F410273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 219 | 309 | 398 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0000182|Ga0501034_0000182_79805_81178 |
| Length | 457 |
| Sequence | LRNVTVSRETVRAENAETCIPLYHVYKIVRSADREEESSMHKGAAEQAGVAGMEATGGGAAPLPLSGLRVLDLSQVMAGPFCCMLLGDMGADVIKVEPPGVGDQTRKSMGFRMKGEDSPGFLALNRNKRSITLNLKTEAGRAVFYELVKTADIMVENSRPGVARKLGIDYPTLNAINPRLVYASISGFGQTGPWSQRPGFDLIAQAMSGIISAMGLPGAEPVKSGVPVGDLGAGLFAMYGILSAVIGRQHTGRGQYIDTSLFDAALALSVWETTELWATGNSPGPLGTANRMSAPYQAFSGSDGRFVVGAANQRLWLRFLEVIGRPELASDPRYLDNKDRVAHRRELADELAPTFATRSALDWVDAFLDAGVPAGPINSYVEAFDNDHARARGAMIEIEHPVEGKFKALGFPVKMSGPGPDVRMPPPLLGQHTADIVGRLGLGPRYGELEAAGAFSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 4 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 5 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 6 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 7 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 8 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 9 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 10 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 11 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 12 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 13 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 14 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 15 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 16 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 138 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 139 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 144 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 145 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 154 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 155 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 158 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 159 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 160 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 161 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 162 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 178 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 179 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 180 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 181 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 182 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 183 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 184 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 185 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 186 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 187 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 188 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 189 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 201 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 203 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 204 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 205 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 206 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 207 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 208 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 209 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 210 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 211 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 214 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 215 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 216 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 217 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 218 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 219 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.64 |
| Metatranscriptomes | 0 |
| Isolates | 6.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.52 |
| Nodule | 1.52 |
| Rhizoplane | 0.61 |
| Rhizosphere | 74.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1005614 | 3300001904 | Bacteria | 2119 |
| 2 | JGI24739J22299_10000316 | 3300001989 | Bacteria | 16524 |
| 3 | JGI24737J22298_10004420 | 3300001990 | Bacteria | 4902 |
| 4 | JGI24743J22301_10007606 | 3300001991 | Bacteria | 1884 |
| 5 | JGI24735J21928_10007359 | 3300002067 | Bacteria | 3592 |
| 6 | JGI24735J21928_10013052 | 3300002067 | Bacteria | 2618 |
| 7 | JGI24735J21928_10016623 | 3300002067 | Bacteria | 2279 |
| 8 | JGI24735J21928_10017105 | 3300002067 | Bacteria | 2244 |
| 9 | JGI25151J46595_10001280 | 3300003187 | Bacteria | 17745 |
| 10 | JGI25151J46595_10003813 | 3300003187 | Bacteria | 8172 |
| 11 | JGI25151J46595_10006982 | 3300003187 | Bacteria | 5592 |
| 12 | JGI25406J46586_10001541 | 3300003203 | Bacteria | 10888 |
| 13 | Ga0055526_1000318 | 3300003771 | Bacteria | 40039 |
| 14 | Ga0055526_1021360 | 3300003771 | Bacteria | 2255 |
| 15 | Ga0055537_1004061 | 3300003773 | Bacteria | 4292 |
| 16 | Ga0055524_1001068 | 3300003775 | Bacteria | 16849 |
| 17 | Ga0070658_10000106 | 3300005327 | Bacteria | 74827 |
| 18 | Ga0070658_10007041 | 3300005327 | Bacteria | 9073 |
| 19 | Ga0070666_10226131 | 3300005335 | Bacteria | 1321 |
| 20 | Ga0070660_100005028 | 3300005339 | Bacteria | 9141 |
| 21 | Ga0070675_100006461 | 3300005354 | Bacteria | 8999 |
| 22 | Ga0070671_100016127 | 3300005355 | Bacteria | 6040 |
| 23 | Ga0070673_100000008 | 3300005364 | Bacteria | 166844 |
| 24 | Ga0070659_100127205 | 3300005366 | Bacteria | 2068 |
| 25 | Ga0070667_100010667 | 3300005367 | Bacteria | 7590 |
| 26 | Ga0070701_10011535 | 3300005438 | Bacteria | 3955 |
| 27 | Ga0070694_100133407 | 3300005444 | Bacteria | 1796 |
| 28 | Ga0070663_100010470 | 3300005455 | Bacteria | 5779 |
| 29 | Ga0070662_100056688 | 3300005457 | Bacteria | 2845 |
| 30 | Ga0068867_100000003 | 3300005459 | Bacteria | 217886 |
| 31 | Ga0070707_100263084 | 3300005468 | Bacteria | 1678 |
| 32 | Ga0068853_100011610 | 3300005539 | Bacteria | 7160 |
| 33 | Ga0070672_100211813 | 3300005543 | Bacteria | 1623 |
| 34 | Ga0070695_100138345 | 3300005545 | Bacteria | 1685 |
| 35 | Ga0070665_100014961 | 3300005548 | Bacteria | 7788 |
| 36 | Ga0070665_100198611 | 3300005548 | Bacteria | 2006 |
| 37 | Ga0068855_100000183 | 3300005563 | Bacteria | 80725 |
| 38 | Ga0068855_100084440 | 3300005563 | Bacteria | 3676 |
| 39 | Ga0068854_100000151 | 3300005578 | Bacteria | 48172 |
| 40 | Ga0068856_100044040 | 3300005614 | Bacteria | 4391 |
| 41 | Ga0068852_100000537 | 3300005616 | Bacteria | 24919 |
| 42 | Ga0068859_100000474 | 3300005617 | Bacteria | 39638 |
| 43 | Ga0068859_100027858 | 3300005617 | Bacteria | 5666 |
| 44 | Ga0068864_100095362 | 3300005618 | Bacteria | 2631 |
| 45 | Ga0068861_100000402 | 3300005719 | Bacteria | 25029 |
| 46 | Ga0068863_100003804 | 3300005841 | Bacteria | 14918 |
| 47 | Ga0068863_100013216 | 3300005841 | Bacteria | 7962 |
| 48 | Ga0068858_100004261 | 3300005842 | Bacteria | 14061 |
| 49 | Ga0068858_100010601 | 3300005842 | Bacteria | 8724 |
| 50 | Ga0068860_100001809 | 3300005843 | Bacteria | 22764 |
| 51 | Ga0081538_10003622 | 3300005981 | Bacteria | 14521 |
| 52 | Ga0081539_10000310 | 3300005985 | Bacteria | 109306 |
| 53 | Ga0081539_10000606 | 3300005985 | Bacteria | 72943 |
| 54 | Ga0081539_10009060 | 3300005985 | Bacteria | 8437 |
| 55 | Ga0097621_100007819 | 3300006237 | Bacteria | 7671 |
| 56 | Ga0068871_100074443 | 3300006358 | Bacteria | 2801 |
| 57 | Ga0068865_100000002 | 3300006881 | Bacteria | 285745 |
| 58 | Ga0097620_100000474 | 3300006931 | Bacteria | 39638 |
| 59 | Ga0097620_100027856 | 3300006931 | Bacteria | 5666 |
| 60 | Ga0105251_10052120 | 3300009011 | Bacteria | 1949 |
| 61 | Ga0105240_10013168 | 3300009093 | Bacteria | 11377 |
| 62 | Ga0105240_10108169 | 3300009093 | Bacteria | 3369 |
| 63 | Ga0105245_10271756 | 3300009098 | Bacteria | 1653 |
| 64 | Ga0105247_10011606 | 3300009101 | Bacteria | 5307 |
| 65 | Ga0105247_10031420 | 3300009101 | Bacteria | 3222 |
| 66 | Ga0105247_10206469 | 3300009101 | Bacteria | 1323 |
| 67 | Ga0114129_10097495 | 3300009147 | Bacteria | 4070 |
| 68 | Ga0105243_10000031 | 3300009148 | Bacteria | 185825 |
| 69 | Ga0105241_10127900 | 3300009174 | Bacteria | 2053 |
| 70 | Ga0105242_10000193 | 3300009176 | Bacteria | 47293 |
| 71 | Ga0105248_10000361 | 3300009177 | Bacteria | 53041 |
| 72 | Ga0105248_10005925 | 3300009177 | Bacteria | 13438 |
| 73 | Ga0105237_10000130 | 3300009545 | Bacteria | 105282 |
| 74 | Ga0105237_10156131 | 3300009545 | Bacteria | 2279 |
| 75 | Ga0105237_10239822 | 3300009545 | Bacteria | 1814 |
| 76 | Ga0105238_10118204 | 3300009551 | Bacteria | 2631 |
| 77 | Ga0105238_10144072 | 3300009551 | Bacteria | 2359 |
| 78 | Ga0105249_10034409 | 3300009553 | Bacteria | 4592 |
| 79 | Ga0105249_10044724 | 3300009553 | Bacteria | 4026 |
| 80 | Ga0105249_10213653 | 3300009553 | Bacteria | 1894 |
| 81 | Ga0105249_10292731 | 3300009553 | Bacteria | 1630 |
| 82 | Ga0105239_10000605 | 3300010375 | Bacteria | 51086 |
| 83 | Ga0105239_10050131 | 3300010375 | Bacteria | 4579 |
| 84 | Ga0105246_10006967 | 3300011119 | Bacteria | 6913 |
| 85 | Ga0157373_10010252 | 3300013100 | Bacteria | 6903 |
| 86 | Ga0157370_10148287 | 3300013104 | Bacteria | 2184 |
| 87 | Ga0157369_10166394 | 3300013105 | Bacteria | 2325 |
| 88 | Ga0157369_10261578 | 3300013105 | Bacteria | 1804 |
| 89 | Ga0157374_10030085 | 3300013296 | Bacteria | 4927 |
| 90 | Ga0157374_10159772 | 3300013296 | Bacteria | 2195 |
| 91 | Ga0157378_10048774 | 3300013297 | Bacteria | 3766 |
| 92 | Ga0163162_10054226 | 3300013306 | Bacteria | 4032 |
| 93 | Ga0163162_10168684 | 3300013306 | Bacteria | 2313 |
| 94 | Ga0157372_10004526 | 3300013307 | Bacteria | 14816 |
| 95 | Ga0157372_10103698 | 3300013307 | Bacteria | 3250 |
| 96 | Ga0157372_10106368 | 3300013307 | Bacteria | 3209 |
| 97 | Ga0157372_10120689 | 3300013307 | Bacteria | 3010 |
| 98 | Ga0157375_10000990 | 3300013308 | Bacteria | 24534 |
| 99 | Ga0163163_10048187 | 3300014325 | Bacteria | 4189 |
| 100 | Ga0182008_10000219 | 3300014497 | Bacteria | 44976 |
| 101 | Ga0157379_10015521 | 3300014968 | Bacteria | 6684 |
| 102 | Ga0157379_10020201 | 3300014968 | Bacteria | 5886 |
| 103 | Ga0157379_10126147 | 3300014968 | Bacteria | 2303 |
| 104 | Ga0157379_10140072 | 3300014968 | Bacteria | 2180 |
| 105 | Ga0157376_10000172 | 3300014969 | Bacteria | 44803 |
| 106 | Ga0163161_10007504 | 3300017792 | Bacteria | 7537 |
| 107 | Ga0163161_10074985 | 3300017792 | Bacteria | 2482 |
| 108 | Ga0209148_1000160 | 3300025254 | Bacteria | 139522 |
| 109 | Ga0209148_1000579 | 3300025254 | Bacteria | 33716 |
| 110 | Ga0209129_1001343 | 3300025258 | Bacteria | 13905 |
| 111 | Ga0209565_1000021 | 3300025263 | Bacteria | 406281 |
| 112 | Ga0209455_1002767 | 3300025272 | Bacteria | 6565 |
| 113 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 114 | Ga0209025_1000141 | 3300025294 | Bacteria | 184281 |
| 115 | Ga0209025_1002851 | 3300025294 | Bacteria | 17343 |
| 116 | Ga0209025_1008454 | 3300025294 | Bacteria | 7407 |
| 117 | Ga0209025_1037017 | 3300025294 | Bacteria | 2173 |
| 118 | Ga0209564_1000054 | 3300025295 | Bacteria | 350653 |
| 119 | Ga0209564_1000452 | 3300025295 | Bacteria | 69505 |
| 120 | Ga0209256_1000330 | 3300025299 | Bacteria | 79958 |
| 121 | Ga0209256_1000501 | 3300025299 | Bacteria | 57500 |
| 122 | Ga0209256_1003754 | 3300025299 | Bacteria | 10255 |
| 123 | Ga0207710_10001989 | 3300025900 | Bacteria | 9751 |
| 124 | Ga0207710_10021535 | 3300025900 | Bacteria | 2763 |
| 125 | Ga0207680_10053138 | 3300025903 | Bacteria | 2431 |
| 126 | Ga0207680_10149865 | 3300025903 | Bacteria | 1554 |
| 127 | Ga0207647_10000314 | 3300025904 | Bacteria | 40279 |
| 128 | Ga0207645_10000940 | 3300025907 | Bacteria | 24200 |
| 129 | Ga0207705_10000078 | 3300025909 | Bacteria | 120247 |
| 130 | Ga0207705_10000354 | 3300025909 | Bacteria | 41477 |
| 131 | Ga0207705_10005730 | 3300025909 | Bacteria | 9277 |
| 132 | Ga0207695_10013634 | 3300025913 | Bacteria | 9679 |
| 133 | Ga0207695_10027428 | 3300025913 | Bacteria | 6343 |
| 134 | Ga0207695_10031626 | 3300025913 | Bacteria | 5801 |
| 135 | Ga0207671_10001177 | 3300025914 | Bacteria | 31119 |
| 136 | Ga0207671_10020229 | 3300025914 | Bacteria | 5070 |
| 137 | Ga0207671_10087798 | 3300025914 | Bacteria | 2339 |
| 138 | Ga0207671_10113037 | 3300025914 | Bacteria | 2068 |
| 139 | Ga0207657_10002458 | 3300025919 | Bacteria | 20026 |
| 140 | Ga0207657_10003588 | 3300025919 | Bacteria | 16563 |
| 141 | Ga0207646_10186875 | 3300025922 | Bacteria | 1871 |
| 142 | Ga0207681_10162242 | 3300025923 | Bacteria | 1686 |
| 143 | Ga0207694_10027265 | 3300025924 | Bacteria | 4350 |
| 144 | Ga0207694_10078694 | 3300025924 | Bacteria | 2585 |
| 145 | Ga0207659_10026637 | 3300025926 | Bacteria | 3903 |
| 146 | Ga0207644_10015655 | 3300025931 | Bacteria | 5095 |
| 147 | Ga0207644_10195059 | 3300025931 | Bacteria | 1594 |
| 148 | Ga0207690_10058517 | 3300025932 | Bacteria | 2607 |
| 149 | Ga0207706_10009378 | 3300025933 | Bacteria | 8985 |
| 150 | Ga0207706_10028241 | 3300025933 | Bacteria | 5011 |
| 151 | Ga0207686_10000821 | 3300025934 | Bacteria | 18958 |
| 152 | Ga0207709_10000237 | 3300025935 | Bacteria | 69190 |
| 153 | Ga0207704_10000003 | 3300025938 | Bacteria | 285808 |
| 154 | Ga0207691_10062443 | 3300025940 | Bacteria | 3380 |
| 155 | Ga0207691_10146941 | 3300025940 | Bacteria | 2075 |
| 156 | Ga0207711_10000649 | 3300025941 | Bacteria | 34680 |
| 157 | Ga0207661_10176348 | 3300025944 | Bacteria | 1864 |
| 158 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 159 | Ga0207667_10007580 | 3300025949 | Bacteria | 13018 |
| 160 | Ga0207667_10063192 | 3300025949 | Bacteria | 3868 |
| 161 | Ga0207651_10000003 | 3300025960 | Bacteria | 308050 |
| 162 | Ga0207712_10055586 | 3300025961 | Bacteria | 2785 |
| 163 | Ga0207712_10162508 | 3300025961 | Bacteria | 1737 |
| 164 | Ga0207712_10242107 | 3300025961 | Bacteria | 1453 |
| 165 | Ga0207640_10000263 | 3300025981 | Bacteria | 35443 |
| 166 | Ga0207640_10039331 | 3300025981 | Bacteria | 2993 |
| 167 | Ga0207658_10008131 | 3300025986 | Bacteria | 7144 |
| 168 | Ga0207658_10034694 | 3300025986 | Bacteria | 3607 |
| 169 | Ga0207677_10000628 | 3300026023 | Bacteria | 21418 |
| 170 | Ga0207703_10001419 | 3300026035 | Bacteria | 21845 |
| 171 | Ga0207703_10002123 | 3300026035 | Bacteria | 17434 |
| 172 | Ga0207639_10012254 | 3300026041 | Bacteria | 5969 |
| 173 | Ga0207639_10015159 | 3300026041 | Bacteria | 5431 |
| 174 | Ga0207639_10095073 | 3300026041 | Bacteria | 2394 |
| 175 | Ga0207678_10020521 | 3300026067 | Bacteria | 5792 |
| 176 | Ga0207678_10122875 | 3300026067 | Bacteria | 2215 |
| 177 | Ga0207708_10282300 | 3300026075 | Bacteria | 1346 |
| 178 | Ga0207702_10048181 | 3300026078 | Bacteria | 3593 |
| 179 | Ga0207641_10000650 | 3300026088 | Bacteria | 37805 |
| 180 | Ga0207641_10141594 | 3300026088 | Bacteria | 2170 |
| 181 | Ga0207648_10000007 | 3300026089 | Bacteria | 217865 |
| 182 | Ga0207676_10141860 | 3300026095 | Bacteria | 2058 |
| 183 | Ga0207676_10178286 | 3300026095 | Bacteria | 1858 |
| 184 | Ga0207676_10299461 | 3300026095 | Bacteria | 1468 |
| 185 | Ga0207674_10026672 | 3300026116 | Bacteria | 6129 |
| 186 | Ga0207675_100000285 | 3300026118 | Bacteria | 48665 |
| 187 | Ga0207675_100230678 | 3300026118 | Bacteria | 1786 |
| 188 | Ga0207698_10013684 | 3300026142 | Bacteria | 5362 |
| 189 | Ga0268266_10003131 | 3300028379 | Bacteria | 16826 |
| 190 | Ga0268265_10166845 | 3300028380 | Bacteria | 1877 |
| 191 | Ga0268264_10000188 | 3300028381 | Bacteria | 129042 |
| 192 | Ga0268264_10071105 | 3300028381 | Bacteria | 2947 |
| 193 | Ga0265334_10023511 | 3300028573 | Bacteria | 2505 |
| 194 | Ga0265318_10014941 | 3300028577 | Bacteria | 3246 |
| 195 | Ga0307515_10000208 | 3300028794 | Bacteria | 144484 |
| 196 | Ga0307515_10059020 | 3300028794 | Bacteria | 5509 |
| 197 | Ga0307512_10010122 | 3300030522 | Bacteria | 9020 |
| 198 | Ga0316182_1040504 | 3300030745 | Bacteria | 9069 |
| 199 | Ga0265331_10004682 | 3300031250 | Bacteria | 8470 |
| 200 | Ga0307513_10050556 | 3300031456 | Bacteria | 4492 |
| 201 | Ga0307513_10099079 | 3300031456 | Bacteria | 2944 |
| 202 | Ga0307513_10130827 | 3300031456 | Bacteria | 2456 |
| 203 | Ga0307408_100285236 | 3300031548 | Bacteria | 1377 |
| 204 | Ga0307508_10000251 | 3300031616 | Bacteria | 65275 |
| 205 | Ga0307410_10072225 | 3300031852 | Bacteria | 2396 |
| 206 | Ga0307406_10053599 | 3300031901 | Bacteria | 2570 |
| 207 | Ga0307412_10137175 | 3300031911 | Bacteria | 1786 |
| 208 | Ga0307412_10193272 | 3300031911 | Bacteria | 1540 |
| 209 | Ga0307414_10001453 | 3300032004 | Bacteria | 12302 |
| 210 | Ga0307414_10006866 | 3300032004 | Bacteria | 6369 |
| 211 | Ga0307411_10127466 | 3300032005 | Bacteria | 1854 |
| 212 | Ga0307411_10136331 | 3300032005 | Bacteria | 1803 |
| 213 | Ga0307415_100235108 | 3300032126 | Bacteria | 1478 |
| 214 | Ga0395900_0114031 | 3300037418 | Bacteria | 2774 |
| 215 | Ga0395905_0003260 | 3300037471 | Bacteria | 17452 |
| 216 | Ga0395905_0026644 | 3300037471 | Bacteria | 5450 |
| 217 | Ga0395905_0054790 | 3300037471 | Bacteria | 3732 |
| 218 | Ga0395901_0023083 | 3300038443 | Bacteria | 6376 |
| 219 | Ga0395901_0114610 | 3300038443 | Bacteria | 2831 |
| 220 | Ga0395901_0254294 | 3300038443 | Bacteria | 1830 |
| 221 | Ga0439448_0002098 | 3300042005 | Bacteria | 5355 |
| 222 | Ga0439458_0001788 | 3300042157 | Bacteria | 5351 |
| 223 | Ga0439464_0009845 | 3300042439 | Bacteria | 2519 |
| 224 | Ga0466965_0016816 | 3300044683 | Bacteria | 3488 |
| 225 | Ga0466961_0010796 | 3300044693 | Bacteria | 5834 |
| 226 | Ga0466963_0001878 | 3300044694 | Bacteria | 11460 |
| 227 | Ga0466964_0000784 | 3300044706 | Bacteria | 10345 |
| 228 | Ga0466971_0010331 | 3300044719 | Bacteria | 4078 |
| 229 | Ga0466968_0031011 | 3300044735 | Bacteria | 2217 |
| 230 | Ga0466957_0015835 | 3300044842 | Bacteria | 4406 |
| 231 | Ga0466959_0100460 | 3300045049 | Unclassified | 2071 |
| 232 | Ga0466958_0004157 | 3300045836 | Bacteria | 7604 |
| 233 | Ga0466967_0002434 | 3300045976 | Bacteria | 11583 |
| 234 | Ga0466967_0202844 | 3300045976 | Bacteria | 1879 |
| 235 | Ga0495638_0000253 | 3300046460 | Bacteria | 72446 |
| 236 | Ga0495610_0002065 | 3300046512 | Bacteria | 17145 |
| 237 | Ga0495616_0002734 | 3300046513 | Bacteria | 11547 |
| 238 | Ga0495620_0014120 | 3300046515 | Bacteria | 4069 |
| 239 | Ga0495620_0091423 | 3300046515 | Bacteria | 1221 |
| 240 | Ga0495631_0000042 | 3300046518 | Bacteria | 78766 |
| 241 | Ga0495637_0007319 | 3300046520 | Bacteria | 5483 |
| 242 | Ga0495621_0003790 | 3300046539 | Bacteria | 4193 |
| 243 | Ga0495597_0076904 | 3300046542 | Bacteria | 1431 |
| 244 | Ga0495625_0000031 | 3300046660 | Bacteria | 238193 |
| 245 | Ga0495625_0012889 | 3300046660 | Bacteria | 6755 |
| 246 | Ga0495670_0024644 | 3300046691 | Bacteria | 2974 |
| 247 | Ga0495670_0049727 | 3300046691 | Bacteria | 2098 |
| 248 | Ga0495686_0002011 | 3300047472 | Bacteria | 20108 |
| 249 | Ga0495686_0002084 | 3300047472 | Bacteria | 19662 |
| 250 | Ga0496112_0027529 | 3300048915 | Bacteria | 5481 |
| 251 | Ga0496113_0204081 | 3300048916 | Bacteria | 1572 |
| 252 | Ga0496117_0000035 | 3300048920 | Bacteria | 326449 |
| 253 | Ga0496117_0027593 | 3300048920 | Bacteria | 4418 |
| 254 | Ga0496118_0000054 | 3300048921 | Bacteria | 233617 |
| 255 | Ga0496118_0065230 | 3300048921 | Bacteria | 2665 |
| 256 | Ga0496119_0000260 | 3300048922 | Bacteria | 74908 |
| 257 | Ga0496119_0004560 | 3300048922 | Bacteria | 13709 |
| 258 | Ga0496119_0017040 | 3300048922 | Bacteria | 5492 |
| 259 | Ga0496120_0000061 | 3300048923 | Bacteria | 172817 |
| 260 | Ga0496121_0000114 | 3300048924 | Bacteria | 179427 |
| 261 | Ga0496121_0002192 | 3300048924 | Bacteria | 30563 |
| 262 | Ga0496121_0052306 | 3300048924 | Bacteria | 3432 |
| 263 | Ga0496121_0114911 | 3300048924 | Bacteria | 2045 |
| 264 | Ga0496122_0000531 | 3300048925 | Bacteria | 79144 |
| 265 | Ga0496122_0001585 | 3300048925 | Bacteria | 35726 |
| 266 | Ga0496122_0058812 | 3300048925 | Bacteria | 2842 |
| 267 | Ga0496123_0010976 | 3300048926 | Bacteria | 7922 |
| 268 | Ga0496124_0005523 | 3300048927 | Bacteria | 14188 |
| 269 | Ga0496125_0001169 | 3300048928 | Bacteria | 39735 |
| 270 | Ga0496125_0003275 | 3300048928 | Bacteria | 19914 |
| 271 | Ga0496125_0007617 | 3300048928 | Bacteria | 11491 |
| 272 | Ga0496125_0020333 | 3300048928 | Bacteria | 6231 |
| 273 | Ga0496125_0106181 | 3300048928 | Bacteria | 2050 |
| 274 | Ga0496126_0096214 | 3300048929 | Bacteria | 2596 |
| 275 | Ga0501034_0000182 | 3300049571 | Bacteria | 117605 |
| 276 | Ga0501034_0042861 | 3300049571 | Bacteria | 4581 |
| 277 | Ga0501034_0051000 | 3300049571 | Bacteria | 4173 |
| 278 | Ga0501034_0291441 | 3300049571 | Bacteria | 1570 |
| 279 | Ga0501034_0367991 | 3300049571 | Bacteria | 1364 |
| 280 | Ga0501036_0095467 | 3300049572 | Bacteria | 2513 |
| 281 | Ga0501037_0046968 | 3300049573 | Bacteria | 3165 |
| 282 | Ga0501040_0065584 | 3300049576 | Bacteria | 2501 |
| 283 | Ga0501042_0153344 | 3300049578 | Bacteria | 1661 |
| 284 | Ga0501043_0137094 | 3300049579 | Bacteria | 1917 |
| 285 | Ga0501046_0219354 | 3300049580 | Bacteria | 1409 |
| 286 | Ga0501073_0046377 | 3300049589 | Bacteria | 3057 |
| 287 | Ga0501074_0077546 | 3300049590 | Bacteria | 2385 |
| 288 | Ga0501074_0088088 | 3300049590 | Bacteria | 2223 |
| 289 | Ga0501075_0024361 | 3300049591 | Bacteria | 4437 |
| 290 | Ga0501081_0081018 | 3300049743 | Bacteria | 2273 |
| 291 | nmdc:mga00v17_29975_c1 | 3300050491 | Bacteria | 3196 |
| 292 | nmdc:mga05p37_132839_c1 | 3300050507 | Bacteria | 3053 |
| 293 | Ga0500610_0000161 | 3300053079 | Bacteria | 19927 |
| 294 | Ga0500646_0014559 | 3300053090 | Bacteria | 2042 |
| 295 | Ga0500583_0000478 | 3300053092 | Bacteria | 12431 |
| 296 | Ga0500583_0000701 | 3300053092 | Bacteria | 9778 |
| 297 | Ga0500641_0011430 | 3300053096 | Bacteria | 3222 |
| 298 | Ga0500555_000086 | 3300053103 | Bacteria | 44938 |
| 299 | Ga0500562_000459 | 3300053108 | Bacteria | 9883 |
| 300 | Ga0500562_006861 | 3300053108 | Bacteria | 2873 |
| 301 | Ga0500592_001495 | 3300053116 | Bacteria | 3788 |
| 302 | Ga0500607_020093 | 3300053121 | Bacteria | 3774 |
| 303 | Ga0500658_0001311 | 3300053134 | Bacteria | 10071 |
| 304 | Ga0500568_0007511 | 3300053139 | Bacteria | 5341 |
| 305 | Ga0500616_0005654 | 3300053153 | Bacteria | 8433 |
| 306 | Ga0500622_0000698 | 3300053156 | Bacteria | 29555 |
| 307 | Ga0500622_0001442 | 3300053156 | Bacteria | 19051 |
| 308 | Ga0466962_0009209 | 3300061719 | Bacteria | 4731 |
| 309 | Ga0530510_0024405 | 3300061734 | Bacteria | 4313 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049571 | Ga0501034_0291441 | Ga0501034_0291441_511_1548 | 324 |
| 2 | 3300031852 | Ga0307410_10072225 | Ga0307410_100722252 | 360 |
| 3 | 3300049576 | Ga0501040_0065584 | Ga0501040_0065584_102_1301 | 363 |
| 4 | 3300049578 | Ga0501042_0153344 | Ga0501042_0153344_149_1348 | 363 |
| 5 | 3300049591 | Ga0501075_0024361 | Ga0501075_0024361_2001_3200 | 363 |
| 6 | 3300049743 | Ga0501081_0081018 | Ga0501081_0081018_735_1934 | 363 |
| 7 | 3300061734 | Ga0530510_0024405 | Ga0530510_0024405_3002_4201 | 363 |
| 8 | 3300005468 | Ga0070707_100263084 | Ga0070707_1002630841 | 365 |
| 9 | 3300025922 | Ga0207646_10186875 | Ga0207646_101868751 | 365 |
| 10 | 3300031548 | Ga0307408_100285236 | Ga0307408_1002852362 | 365 |
| 11 | 3300005438 | Ga0070701_10011535 | Ga0070701_100115354 | 369 |
| 12 | 3300005444 | Ga0070694_100133407 | Ga0070694_1001334071 | 369 |
| 13 | 3300005545 | Ga0070695_100138345 | Ga0070695_1001383452 | 369 |
| 14 | 3300005617 | Ga0068859_100027858 | Ga0068859_1000278584 | 369 |
| 15 | 3300006931 | Ga0097620_100027856 | Ga0097620_1000278564 | 369 |
| 16 | 3300009553 | Ga0105249_10213653 | Ga0105249_102136532 | 369 |
| 17 | 3300014968 | Ga0157379_10126147 | Ga0157379_101261471 | 369 |
| 18 | 3300026095 | Ga0207676_10141860 | Ga0207676_101418601 | 369 |
| 19 | 3300028381 | Ga0268264_10071105 | Ga0268264_100711052 | 369 |
| 20 | 3300032005 | Ga0307411_10136331 | Ga0307411_101363312 | 373 |
| 21 | 3300009098 | Ga0105245_10271756 | Ga0105245_102717562 | 374 |
| 22 | 3300025940 | Ga0207691_10062443 | Ga0207691_100624433 | 374 |
| 23 | 3300025944 | Ga0207661_10176348 | Ga0207661_101763482 | 374 |
| 24 | 3300026118 | Ga0207675_100230678 | Ga0207675_1002306782 | 374 |
| 25 | 3300042439 | Ga0439464_0009845 | Ga0439464_0009845_1320_2471 | 374 |
| 26 | 3300049580 | Ga0501046_0219354 | Ga0501046_0219354_211_1335 | 374 |
| 27 | 3300049590 | Ga0501074_0088088 | Ga0501074_0088088_29_1198 | 377 |
| 28 | 3300046515 | Ga0495620_0091423 | Ga0495620_0091423_41_1195 | 379 |
| 29 | 3300009101 | Ga0105247_10206469 | Ga0105247_102064691 | 381 |
| 30 | 3300026075 | Ga0207708_10282300 | Ga0207708_102823002 | 381 |
| 31 | 3300028380 | Ga0268265_10166845 | Ga0268265_101668452 | 381 |
| 32 | iso_pu_bacteria | 2791354901 | 2791915625 | 383 |
| 33 | iso_pu_bacteria | 2866612099 | 2866617890 | 383 |
| 34 | iso_pu_bacteria | 2899359706 | 2899364374 | 383 |
| 35 | 3300048924 | Ga0496121_0052306 | Ga0496121_0052306_1186_2364 | 384 |
| 36 | iso_pu_bacteria | 2508501114 | 2509078487 | 384 |
| 37 | iso_pu_bacteria | 8054563764 | 8054566780 | 384 |
| 38 | 3300005985 | Ga0081539_10000606 | Ga0081539_1000060623 | 385 |
| 39 | 3300005985 | Ga0081539_10009060 | Ga0081539_100090608 | 385 |
| 40 | 3300031911 | Ga0307412_10137175 | Ga0307412_101371752 | 385 |
| 41 | 3300032126 | Ga0307415_100235108 | Ga0307415_1002351081 | 385 |
| 42 | 3300005981 | Ga0081538_10003622 | Ga0081538_100036226 | 386 |
| 43 | 3300047472 | Ga0495686_0002084 | Ga0495686_0002084_11386_12549 | 386 |
| 44 | 3300003203 | JGI25406J46586_10001541 | JGI25406J46586_100015419 | 387 |
| 45 | 3300005985 | Ga0081539_10000310 | Ga0081539_1000031065 | 387 |
| 46 | 3300009093 | Ga0105240_10108169 | Ga0105240_101081692 | 387 |
| 47 | 3300009147 | Ga0114129_10097495 | Ga0114129_100974952 | 387 |
| 48 | 3300013104 | Ga0157370_10148287 | Ga0157370_101482872 | 387 |
| 49 | 3300013105 | Ga0157369_10261578 | Ga0157369_102615782 | 387 |
| 50 | 3300025258 | Ga0209129_1001343 | Ga0209129_100134313 | 387 |
| 51 | 3300030522 | Ga0307512_10010122 | Ga0307512_100101224 | 387 |
| 52 | 3300045976 | Ga0466967_0202844 | Ga0466967_0202844_191_1423 | 387 |
| 53 | 3300050507 | nmdc:mga05p37_132839_c1 | nmdc:mga05p37_132839_c1_1627_2820 | 387 |
| 54 | 3300053092 | Ga0500583_0000701 | Ga0500583_0000701_6076_7245 | 387 |
| 55 | 3300005355 | Ga0070671_100016127 | Ga0070671_1000161275 | 388 |
| 56 | 3300005367 | Ga0070667_100010667 | Ga0070667_1000106673 | 388 |
| 57 | 3300005548 | Ga0070665_100014961 | Ga0070665_1000149617 | 388 |
| 58 | 3300005548 | Ga0070665_100198611 | Ga0070665_1001986112 | 388 |
| 59 | 3300005841 | Ga0068863_100013216 | Ga0068863_1000132166 | 388 |
| 60 | 3300005842 | Ga0068858_100010601 | Ga0068858_1000106014 | 388 |
| 61 | 3300009101 | Ga0105247_10011606 | Ga0105247_100116062 | 388 |
| 62 | 3300009553 | Ga0105249_10044724 | Ga0105249_100447244 | 388 |
| 63 | 3300013306 | Ga0163162_10054226 | Ga0163162_100542264 | 388 |
| 64 | 3300014325 | Ga0163163_10048187 | Ga0163163_100481873 | 388 |
| 65 | 3300014968 | Ga0157379_10015521 | Ga0157379_100155213 | 388 |
| 66 | 3300025900 | Ga0207710_10001989 | Ga0207710_100019895 | 388 |
| 67 | 3300025903 | Ga0207680_10053138 | Ga0207680_100531382 | 388 |
| 68 | 3300025914 | Ga0207671_10087798 | Ga0207671_100877982 | 388 |
| 69 | 3300025931 | Ga0207644_10195059 | Ga0207644_101950591 | 388 |
| 70 | 3300025986 | Ga0207658_10008131 | Ga0207658_100081315 | 388 |
| 71 | 3300026035 | Ga0207703_10001419 | Ga0207703_100014194 | 388 |
| 72 | 3300026088 | Ga0207641_10141594 | Ga0207641_101415942 | 388 |
| 73 | 3300028379 | Ga0268266_10003131 | Ga0268266_100031317 | 388 |
| 74 | 3300028794 | Ga0307515_10059020 | Ga0307515_100590202 | 388 |
| 75 | 3300037471 | Ga0395905_0026644 | Ga0395905_0026644_2128_3327 | 388 |
| 76 | 3300046691 | Ga0495670_0049727 | Ga0495670_0049727_353_1552 | 388 |
| 77 | 3300048915 | Ga0496112_0027529 | Ga0496112_0027529_819_2003 | 388 |
| 78 | 3300048924 | Ga0496121_0002192 | Ga0496121_0002192_17222_18406 | 388 |
| 79 | 3300048928 | Ga0496125_0007617 | Ga0496125_0007617_4791_5975 | 388 |
| 80 | iso_pu_bacteria | 2939631187 | 2939632040 | 388 |
| 81 | iso_pu_bacteria | 644736347 | 644747960 | 388 |
| 82 | 3300003187 | JGI25151J46595_10003813 | JGI25151J46595_100038134 | 389 |
| 83 | 3300003771 | Ga0055526_1021360 | Ga0055526_10213602 | 389 |
| 84 | 3300003773 | Ga0055537_1004061 | Ga0055537_10040613 | 389 |
| 85 | 3300003775 | Ga0055524_1001068 | Ga0055524_10010684 | 389 |
| 86 | 3300025263 | Ga0209565_1000021 | Ga0209565_1000021105 | 389 |
| 87 | 3300025294 | Ga0209025_1002851 | Ga0209025_100285115 | 389 |
| 88 | 3300025294 | Ga0209025_1008454 | Ga0209025_10084546 | 389 |
| 89 | 3300025295 | Ga0209564_1000452 | Ga0209564_100045223 | 389 |
| 90 | 3300025299 | Ga0209256_1000501 | Ga0209256_10005019 | 389 |
| 91 | 3300025299 | Ga0209256_1003754 | Ga0209256_10037545 | 389 |
| 92 | 3300030745 | Ga0316182_1040504 | Ga0316182_10405042 | 389 |
| 93 | 3300031911 | Ga0307412_10193272 | Ga0307412_101932721 | 389 |
| 94 | 3300032004 | Ga0307414_10001453 | Ga0307414_100014536 | 389 |
| 95 | 3300032005 | Ga0307411_10127466 | Ga0307411_101274662 | 389 |
| 96 | 3300038443 | Ga0395901_0114610 | Ga0395901_0114610_832_2127 | 389 |
| 97 | 3300038443 | Ga0395901_0254294 | Ga0395901_0254294_177_1436 | 389 |
| 98 | 3300049571 | Ga0501034_0000182 | Ga0501034_0000182_79805_81178 | 389 |
| 99 | 3300049571 | Ga0501034_0042861 | Ga0501034_0042861_1085_2341 | 389 |
| 100 | 3300049571 | Ga0501034_0367991 | Ga0501034_0367991_96_1340 | 389 |
| 101 | 3300049572 | Ga0501036_0095467 | Ga0501036_0095467_993_2255 | 389 |
| 102 | 3300049579 | Ga0501043_0137094 | Ga0501043_0137094_81_1343 | 389 |
| 103 | 3300049589 | Ga0501073_0046377 | Ga0501073_0046377_786_2048 | 389 |
| 104 | 3300049590 | Ga0501074_0077546 | Ga0501074_0077546_388_1650 | 389 |
| 105 | 3300053103 | Ga0500555_000086 | Ga0500555_000086_21693_22865 | 389 |
| 106 | 3300053121 | Ga0500607_020093 | Ga0500607_020093_866_2089 | 389 |
| 107 | iso_pu_bacteria | 2881412998 | 2881413218 | 389 |
| 108 | iso_pu_bacteria | 2904541872 | 2904548686 | 389 |
| 109 | iso_pu_bacteria | 2929160207 | 2929164648 | 389 |
| 110 | iso_pu_bacteria | 2954767861 | 2954771397 | 389 |
| 111 | 3300047472 | Ga0495686_0002011 | Ga0495686_0002011_8055_9233 | 390 |
| 112 | 3300048916 | Ga0496113_0204081 | Ga0496113_0204081_227_1405 | 390 |
| 113 | 3300048922 | Ga0496119_0017040 | Ga0496119_0017040_340_1518 | 390 |
| 114 | iso_pu_bacteria | 2513237150 | 2513955235 | 390 |
| 115 | iso_pu_bacteria | 2643221733 | 2644728564 | 390 |
| 116 | iso_pu_bacteria | 2842733646 | 2842737487 | 390 |
| 117 | iso_pu_bacteria | 2855730933 | 2855736113 | 390 |
| 118 | iso_pu_bacteria | 2855767633 | 2855773050 | 390 |
| 119 | iso_pu_bacteria | 2904541872 | 2904545650 | 390 |
| 120 | iso_pu_bacteria | 2929160207 | 2929168293 | 390 |
| 121 | iso_pu_bacteria | 8045864390 | 8045866859 | 390 |
| 122 | 3300037418 | Ga0395900_0114031 | Ga0395900_0114031_1451_2704 | 391 |
| 123 | 3300037471 | Ga0395905_0003260 | Ga0395905_0003260_4506_5759 | 391 |
| 124 | 3300038443 | Ga0395901_0023083 | Ga0395901_0023083_4203_5456 | 391 |
| 125 | iso_pu_bacteria | 2775507255 | 2778126940 | 391 |
| 126 | iso_pu_bacteria | 8057101203 | 8057102677 | 391 |
| 127 | 3300005327 | Ga0070658_10000106 | Ga0070658_1000010652 | 392 |
| 128 | 3300005339 | Ga0070660_100005028 | Ga0070660_1000050284 | 392 |
| 129 | 3300025909 | Ga0207705_10000078 | Ga0207705_1000007880 | 392 |
| 130 | 3300025919 | Ga0207657_10003588 | Ga0207657_1000358811 | 392 |
| 131 | 3300042005 | Ga0439448_0002098 | Ga0439448_0002098_687_1868 | 392 |
| 132 | 3300042157 | Ga0439458_0001788 | Ga0439458_0001788_1679_2860 | 392 |
| 133 | 3300053096 | Ga0500641_0011430 | Ga0500641_0011430_1752_2933 | 392 |
| 134 | 3300013105 | Ga0157369_10166394 | Ga0157369_101663942 | 393 |
| 135 | 3300025932 | Ga0207690_10058517 | Ga0207690_100585172 | 393 |
| 136 | 3300025933 | Ga0207706_10028241 | Ga0207706_100282412 | 393 |
| 137 | 3300028794 | Ga0307515_10000208 | Ga0307515_1000020884 | 393 |
| 138 | 3300050491 | nmdc:mga00v17_29975_c1 | nmdc:mga00v17_29975_c1_1445_2662 | 393 |
| 139 | 3300003187 | JGI25151J46595_10001280 | JGI25151J46595_100012804 | 394 |
| 140 | 3300003187 | JGI25151J46595_10006982 | JGI25151J46595_100069824 | 394 |
| 141 | 3300003771 | Ga0055526_1000318 | Ga0055526_100031822 | 394 |
| 142 | 3300014497 | Ga0182008_10000219 | Ga0182008_1000021931 | 394 |
| 143 | 3300017792 | Ga0163161_10007504 | Ga0163161_100075043 | 394 |
| 144 | 3300025294 | Ga0209025_1000029 | Ga0209025_100002977 | 394 |
| 145 | 3300025294 | Ga0209025_1000141 | Ga0209025_1000141145 | 394 |
| 146 | 3300025294 | Ga0209025_1037017 | Ga0209025_10370171 | 394 |
| 147 | 3300025295 | Ga0209564_1000054 | Ga0209564_100005466 | 394 |
| 148 | 3300025299 | Ga0209256_1000330 | Ga0209256_100033025 | 394 |
| 149 | 3300025923 | Ga0207681_10162242 | Ga0207681_101622422 | 394 |
| 150 | 3300025961 | Ga0207712_10162508 | Ga0207712_101625082 | 394 |
| 151 | 3300031456 | Ga0307513_10050556 | Ga0307513_100505562 | 394 |
| 152 | 3300031456 | Ga0307513_10099079 | Ga0307513_100990792 | 394 |
| 153 | 3300031456 | Ga0307513_10130827 | Ga0307513_101308271 | 394 |
| 154 | 3300031616 | Ga0307508_10000251 | Ga0307508_1000025116 | 394 |
| 155 | 3300031901 | Ga0307406_10053599 | Ga0307406_100535992 | 394 |
| 156 | 3300032004 | Ga0307414_10006866 | Ga0307414_100068663 | 394 |
| 157 | 3300046512 | Ga0495610_0002065 | Ga0495610_0002065_44_1267 | 394 |
| 158 | 3300046513 | Ga0495616_0002734 | Ga0495616_0002734_1313_2536 | 394 |
| 159 | 3300046515 | Ga0495620_0014120 | Ga0495620_0014120_1776_2999 | 394 |
| 160 | 3300046518 | Ga0495631_0000042 | Ga0495631_0000042_43868_45091 | 394 |
| 161 | 3300046520 | Ga0495637_0007319 | Ga0495637_0007319_1681_2904 | 394 |
| 162 | 3300046539 | Ga0495621_0003790 | Ga0495621_0003790_1228_2451 | 394 |
| 163 | 3300046660 | Ga0495625_0012889 | Ga0495625_0012889_1065_2288 | 394 |
| 164 | 3300046691 | Ga0495670_0024644 | Ga0495670_0024644_1116_2339 | 394 |
| 165 | 3300048924 | Ga0496121_0000114 | Ga0496121_0000114_90988_92181 | 394 |
| 166 | 3300048925 | Ga0496122_0000531 | Ga0496122_0000531_48918_50141 | 394 |
| 167 | 3300048928 | Ga0496125_0020333 | Ga0496125_0020333_1453_2640 | 394 |
| 168 | 3300049571 | Ga0501034_0051000 | Ga0501034_0051000_1338_2528 | 394 |
| 169 | 3300049573 | Ga0501037_0046968 | Ga0501037_0046968_67_1257 | 394 |
| 170 | 3300053079 | Ga0500610_0000161 | Ga0500610_0000161_15242_16465 | 394 |
| 171 | 3300053090 | Ga0500646_0014559 | Ga0500646_0014559_84_1307 | 394 |
| 172 | 3300053108 | Ga0500562_000459 | Ga0500562_000459_5966_7201 | 394 |
| 173 | 3300053108 | Ga0500562_006861 | Ga0500562_006861_47_1270 | 394 |
| 174 | 3300053116 | Ga0500592_001495 | Ga0500592_001495_1728_2951 | 394 |
| 175 | 3300001904 | JGI24736J21556_1005614 | JGI24736J21556_10056142 | 395 |
| 176 | 3300001989 | JGI24739J22299_10000316 | JGI24739J22299_1000031616 | 395 |
| 177 | 3300001990 | JGI24737J22298_10004420 | JGI24737J22298_100044204 | 395 |
| 178 | 3300001991 | JGI24743J22301_10007606 | JGI24743J22301_100076062 | 395 |
| 179 | 3300002067 | JGI24735J21928_10007359 | JGI24735J21928_100073594 | 395 |
| 180 | 3300002067 | JGI24735J21928_10013052 | JGI24735J21928_100130522 | 395 |
| 181 | 3300002067 | JGI24735J21928_10016623 | JGI24735J21928_100166232 | 395 |
| 182 | 3300002067 | JGI24735J21928_10017105 | JGI24735J21928_100171052 | 395 |
| 183 | 3300005327 | Ga0070658_10007041 | Ga0070658_100070415 | 395 |
| 184 | 3300005335 | Ga0070666_10226131 | Ga0070666_102261311 | 395 |
| 185 | 3300005354 | Ga0070675_100006461 | Ga0070675_1000064616 | 395 |
| 186 | 3300005364 | Ga0070673_100000008 | Ga0070673_10000000888 | 395 |
| 187 | 3300005366 | Ga0070659_100127205 | Ga0070659_1001272052 | 395 |
| 188 | 3300005455 | Ga0070663_100010470 | Ga0070663_1000104704 | 395 |
| 189 | 3300005457 | Ga0070662_100056688 | Ga0070662_1000566882 | 395 |
| 190 | 3300005459 | Ga0068867_100000003 | Ga0068867_10000000365 | 395 |
| 191 | 3300005539 | Ga0068853_100011610 | Ga0068853_1000116107 | 395 |
| 192 | 3300005543 | Ga0070672_100211813 | Ga0070672_1002118131 | 395 |
| 193 | 3300005563 | Ga0068855_100000183 | Ga0068855_10000018326 | 395 |
| 194 | 3300005563 | Ga0068855_100084440 | Ga0068855_1000844402 | 395 |
| 195 | 3300005578 | Ga0068854_100000151 | Ga0068854_10000015114 | 395 |
| 196 | 3300005614 | Ga0068856_100044040 | Ga0068856_1000440402 | 395 |
| 197 | 3300005616 | Ga0068852_100000537 | Ga0068852_10000053716 | 395 |
| 198 | 3300005617 | Ga0068859_100000474 | Ga0068859_10000047413 | 395 |
| 199 | 3300005618 | Ga0068864_100095362 | Ga0068864_1000953622 | 395 |
| 200 | 3300005719 | Ga0068861_100000402 | Ga0068861_10000040216 | 395 |
| 201 | 3300005841 | Ga0068863_100003804 | Ga0068863_1000038042 | 395 |
| 202 | 3300005842 | Ga0068858_100004261 | Ga0068858_1000042616 | 395 |
| 203 | 3300005843 | Ga0068860_100001809 | Ga0068860_1000018099 | 395 |
| 204 | 3300006237 | Ga0097621_100007819 | Ga0097621_1000078192 | 395 |
| 205 | 3300006358 | Ga0068871_100074443 | Ga0068871_1000744432 | 395 |
| 206 | 3300006881 | Ga0068865_100000002 | Ga0068865_100000002194 | 395 |
| 207 | 3300006931 | Ga0097620_100000474 | Ga0097620_10000047413 | 395 |
| 208 | 3300009011 | Ga0105251_10052120 | Ga0105251_100521202 | 395 |
| 209 | 3300009093 | Ga0105240_10013168 | Ga0105240_100131682 | 395 |
| 210 | 3300009101 | Ga0105247_10031420 | Ga0105247_100314203 | 395 |
| 211 | 3300009148 | Ga0105243_10000031 | Ga0105243_1000003164 | 395 |
| 212 | 3300009174 | Ga0105241_10127900 | Ga0105241_101279002 | 395 |
| 213 | 3300009176 | Ga0105242_10000193 | Ga0105242_100001934 | 395 |
| 214 | 3300009177 | Ga0105248_10000361 | Ga0105248_1000036118 | 395 |
| 215 | 3300009177 | Ga0105248_10005925 | Ga0105248_100059259 | 395 |
| 216 | 3300009545 | Ga0105237_10000130 | Ga0105237_1000013060 | 395 |
| 217 | 3300009545 | Ga0105237_10156131 | Ga0105237_101561312 | 395 |
| 218 | 3300009545 | Ga0105237_10239822 | Ga0105237_102398222 | 395 |
| 219 | 3300009551 | Ga0105238_10118204 | Ga0105238_101182042 | 395 |
| 220 | 3300009551 | Ga0105238_10144072 | Ga0105238_101440722 | 395 |
| 221 | 3300009553 | Ga0105249_10034409 | Ga0105249_100344092 | 395 |
| 222 | 3300009553 | Ga0105249_10292731 | Ga0105249_102927312 | 395 |
| 223 | 3300010375 | Ga0105239_10000605 | Ga0105239_1000060531 | 395 |
| 224 | 3300010375 | Ga0105239_10050131 | Ga0105239_100501314 | 395 |
| 225 | 3300011119 | Ga0105246_10006967 | Ga0105246_100069672 | 395 |
| 226 | 3300013100 | Ga0157373_10010252 | Ga0157373_100102524 | 395 |
| 227 | 3300013296 | Ga0157374_10030085 | Ga0157374_100300854 | 395 |
| 228 | 3300013296 | Ga0157374_10159772 | Ga0157374_101597722 | 395 |
| 229 | 3300013297 | Ga0157378_10048774 | Ga0157378_100487743 | 395 |
| 230 | 3300013306 | Ga0163162_10168684 | Ga0163162_101686842 | 395 |
| 231 | 3300013307 | Ga0157372_10004526 | Ga0157372_100045265 | 395 |
| 232 | 3300013307 | Ga0157372_10103698 | Ga0157372_101036982 | 395 |
| 233 | 3300013307 | Ga0157372_10106368 | Ga0157372_101063683 | 395 |
| 234 | 3300013307 | Ga0157372_10120689 | Ga0157372_101206892 | 395 |
| 235 | 3300013308 | Ga0157375_10000990 | Ga0157375_1000099026 | 395 |
| 236 | 3300014968 | Ga0157379_10020201 | Ga0157379_100202015 | 395 |
| 237 | 3300014968 | Ga0157379_10140072 | Ga0157379_101400722 | 395 |
| 238 | 3300014969 | Ga0157376_10000172 | Ga0157376_1000017210 | 395 |
| 239 | 3300017792 | Ga0163161_10074985 | Ga0163161_100749852 | 395 |
| 240 | 3300025254 | Ga0209148_1000160 | Ga0209148_100016085 | 395 |
| 241 | 3300025254 | Ga0209148_1000579 | Ga0209148_100057916 | 395 |
| 242 | 3300025272 | Ga0209455_1002767 | Ga0209455_10027673 | 395 |
| 243 | 3300025900 | Ga0207710_10021535 | Ga0207710_100215352 | 395 |
| 244 | 3300025903 | Ga0207680_10149865 | Ga0207680_101498651 | 395 |
| 245 | 3300025904 | Ga0207647_10000314 | Ga0207647_1000031416 | 395 |
| 246 | 3300025907 | Ga0207645_10000940 | Ga0207645_1000094019 | 395 |
| 247 | 3300025909 | Ga0207705_10000354 | Ga0207705_1000035418 | 395 |
| 248 | 3300025909 | Ga0207705_10005730 | Ga0207705_100057305 | 395 |
| 249 | 3300025913 | Ga0207695_10013634 | Ga0207695_100136343 | 395 |
| 250 | 3300025913 | Ga0207695_10027428 | Ga0207695_100274282 | 395 |
| 251 | 3300025913 | Ga0207695_10031626 | Ga0207695_100316265 | 395 |
| 252 | 3300025914 | Ga0207671_10001177 | Ga0207671_100011772 | 395 |
| 253 | 3300025914 | Ga0207671_10020229 | Ga0207671_100202293 | 395 |
| 254 | 3300025914 | Ga0207671_10113037 | Ga0207671_101130372 | 395 |
| 255 | 3300025919 | Ga0207657_10002458 | Ga0207657_100024585 | 395 |
| 256 | 3300025924 | Ga0207694_10027265 | Ga0207694_100272653 | 395 |
| 257 | 3300025924 | Ga0207694_10078694 | Ga0207694_100786942 | 395 |
| 258 | 3300025926 | Ga0207659_10026637 | Ga0207659_100266372 | 395 |
| 259 | 3300025931 | Ga0207644_10015655 | Ga0207644_100156554 | 395 |
| 260 | 3300025933 | Ga0207706_10009378 | Ga0207706_100093788 | 395 |
| 261 | 3300025934 | Ga0207686_10000821 | Ga0207686_1000082114 | 395 |
| 262 | 3300025935 | Ga0207709_10000237 | Ga0207709_1000023764 | 395 |
| 263 | 3300025938 | Ga0207704_10000003 | Ga0207704_1000000364 | 395 |
| 264 | 3300025940 | Ga0207691_10146941 | Ga0207691_101469412 | 395 |
| 265 | 3300025941 | Ga0207711_10000649 | Ga0207711_1000064917 | 395 |
| 266 | 3300025949 | Ga0207667_10000007 | Ga0207667_10000007573 | 395 |
| 267 | 3300025949 | Ga0207667_10007580 | Ga0207667_100075805 | 395 |
| 268 | 3300025949 | Ga0207667_10063192 | Ga0207667_100631922 | 395 |
| 269 | 3300025960 | Ga0207651_10000003 | Ga0207651_1000000364 | 395 |
| 270 | 3300025961 | Ga0207712_10055586 | Ga0207712_100555862 | 395 |
| 271 | 3300025961 | Ga0207712_10242107 | Ga0207712_102421072 | 395 |
| 272 | 3300025981 | Ga0207640_10000263 | Ga0207640_1000026312 | 395 |
| 273 | 3300025981 | Ga0207640_10039331 | Ga0207640_100393312 | 395 |
| 274 | 3300025986 | Ga0207658_10034694 | Ga0207658_100346941 | 395 |
| 275 | 3300026023 | Ga0207677_10000628 | Ga0207677_100006289 | 395 |
| 276 | 3300026035 | Ga0207703_10002123 | Ga0207703_100021236 | 395 |
| 277 | 3300026041 | Ga0207639_10012254 | Ga0207639_100122542 | 395 |
| 278 | 3300026041 | Ga0207639_10015159 | Ga0207639_100151592 | 395 |
| 279 | 3300026041 | Ga0207639_10095073 | Ga0207639_100950732 | 395 |
| 280 | 3300026067 | Ga0207678_10020521 | Ga0207678_100205214 | 395 |
| 281 | 3300026067 | Ga0207678_10122875 | Ga0207678_101228752 | 395 |
| 282 | 3300026078 | Ga0207702_10048181 | Ga0207702_100481812 | 395 |
| 283 | 3300026088 | Ga0207641_10000650 | Ga0207641_1000065014 | 395 |
| 284 | 3300026089 | Ga0207648_10000007 | Ga0207648_10000007128 | 395 |
| 285 | 3300026095 | Ga0207676_10178286 | Ga0207676_101782862 | 395 |
| 286 | 3300026095 | Ga0207676_10299461 | Ga0207676_102994612 | 395 |
| 287 | 3300026116 | Ga0207674_10026672 | Ga0207674_100266725 | 395 |
| 288 | 3300026118 | Ga0207675_100000285 | Ga0207675_10000028518 | 395 |
| 289 | 3300026142 | Ga0207698_10013684 | Ga0207698_100136846 | 395 |
| 290 | 3300028381 | Ga0268264_10000188 | Ga0268264_10000188110 | 395 |
| 291 | 3300028573 | Ga0265334_10023511 | Ga0265334_100235112 | 395 |
| 292 | 3300028577 | Ga0265318_10014941 | Ga0265318_100149413 | 395 |
| 293 | 3300031250 | Ga0265331_10004682 | Ga0265331_100046823 | 395 |
| 294 | 3300037471 | Ga0395905_0054790 | Ga0395905_0054790_2470_3678 | 395 |
| 295 | 3300044683 | Ga0466965_0016816 | Ga0466965_0016816_378_1568 | 395 |
| 296 | 3300044693 | Ga0466961_0010796 | Ga0466961_0010796_4066_5256 | 395 |
| 297 | 3300044694 | Ga0466963_0001878 | Ga0466963_0001878_1247_2437 | 395 |
| 298 | 3300044706 | Ga0466964_0000784 | Ga0466964_0000784_196_1386 | 395 |
| 299 | 3300044719 | Ga0466971_0010331 | Ga0466971_0010331_1154_2344 | 395 |
| 300 | 3300044735 | Ga0466968_0031011 | Ga0466968_0031011_417_1607 | 395 |
| 301 | 3300044842 | Ga0466957_0015835 | Ga0466957_0015835_2589_3779 | 395 |
| 302 | 3300045049 | Ga0466959_0100460 | Ga0466959_0100460_741_1928 | 395 |
| 303 | 3300045836 | Ga0466958_0004157 | Ga0466958_0004157_2661_3851 | 395 |
| 304 | 3300045976 | Ga0466967_0002434 | Ga0466967_0002434_7488_8678 | 395 |
| 305 | 3300046460 | Ga0495638_0000253 | Ga0495638_0000253_57527_58717 | 395 |
| 306 | 3300046542 | Ga0495597_0076904 | Ga0495597_0076904_39_1229 | 395 |
| 307 | 3300046660 | Ga0495625_0000031 | Ga0495625_0000031_58698_59888 | 395 |
| 308 | 3300048920 | Ga0496117_0000035 | Ga0496117_0000035_172917_174134 | 395 |
| 309 | 3300048920 | Ga0496117_0027593 | Ga0496117_0027593_1685_2872 | 395 |
| 310 | 3300048921 | Ga0496118_0000054 | Ga0496118_0000054_48927_50144 | 395 |
| 311 | 3300048921 | Ga0496118_0065230 | Ga0496118_0065230_1036_2223 | 395 |
| 312 | 3300048922 | Ga0496119_0000260 | Ga0496119_0000260_28854_30071 | 395 |
| 313 | 3300048922 | Ga0496119_0004560 | Ga0496119_0004560_9416_10633 | 395 |
| 314 | 3300048923 | Ga0496120_0000061 | Ga0496120_0000061_161588_162805 | 395 |
| 315 | 3300048924 | Ga0496121_0114911 | Ga0496121_0114911_823_2016 | 395 |
| 316 | 3300048925 | Ga0496122_0001585 | Ga0496122_0001585_11066_12253 | 395 |
| 317 | 3300048925 | Ga0496122_0058812 | Ga0496122_0058812_677_1864 | 395 |
| 318 | 3300048926 | Ga0496123_0010976 | Ga0496123_0010976_81_1268 | 395 |
| 319 | 3300048927 | Ga0496124_0005523 | Ga0496124_0005523_12880_14067 | 395 |
| 320 | 3300048928 | Ga0496125_0001169 | Ga0496125_0001169_23009_24220 | 395 |
| 321 | 3300048928 | Ga0496125_0003275 | Ga0496125_0003275_8492_9709 | 395 |
| 322 | 3300048928 | Ga0496125_0106181 | Ga0496125_0106181_337_1524 | 395 |
| 323 | 3300048929 | Ga0496126_0096214 | Ga0496126_0096214_261_1448 | 395 |
| 324 | 3300053092 | Ga0500583_0000478 | Ga0500583_0000478_3907_5124 | 395 |
| 325 | 3300053134 | Ga0500658_0001311 | Ga0500658_0001311_6071_7261 | 395 |
| 326 | 3300053139 | Ga0500568_0007511 | Ga0500568_0007511_967_2157 | 395 |
| 327 | 3300053153 | Ga0500616_0005654 | Ga0500616_0005654_632_1822 | 395 |
| 328 | 3300053156 | Ga0500622_0000698 | Ga0500622_0000698_10681_11910 | 395 |
| 329 | 3300053156 | Ga0500622_0001442 | Ga0500622_0001442_5106_6335 | 395 |
| 330 | 3300061719 | Ga0466962_0009209 | Ga0466962_0009209_1839_3029 | 395 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hl6-assembly2.cif.gz_C | yfde from escherichia coli | 0.9485 | 3 | 381 |
| 5yx6-assembly2.cif.gz_D | crystal structure of rv3272 from m. tuberculosis orthorhombic form | 0.9416 | 3 | 375 |
| 4hl6-assembly2.cif.gz_C | yfde from escherichia coli | 0.9412 | 3 | 381 |
| 5yiy-assembly1.cif.gz_B | crystal structure of d175a mutant of rv3272 from mycobacterium tuberculosis | 0.9409 | 3 | 375 |
| 5yit-assembly1.cif.gz_A | crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis | 0.94 | 3 | 377 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hl6E02 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9766 | 228 | 319 | 3.30.1540.10 |
| af_Q4V9F2_1_227_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9744 | 27 | 238 | 3.40.50.10540 |
| 4ed9A02 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9685 | 228 | 319 | 3.30.1540.10 |
| af_Q9VDL4_46_327_3.40.50.10540 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 | 0.9683 | 3 | 285 | 3.40.50.10540 |
| 4hl6E02 | Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 | 0.9663 | 228 | 319 | 3.30.1540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259FSB0-F1-model_v4 | CoA transferase | 0.9855 | 4 | 163 |
GO:0008410
|
| AF-A0A258IQJ1-F1-model_v4 | CoA transferase | 0.9852 | 4 | 393 |
GO:0008410
|
| AF-A0A3L7VS60-F1-model_v4 | CoA transferase | 0.9807 | 3 | 381 |
GO:0008410
|
| AF-A0A1F9DFM9-F1-model_v4 | Formyl-CoA transferase | 0.9805 | 3 | 392 |
GO:0008410
|
| AF-A0A381XRA4-F1-model_v4 | CoA transferase | 0.9803 | 4 | 385 |
GO:0008410
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar