389
105 3300053103 Ga0500555_000086 Ga0500555_000086_21693_22865 389
106 3300053121 Ga0500607_020093 Ga0500607_020093_866_2089 389
107 iso_pu_bacteria 2881412998 2881413218 389
108 iso_pu_bacteria 2904541872 2904548686 389
109 iso_pu_bacteria 2929160207 2929164648 389
110 iso_pu_bacteria 2954767861 2954771397 389
111 3300047472 Ga0495686_0002011 Ga0495686_0002011_8055_9233 390
112 3300048916 Ga0496113_0204081 Ga0496113_0204081_227_1405 390
113 3300048922 Ga0496119_0017040 Ga0496119_0017040_340_1518 390
114 iso_pu_bacteria 2513237150 2513955235 390
115 iso_pu_bacteria 2643221733 2644728564 390
116 iso_pu_bacteria 2842733646 2842737487 390
117 iso_pu_bacteria 2855730933 2855736113 390
118 iso_pu_bacteria 2855767633 2855773050 390
119 iso_pu_bacteria 2904541872 2904545650 390
120 iso_pu_bacteria 2929160207 2929168293 390
121 iso_pu_bacteria 8045864390 8045866859 390
122 3300037418 Ga0395900_0114031 Ga0395900_0114031_1451_2704 391
123 3300037471 Ga0395905_0003260 Ga0395905_0003260_4506_5759 391
124 3300038443 Ga0395901_0023083 Ga0395901_0023083_4203_5456 391
125 iso_pu_bacteria 2775507255 2778126940 391
126 iso_pu_bacteria 8057101203 8057102677 391
127 3300005327 Ga0070658_10000106 Ga0070658_1000010652 392
128 3300005339 Ga0070660_100005028 Ga0070660_1000050284 392
129 3300025909 Ga0207705_10000078 Ga0207705_1000007880 392
130 3300025919 Ga0207657_10003588 Ga0207657_1000358811 392
131 3300042005 Ga0439448_0002098 Ga0439448_0002098_687_1868 392
132 3300042157 Ga0439458_0001788 Ga0439458_0001788_1679_2860 392
133 3300053096 Ga0500641_0011430 Ga0500641_0011430_1752_2933 392
134 3300013105 Ga0157369_10166394 Ga0157369_101663942 393
135 3300025932 Ga0207690_10058517 Ga0207690_100585172 393
136 3300025933 Ga0207706_10028241 Ga0207706_100282412 393
137 3300028794 Ga0307515_10000208 Ga0307515_1000020884 393
138 3300050491 nmdc:mga00v17_29975_c1 nmdc:mga00v17_29975_c1_1445_2662 393
139 3300003187 JGI25151J46595_10001280 JGI25151J46595_100012804 394
140 3300003187 JGI25151J46595_10006982 JGI25151J46595_100069824 394
141 3300003771 Ga0055526_1000318 Ga0055526_100031822 394
142 3300014497 Ga0182008_10000219 Ga0182008_1000021931 394
143 3300017792 Ga0163161_10007504 Ga0163161_100075043 394
144 3300025294 Ga0209025_1000029 Ga0209025_100002977 394
145 3300025294 Ga0209025_1000141 Ga0209025_1000141145 394
146 3300025294 Ga0209025_1037017 Ga0209025_10370171 394
147 3300025295 Ga0209564_1000054 Ga0209564_100005466 394
148 3300025299 Ga0209256_1000330 Ga0209256_100033025 394
149 3300025923 Ga0207681_10162242 Ga0207681_101622422 394
150 3300025961 Ga0207712_10162508 Ga0207712_101625082 394
151 3300031456 Ga0307513_10050556 Ga0307513_100505562 394
152 3300031456 Ga0307513_10099079 Ga0307513_100990792 394
153 3300031456 Ga0307513_10130827 Ga0307513_101308271 394
154 3300031616 Ga0307508_10000251 Ga0307508_1000025116 394
155 3300031901 Ga0307406_10053599 Ga0307406_100535992 394
156 3300032004 Ga0307414_10006866 Ga0307414_100068663 394
157 3300046512 Ga0495610_0002065 Ga0495610_0002065_44_1267 394
158 3300046513 Ga0495616_0002734 Ga0495616_0002734_1313_2536 394
159 3300046515 Ga0495620_0014120 Ga0495620_0014120_1776_2999 394
160 3300046518 Ga0495631_0000042 Ga0495631_0000042_43868_45091 394
161 3300046520 Ga0495637_0007319 Ga0495637_0007319_1681_2904 394
162 3300046539 Ga0495621_0003790 Ga0495621_0003790_1228_2451 394
163 3300046660 Ga0495625_0012889 Ga0495625_0012889_1065_2288 394
164 3300046691 Ga0495670_0024644 Ga0495670_0024644_1116_2339 394
165 3300048924 Ga0496121_0000114 Ga0496121_0000114_90988_92181 394
166 3300048925 Ga0496122_0000531 Ga0496122_0000531_48918_50141 394
167 3300048928 Ga0496125_0020333 Ga0496125_0020333_1453_2640 394
168 3300049571 Ga0501034_0051000 Ga0501034_0051000_1338_2528 394
169 3300049573 Ga0501037_0046968 Ga0501037_0046968_67_1257 394
170 3300053079 Ga0500610_0000161 Ga0500610_0000161_15242_16465 394
171 3300053090 Ga0500646_0014559 Ga0500646_0014559_84_1307 394
172 3300053108 Ga0500562_000459 Ga0500562_000459_5966_7201 394
173 3300053108 Ga0500562_006861 Ga0500562_006861_47_1270 394
174 3300053116 Ga0500592_001495 Ga0500592_001495_1728_2951 394
175 3300001904 JGI24736J21556_1005614 JGI24736J21556_10056142 395
176 3300001989 JGI24739J22299_10000316 JGI24739J22299_1000031616 395
177 3300001990 JGI24737J22298_10004420 JGI24737J22298_100044204 395
178 3300001991 JGI24743J22301_10007606 JGI24743J22301_100076062 395
179 3300002067 JGI24735J21928_10007359 JGI24735J21928_100073594 395
180 3300002067 JGI24735J21928_10013052 JGI24735J21928_100130522 395
181 3300002067 JGI24735J21928_10016623 JGI24735J21928_100166232 395
182 3300002067 JGI24735J21928_10017105 JGI24735J21928_100171052 395
183 3300005327 Ga0070658_10007041 Ga0070658_100070415 395
184 3300005335 Ga0070666_10226131 Ga0070666_102261311 395
185 3300005354 Ga0070675_100006461 Ga0070675_1000064616 395
186 3300005364 Ga0070673_100000008 Ga0070673_10000000888 395
187 3300005366 Ga0070659_100127205 Ga0070659_1001272052 395
188 3300005455 Ga0070663_100010470 Ga0070663_1000104704 395
189 3300005457 Ga0070662_100056688 Ga0070662_1000566882 395
190 3300005459 Ga0068867_100000003 Ga0068867_10000000365 395
191 3300005539 Ga0068853_100011610 Ga0068853_1000116107 395
192 3300005543 Ga0070672_100211813 Ga0070672_1002118131 395
193 3300005563 Ga0068855_100000183 Ga0068855_10000018326 395
194 3300005563 Ga0068855_100084440 Ga0068855_1000844402 395
195 3300005578 Ga0068854_100000151 Ga0068854_10000015114 395
196 3300005614 Ga0068856_100044040 Ga0068856_1000440402 395
197 3300005616 Ga0068852_100000537 Ga0068852_10000053716 395
198 3300005617 Ga0068859_100000474 Ga0068859_10000047413 395
199 3300005618 Ga0068864_100095362 Ga0068864_1000953622 395
200 3300005719 Ga0068861_100000402 Ga0068861_10000040216 395
201 3300005841 Ga0068863_100003804 Ga0068863_1000038042 395
202 3300005842 Ga0068858_100004261 Ga0068858_1000042616 395
203 3300005843 Ga0068860_100001809 Ga0068860_1000018099 395
204 3300006237 Ga0097621_100007819 Ga0097621_1000078192 395
205 3300006358 Ga0068871_100074443 Ga0068871_1000744432 395
206 3300006881 Ga0068865_100000002 Ga0068865_100000002194 395
207 3300006931 Ga0097620_100000474 Ga0097620_10000047413 395
208 3300009011 Ga0105251_10052120 Ga0105251_100521202 395
209 3300009093 Ga0105240_10013168 Ga0105240_100131682 395
210 3300009101 Ga0105247_10031420 Ga0105247_100314203 395
211 3300009148 Ga0105243_10000031 Ga0105243_1000003164 395
212 3300009174 Ga0105241_10127900 Ga0105241_101279002 395
213 3300009176 Ga0105242_10000193 Ga0105242_100001934 395
214 3300009177 Ga0105248_10000361 Ga0105248_1000036118 395
215 3300009177 Ga0105248_10005925 Ga0105248_100059259 395
216 3300009545 Ga0105237_10000130 Ga0105237_1000013060 395
217 3300009545 Ga0105237_10156131 Ga0105237_101561312 395
218 3300009545 Ga0105237_10239822 Ga0105237_102398222 395
219 3300009551 Ga0105238_10118204 Ga0105238_101182042 395
220 3300009551 Ga0105238_10144072 Ga0105238_101440722 395
221 3300009553 Ga0105249_10034409 Ga0105249_100344092 395
222 3300009553 Ga0105249_10292731 Ga0105249_102927312 395
223 3300010375 Ga0105239_10000605 Ga0105239_1000060531 395
224 3300010375 Ga0105239_10050131 Ga0105239_100501314 395
225 3300011119 Ga0105246_10006967 Ga0105246_100069672 395
226 3300013100 Ga0157373_10010252 Ga0157373_100102524 395
227 3300013296 Ga0157374_10030085 Ga0157374_100300854 395
228 3300013296 Ga0157374_10159772 Ga0157374_101597722 395
229 3300013297 Ga0157378_10048774 Ga0157378_100487743 395
230 3300013306 Ga0163162_10168684 Ga0163162_101686842 395
231 3300013307 Ga0157372_10004526 Ga0157372_100045265 395
232 3300013307 Ga0157372_10103698 Ga0157372_101036982 395
233 3300013307 Ga0157372_10106368 Ga0157372_101063683 395
234 3300013307 Ga0157372_10120689 Ga0157372_101206892 395
235 3300013308 Ga0157375_10000990 Ga0157375_1000099026 395
236 3300014968 Ga0157379_10020201 Ga0157379_100202015 395
237 3300014968 Ga0157379_10140072 Ga0157379_101400722 395
238 3300014969 Ga0157376_10000172 Ga0157376_1000017210 395
239 3300017792 Ga0163161_10074985 Ga0163161_100749852 395
240 3300025254 Ga0209148_1000160 Ga0209148_100016085 395
241 3300025254 Ga0209148_1000579 Ga0209148_100057916 395
242 3300025272 Ga0209455_1002767 Ga0209455_10027673 395
243 3300025900 Ga0207710_10021535 Ga0207710_100215352 395
244 3300025903 Ga0207680_10149865 Ga0207680_101498651 395
245 3300025904 Ga0207647_10000314 Ga0207647_1000031416 395
246 3300025907 Ga0207645_10000940 Ga0207645_1000094019 395
247 3300025909 Ga0207705_10000354 Ga0207705_1000035418 395
248 3300025909 Ga0207705_10005730 Ga0207705_100057305 395
249 3300025913 Ga0207695_10013634 Ga0207695_100136343 395
250 3300025913 Ga0207695_10027428 Ga0207695_100274282 395
251 3300025913 Ga0207695_10031626 Ga0207695_100316265 395
252 3300025914 Ga0207671_10001177 Ga0207671_100011772 395
253 3300025914 Ga0207671_10020229 Ga0207671_100202293 395
254 3300025914 Ga0207671_10113037 Ga0207671_101130372 395
255 3300025919 Ga0207657_10002458 Ga0207657_100024585 395
256 3300025924 Ga0207694_10027265 Ga0207694_100272653 395
257 3300025924 Ga0207694_10078694 Ga0207694_100786942 395
258 3300025926 Ga0207659_10026637 Ga0207659_100266372 395
259 3300025931 Ga0207644_10015655 Ga0207644_100156554 395
260 3300025933 Ga0207706_10009378 Ga0207706_100093788 395
261 3300025934 Ga0207686_10000821 Ga0207686_1000082114 395
262 3300025935 Ga0207709_10000237 Ga0207709_1000023764 395
263 3300025938 Ga0207704_10000003 Ga0207704_1000000364 395
264 3300025940 Ga0207691_10146941 Ga0207691_101469412 395
265 3300025941 Ga0207711_10000649 Ga0207711_1000064917 395
266 3300025949 Ga0207667_10000007 Ga0207667_10000007573 395
267 3300025949 Ga0207667_10007580 Ga0207667_100075805 395
268 3300025949 Ga0207667_10063192 Ga0207667_100631922 395
269 3300025960 Ga0207651_10000003 Ga0207651_1000000364 395
270 3300025961 Ga0207712_10055586 Ga0207712_100555862 395
271 3300025961 Ga0207712_10242107 Ga0207712_102421072 395
272 3300025981 Ga0207640_10000263 Ga0207640_1000026312 395
273 3300025981 Ga0207640_10039331 Ga0207640_100393312 395
274 3300025986 Ga0207658_10034694 Ga0207658_100346941 395
275 3300026023 Ga0207677_10000628 Ga0207677_100006289 395
276 3300026035 Ga0207703_10002123 Ga0207703_100021236 395
277 3300026041 Ga0207639_10012254 Ga0207639_100122542 395
278 3300026041 Ga0207639_10015159 Ga0207639_100151592 395
279 3300026041 Ga0207639_10095073 Ga0207639_100950732 395
280 3300026067 Ga0207678_10020521 Ga0207678_100205214 395
281 3300026067 Ga0207678_10122875 Ga0207678_101228752 395
282 3300026078 Ga0207702_10048181 Ga0207702_100481812 395
283 3300026088 Ga0207641_10000650 Ga0207641_1000065014 395
284 3300026089 Ga0207648_10000007 Ga0207648_10000007128 395
285 3300026095 Ga0207676_10178286 Ga0207676_101782862 395
286 3300026095 Ga0207676_10299461 Ga0207676_102994612 395
287 3300026116 Ga0207674_10026672 Ga0207674_100266725 395
288 3300026118 Ga0207675_100000285 Ga0207675_10000028518 395
289 3300026142 Ga0207698_10013684 Ga0207698_100136846 395
290 3300028381 Ga0268264_10000188 Ga0268264_10000188110 395
291 3300028573 Ga0265334_10023511 Ga0265334_100235112 395
292 3300028577 Ga0265318_10014941 Ga0265318_100149413 395
293 3300031250 Ga0265331_10004682 Ga0265331_100046823 395
294 3300037471 Ga0395905_0054790 Ga0395905_0054790_2470_3678 395
295 3300044683 Ga0466965_0016816 Ga0466965_0016816_378_1568 395
296 3300044693 Ga0466961_0010796 Ga0466961_0010796_4066_5256 395
297 3300044694 Ga0466963_0001878 Ga0466963_0001878_1247_2437 395
298 3300044706 Ga0466964_0000784 Ga0466964_0000784_196_1386 395
299 3300044719 Ga0466971_0010331 Ga0466971_0010331_1154_2344 395
300 3300044735 Ga0466968_0031011 Ga0466968_0031011_417_1607 395
301 3300044842 Ga0466957_0015835 Ga0466957_0015835_2589_3779 395
302 3300045049 Ga0466959_0100460 Ga0466959_0100460_741_1928 395
303 3300045836 Ga0466958_0004157 Ga0466958_0004157_2661_3851 395
304 3300045976 Ga0466967_0002434 Ga0466967_0002434_7488_8678 395
305 3300046460 Ga0495638_0000253 Ga0495638_0000253_57527_58717 395
306 3300046542 Ga0495597_0076904 Ga0495597_0076904_39_1229 395
307 3300046660 Ga0495625_0000031 Ga0495625_0000031_58698_59888 395
308 3300048920 Ga0496117_0000035 Ga0496117_0000035_172917_174134 395
309 3300048920 Ga0496117_0027593 Ga0496117_0027593_1685_2872 395
310 3300048921 Ga0496118_0000054 Ga0496118_0000054_48927_50144 395
311 3300048921 Ga0496118_0065230 Ga0496118_0065230_1036_2223 395
312 3300048922 Ga0496119_0000260 Ga0496119_0000260_28854_30071 395
313 3300048922 Ga0496119_0004560 Ga0496119_0004560_9416_10633 395
314 3300048923 Ga0496120_0000061 Ga0496120_0000061_161588_162805 395
315 3300048924 Ga0496121_0114911 Ga0496121_0114911_823_2016 395
316 3300048925 Ga0496122_0001585 Ga0496122_0001585_11066_12253 395
317 3300048925 Ga0496122_0058812 Ga0496122_0058812_677_1864 395
318 3300048926 Ga0496123_0010976 Ga0496123_0010976_81_1268 395
319 3300048927 Ga0496124_0005523 Ga0496124_0005523_12880_14067 395
320 3300048928 Ga0496125_0001169 Ga0496125_0001169_23009_24220 395
321 3300048928 Ga0496125_0003275 Ga0496125_0003275_8492_9709 395
322 3300048928 Ga0496125_0106181 Ga0496125_0106181_337_1524 395
323 3300048929 Ga0496126_0096214 Ga0496126_0096214_261_1448 395
324 3300053092 Ga0500583_0000478 Ga0500583_0000478_3907_5124 395
325 3300053134 Ga0500658_0001311 Ga0500658_0001311_6071_7261 395
326 3300053139 Ga0500568_0007511 Ga0500568_0007511_967_2157 395
327 3300053153 Ga0500616_0005654 Ga0500616_0005654_632_1822 395
328 3300053156 Ga0500622_0000698 Ga0500622_0000698_10681_11910 395
329 3300053156 Ga0500622_0001442 Ga0500622_0001442_5106_6335 395
330 3300061719 Ga0466962_0009209 Ga0466962_0009209_1839_3029 395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

65

433

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9485 3 381
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.9416 3 375
4hl6-assembly2.cif.gz_C yfde from escherichia coli 0.9412 3 381
5yiy-assembly1.cif.gz_B crystal structure of d175a mutant of rv3272 from mycobacterium tuberculosis 0.9409 3 375
5yit-assembly1.cif.gz_A crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.94 3 377
ID Description Score Start End Superfamily
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9766 228 319 3.30.1540.10
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9744 27 238 3.40.50.10540
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9685 228 319 3.30.1540.10
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9683 3 285 3.40.50.10540
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9663 228 319 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A259FSB0-F1-model_v4 CoA transferase 0.9855 4 163 GO:0008410
AF-A0A258IQJ1-F1-model_v4 CoA transferase 0.9852 4 393 GO:0008410
AF-A0A3L7VS60-F1-model_v4 CoA transferase 0.9807 3 381 GO:0008410
AF-A0A1F9DFM9-F1-model_v4 Formyl-CoA transferase 0.9805 3 392 GO:0008410
AF-A0A381XRA4-F1-model_v4 CoA transferase 0.9803 4 385 GO:0008410

Feature Viewer

pLDDT pTM Quality
93.83 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map