F410157

General Info

Members Datasets Scaffolds Average Seq Length
330 153 660 169

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100138885|Ga0307408_1001388852
Length 173
Sequence MTPLQTLYDRIDDLSIAMMTTRRHDGHLRARAMATQKAAPGADLWFVTANGSGKLAELGADPHVNLAYYRNSNSEWVSVSGLAEISRERATIHQLYQPDWSVWFPKDGADPRHGTRDDPRMVLIGVTVHAAEFLAIDAPRPVLLYELAKGWLTGREPELGESHALSQPHRPPE

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
107 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
108 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
114 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
148 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
149 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 0.3
Rhizosphere 97.27
Stem 0
Stem Tuber 0
Unclassified 21.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100138885 3300031548 Bacteria 1905
2 SwRhRL3b_contig_1764455 2162886006 Bacteria 981
3 Ga0065714_10333863 3300005288 Bacteria 654
4 Ga0065712_10067865 3300005290 Bacteria 24437
5 Ga0065712_10282317 3300005290 Unclassified 893
6 Ga0065712_10311799 3300005290 Bacteria 842
7 Ga0065715_10045497 3300005293 Bacteria 1243
8 Ga0065715_10100051 3300005293 Bacteria 3341
9 Ga0065715_10202491 3300005293 Bacteria 1354
10 Ga0065715_10229751 3300005293 Bacteria 1238
11 Ga0065707_10103748 3300005295 Bacteria 2731
12 Ga0065707_10137776 3300005295 Bacteria 1815
13 Ga0065707_10645132 3300005295 Bacteria 666
14 Ga0070676_10290389 3300005328 Bacteria 1105
15 Ga0070690_100057265 3300005330 Bacteria 2501
16 Ga0070670_100141806 3300005331 Bacteria 2078
17 Ga0070670_100229073 3300005331 Bacteria 1617
18 Ga0070677_10008414 3300005333 Bacteria 3470
19 Ga0070677_10167847 3300005333 Bacteria 1035
20 Ga0070677_10258295 3300005333 Bacteria 868
21 Ga0068869_100324848 3300005334 Bacteria 1249
22 Ga0070666_10226140 3300005335 Unclassified 1321
23 Ga0070666_10813830 3300005335 Unclassified 688
24 Ga0070682_100179102 3300005337 Bacteria 1479
25 Ga0070689_100059798 3300005340 Bacteria 2962
26 Ga0070689_100078391 3300005340 Bacteria 2590
27 Ga0070689_101183018 3300005340 Bacteria 686
28 Ga0070687_100135711 3300005343 Bacteria 1426
29 Ga0070661_100043218 3300005344 Bacteria 3292
30 Ga0070661_100236542 3300005344 Unclassified 1405
31 Ga0070668_100126342 3300005347 Bacteria 2049
32 Ga0070669_100035610 3300005353 Bacteria 3606
33 Ga0070669_100213918 3300005353 Bacteria 1522
34 Ga0070669_100291759 3300005353 Unclassified 1310
35 Ga0070669_100608710 3300005353 Unclassified 916
36 Ga0070675_100014210 3300005354 Bacteria 6276
37 Ga0070675_100018104 3300005354 Bacteria 5607
38 Ga0070675_100179284 3300005354 Unclassified 1831
39 Ga0070675_100291739 3300005354 Bacteria 1436
40 Ga0070671_100076526 3300005355 Bacteria 2796
41 Ga0070671_100414617 3300005355 Bacteria 1153
42 Ga0070674_100004591 3300005356 Bacteria 7893
43 Ga0070674_100237351 3300005356 Bacteria 1426
44 Ga0070674_100368901 3300005356 Unclassified 1164
45 Ga0070674_100382573 3300005356 Unclassified 1145
46 Ga0070674_100718349 3300005356 Bacteria 856
47 Ga0070673_100069232 3300005364 Unclassified 2827
48 Ga0070673_100092462 3300005364 Bacteria 2474
49 Ga0070688_100002573 3300005365 Bacteria 9188
50 Ga0070688_100065921 3300005365 Bacteria 2303
51 Ga0070659_100127395 3300005366 Bacteria 2066
52 Ga0070701_10256983 3300005438 Bacteria 1057
53 Ga0070700_100490608 3300005441 Unclassified 943
54 Ga0070700_100927106 3300005441 Bacteria 711
55 Ga0070694_100810539 3300005444 Unclassified 768
56 Ga0070678_100154104 3300005456 Bacteria 1854
57 Ga0070678_100279126 3300005456 Bacteria 1412
58 Ga0070678_100399478 3300005456 Unclassified 1194
59 Ga0070662_100165795 3300005457 Bacteria 1731
60 Ga0070662_100309919 3300005457 Unclassified 1285
61 Ga0070662_100327074 3300005457 Bacteria 1251
62 Ga0070662_100410904 3300005457 Unclassified 1118
63 Ga0070679_100502758 3300005530 Bacteria 1156
64 Ga0070684_100409300 3300005535 Bacteria 1251
65 Ga0070672_100008673 3300005543 Bacteria 6970
66 Ga0070672_100082977 3300005543 Bacteria 2572
67 Ga0070686_100107641 3300005544 Unclassified 1894
68 Ga0070704_100449842 3300005549 Bacteria 1109
69 Ga0070664_100384737 3300005564 Bacteria 1281
70 Ga0068857_100032486 3300005577 Bacteria 4615
71 Ga0068859_100137763 3300005617 Bacteria 2514
72 Ga0068859_100165285 3300005617 Bacteria 2293
73 Ga0068859_100194396 3300005617 Bacteria 2113
74 Ga0068859_100808443 3300005617 Bacteria 1025
75 Ga0068864_100007371 3300005618 Bacteria 9054
76 Ga0068864_100252730 3300005618 Bacteria 1637
77 Ga0068870_10008073 3300005840 Bacteria 4716
78 Ga0068870_10133006 3300005840 Bacteria 1447
79 Ga0068858_101765850 3300005842 Bacteria 611
80 Ga0068860_100626833 3300005843 Unclassified 1082
81 Ga0068862_100064094 3300005844 Bacteria 3163
82 Ga0068862_100113408 3300005844 Bacteria 2381
83 Ga0068862_100417649 3300005844 Bacteria 1258
84 Ga0068862_100580142 3300005844 Unclassified 1074
85 Ga0068862_100638510 3300005844 Unclassified 1026
86 Ga0081539_10086420 3300005985 Bacteria 1632
87 Ga0075365_10021852 3300006038 Bacteria 3997
88 Ga0075368_10013257 3300006042 Bacteria 3025
89 Ga0075364_10006647 3300006051 Bacteria 6814
90 Ga0097621_100630636 3300006237 Unclassified 982
91 Ga0075370_10007423 3300006353 Bacteria 5584
92 Ga0075428_100002848 3300006844 Bacteria 18870
93 Ga0075428_100016851 3300006844 Bacteria 8069
94 Ga0075428_101399152 3300006844 Bacteria 734
95 Ga0075430_100125278 3300006846 Bacteria 2141
96 Ga0075430_100151845 3300006846 Bacteria 1928
97 Ga0075430_100238216 3300006846 Bacteria 1508
98 Ga0075431_100006322 3300006847 Bacteria 11766
99 Ga0075431_100303641 3300006847 Bacteria 1612
100 Ga0075431_100666683 3300006847 Bacteria 1020
101 Ga0075429_100067921 3300006880 Bacteria 3103
102 Ga0075429_100791278 3300006880 Bacteria 831
103 Ga0068865_100116269 3300006881 Bacteria 1981
104 Ga0068865_100117281 3300006881 Bacteria 1973
105 Ga0097620_100137755 3300006931 Bacteria 2514
106 Ga0097620_100165282 3300006931 Bacteria 2293
107 Ga0097620_100194377 3300006931 Bacteria 2113
108 Ga0097620_100808397 3300006931 Bacteria 1025
109 Ga0111539_10000733 3300009094 Bacteria 42654
110 Ga0111539_10001942 3300009094 Bacteria 27552
111 Ga0111539_10012522 3300009094 Bacteria 10630
112 Ga0111539_10027018 3300009094 Bacteria 7010
113 Ga0111539_10085282 3300009094 Bacteria 3712
114 Ga0111539_10248254 3300009094 Unclassified 2072
115 Ga0111539_10255242 3300009094 Bacteria 2042
116 Ga0111539_12133596 3300009094 Bacteria 650
117 Ga0114129_10004998 3300009147 Bacteria 18679
118 Ga0114129_10026704 3300009147 Bacteria 8178
119 Ga0114129_10105928 3300009147 Bacteria 3885
120 Ga0114129_11605855 3300009147 Bacteria 796
121 Ga0105243_10350993 3300009148 Bacteria 1354
122 Ga0105243_10626560 3300009148 Unclassified 1039
123 Ga0105248_12274447 3300009177 Unclassified 617
124 Ga0105249_10012774 3300009553 Bacteria 7406
125 Ga0105249_10322764 3300009553 Unclassified 1556
126 Ga0105249_10623143 3300009553 Bacteria 1135
127 Ga0157378_12212997 3300013297 Unclassified 601
128 Ga0163162_11317248 3300013306 Bacteria 821
129 Ga0157375_10087322 3300013308 Unclassified 3171
130 Ga0157375_10317819 3300013308 Bacteria 1721
131 Ga0157375_12605154 3300013308 Unclassified 604
132 Ga0163163_10129826 3300014325 Bacteria 2560
133 Ga0157380_10008079 3300014326 Bacteria 7496
134 Ga0157380_10099406 3300014326 Unclassified 2420
135 Ga0157380_10100851 3300014326 Bacteria 2404
136 Ga0157380_10266740 3300014326 Bacteria 1558
137 Ga0157380_10813648 3300014326 Bacteria 952
138 Ga0157380_11404423 3300014326 Unclassified 749
139 Ga0157377_10196835 3300014745 Bacteria 1277
140 Ga0157377_10259108 3300014745 Bacteria 1131
141 Ga0157376_10035331 3300014969 Bacteria 4042
142 Ga0163161_10036764 3300017792 Unclassified 3507
143 Ga0207697_10204475 3300025315 Bacteria 869
144 Ga0207682_10010173 3300025893 Bacteria 3691
145 Ga0207682_10106542 3300025893 Unclassified 1230
146 Ga0207688_10052057 3300025901 Unclassified 2294
147 Ga0207680_10050816 3300025903 Unclassified 2476
148 Ga0207645_10045941 3300025907 Bacteria 2790
149 Ga0207645_10217519 3300025907 Unclassified 1259
150 Ga0207645_10321671 3300025907 Bacteria 1032
151 Ga0207643_10009126 3300025908 Bacteria 5327
152 Ga0207662_10300770 3300025918 Bacteria 1066
153 Ga0207662_10642727 3300025918 Bacteria 740
154 Ga0207681_10030130 3300025923 Bacteria 3534
155 Ga0207681_10090083 3300025923 Bacteria 2189
156 Ga0207681_10112731 3300025923 Bacteria 1981
157 Ga0207681_10267046 3300025923 Bacteria 1342
158 Ga0207681_10471365 3300025923 Bacteria 1024
159 Ga0207650_10189536 3300025925 Bacteria 1642
160 Ga0207659_10004417 3300025926 Bacteria 8501
161 Ga0207659_10011444 3300025926 Bacteria 5605
162 Ga0207659_10039889 3300025926 Bacteria 3279
163 Ga0207659_10066899 3300025926 Unclassified 2609
164 Ga0207659_10552443 3300025926 Bacteria 979
165 Ga0207659_10566252 3300025926 Bacteria 967
166 Ga0207659_10675380 3300025926 Bacteria 884
167 Ga0207706_10186567 3300025933 Bacteria 1821
168 Ga0207706_10189578 3300025933 Bacteria 1805
169 Ga0207706_10206994 3300025933 Bacteria 1720
170 Ga0207706_10373746 3300025933 Bacteria 1238
171 Ga0207706_10745137 3300025933 Unclassified 835
172 Ga0207670_10024234 3300025936 Bacteria 3791
173 Ga0207670_10363222 3300025936 Unclassified 1149
174 Ga0207669_10003637 3300025937 Bacteria 6692
175 Ga0207669_10165418 3300025937 Bacteria 1568
176 Ga0207669_10894426 3300025937 Unclassified 741
177 Ga0207691_10005322 3300025940 Bacteria 12425
178 Ga0207691_10008570 3300025940 Bacteria 9816
179 Ga0207689_11276392 3300025942 Unclassified 617
180 Ga0207679_10430840 3300025945 Bacteria 1166
181 Ga0207679_10818753 3300025945 Unclassified 849
182 Ga0207651_10067545 3300025960 Bacteria 2516
183 Ga0207651_10581046 3300025960 Bacteria 977
184 Ga0207651_10868862 3300025960 Bacteria 802
185 Ga0207651_11655229 3300025960 Unclassified 576
186 Ga0207712_10036135 3300025961 Bacteria 3362
187 Ga0207712_10493996 3300025961 Unclassified 1045
188 Ga0207668_11341207 3300025972 Unclassified 644
189 Ga0207658_10410361 3300025986 Unclassified 1192
190 Ga0207677_10377873 3300026023 Unclassified 1195
191 Ga0207648_10125466 3300026089 Bacteria 2258
192 Ga0207676_10064711 3300026095 Bacteria 2909
193 Ga0207676_10155653 3300026095 Bacteria 1974
194 Ga0207674_10042870 3300026116 Bacteria 4669
195 Ga0207675_101154265 3300026118 Bacteria 795
196 Ga0207683_10119213 3300026121 Bacteria 2368
197 Ga0207683_10215478 3300026121 Unclassified 1749
198 Ga0207428_10004907 3300027907 Bacteria 12605
199 Ga0207428_10019492 3300027907 Bacteria 5782
200 Ga0207428_10027178 3300027907 Bacteria 4765
201 Ga0207428_10081403 3300027907 Bacteria 2528
202 Ga0268265_10290944 3300028380 Unclassified 1466
203 Ga0268265_10497772 3300028380 Bacteria 1148
204 Ga0268264_10289490 3300028381 Unclassified 1538
205 Ga0307408_100291171 3300031548 Unclassified 1364
206 Ga0307408_101371681 3300031548 Bacteria 665
207 Ga0307413_10308320 3300031824 Bacteria 1204
208 Ga0307413_10669786 3300031824 Bacteria 858
209 Ga0307413_10912151 3300031824 Bacteria 747
210 Ga0307413_11179535 3300031824 Bacteria 665
211 Ga0307410_10752078 3300031852 Bacteria 825
212 Ga0307406_10107555 3300031901 Bacteria 1913
213 Ga0307407_10078362 3300031903 Unclassified 1991
214 Ga0307412_10211961 3300031911 Bacteria 1479
215 Ga0307409_100713567 3300031995 Bacteria 1003
216 Ga0307416_100020005 3300032002 Unclassified 4763
217 Ga0307416_100207296 3300032002 Bacteria 1866
218 Ga0307414_10245568 3300032004 Bacteria 1485
219 Ga0307411_10065280 3300032005 Unclassified 2441
220 Ga0307411_10450797 3300032005 Unclassified 1076
221 Ga0450914_036213 3300042118 Bacteria 612
222 Ga0439434_0079399 3300042435 Bacteria 1040
223 Ga0439434_0099787 3300042435 Bacteria 935
224 Ga0439435_0017682 3300042436 Bacteria 1806
225 Ga0439435_0193253 3300042436 Unclassified 668
226 Ga0439460_0033723 3300042461 Unclassified 1472
227 Ga0453684_0092399 3300044712 Bacteria 3731
228 Ga0495643_0388124 3300046522 Bacteria 618
229 Ga0496113_0028697 3300048916 Bacteria 4006
230 Ga0501298_133754 3300049521 Unclassified 594
231 Ga0501299_029242 3300049522 Bacteria 1054
232 Ga0501031_0172163 3300049568 Bacteria 1415
233 Ga0501031_0644206 3300049568 Bacteria 681
234 Ga0501032_0621478 3300049569 Bacteria 687
235 Ga0501036_0028789 3300049572 Bacteria 4695
236 Ga0501036_0144194 3300049572 Unclassified 2009
237 Ga0501036_0889352 3300049572 Bacteria 731
238 Ga0501036_1205045 3300049572 Unclassified 617
239 Ga0501038_0140863 3300049574 Bacteria 1973
240 Ga0501038_0200276 3300049574 Bacteria 1603
241 Ga0501038_0260510 3300049574 Bacteria 1371
242 Ga0501039_0280433 3300049575 Bacteria 1310
243 Ga0501040_0031477 3300049576 Bacteria 3586
244 Ga0501040_0227957 3300049576 Bacteria 1326
245 Ga0501040_0637772 3300049576 Unclassified 770
246 Ga0501040_0748057 3300049576 Bacteria 707
247 Ga0501041_0024835 3300049577 Unclassified 3599
248 Ga0501042_0011792 3300049578 Bacteria 5906
249 Ga0501042_0048890 3300049578 Bacteria 3016
250 Ga0501042_0514882 3300049578 Bacteria 869
251 Ga0501046_0351522 3300049580 Unclassified 1070
252 Ga0501046_0459671 3300049580 Bacteria 915
253 Ga0501048_0175209 3300049582 Bacteria 1520
254 Ga0501048_0271993 3300049582 Bacteria 1204
255 Ga0501068_0070410 3300049584 Bacteria 2134
256 Ga0501071_0003662 3300049587 Bacteria 9638
257 Ga0501071_0074137 3300049587 Bacteria 2484
258 Ga0501071_0112693 3300049587 Bacteria 2011
259 Ga0501071_0839847 3300049587 Unclassified 708
260 Ga0501072_0000990 3300049588 Bacteria 20996
261 Ga0501072_0022573 3300049588 Bacteria 4880
262 Ga0501072_0102855 3300049588 Bacteria 2270
263 Ga0501072_0217119 3300049588 Bacteria 1524
264 Ga0501074_0167876 3300049590 Unclassified 1567
265 Ga0501074_0345570 3300049590 Bacteria 1056
266 Ga0501074_0369684 3300049590 Bacteria 1017
267 Ga0501075_0024621 3300049591 Bacteria 4418
268 Ga0501075_0202016 3300049591 Bacteria 1516
269 Ga0501076_0020971 3300049592 Bacteria 5006
270 Ga0501076_0021744 3300049592 Bacteria 4925
271 Ga0501076_0027498 3300049592 Bacteria 4411
272 Ga0501076_1472106 3300049592 Bacteria 559
273 Ga0501077_0074086 3300049593 Bacteria 2157
274 Ga0501077_0075365 3300049593 Bacteria 2137
275 Ga0501217_040404 3300049661 Unclassified 1185
276 Ga0501079_0041408 3300049741 Bacteria 3555
277 Ga0501079_0654877 3300049741 Bacteria 827
278 Ga0501080_0109362 3300049742 Bacteria 2562
279 Ga0501080_0217819 3300049742 Bacteria 1748
280 Ga0501080_0351469 3300049742 Bacteria 1331
281 Ga0501081_0008752 3300049743 Bacteria 6579
282 Ga0501081_0021841 3300049743 Bacteria 4276
283 Ga0501081_0376928 3300049743 Bacteria 1048
284 Ga0501081_0811786 3300049743 Unclassified 704
285 Ga0501081_0939423 3300049743 Bacteria 653
286 Ga0501083_0183459 3300049744 Bacteria 1366
287 Ga0501045_0021599 3300049824 Bacteria 4606
288 Ga0501045_0128787 3300049824 Bacteria 1881
289 Ga0501045_0664536 3300049824 Bacteria 770
290 Ga0501045_1010860 3300049824 Unclassified 609
291 nmdc:mga0yw44_36713_c1 3300050492 Bacteria 2889
292 nmdc:mga06z11_14879_c1 3300050494 Bacteria 3458
293 nmdc:mga07m45_70807_c1 3300050496 Bacteria 1984
294 nmdc:mga05p37_276795_c1 3300050507 Bacteria 2003
295 nmdc:mga05p37_4745_c1 3300050507 Bacteria 15881
296 nmdc:mga05p37_65817_c1 3300050507 Bacteria 4459
297 nmdc:mga09592_168182_c1 3300050508 Bacteria 1895
298 nmdc:mga09592_457457_c1 3300050508 Bacteria 1101
299 nmdc:mga09592_689081_c1 3300050508 Bacteria 870
300 nmdc:mga0qj67_1348_c1 3300050509 Bacteria 3612
301 nmdc:mga0qj67_321006_c1 3300050509 Bacteria 1254
302 nmdc:mga0qj67_45085_c1 3300050509 Bacteria 3478
303 nmdc:mga0qj67_48271_c1 3300050509 Bacteria 3363
304 nmdc:mga0qj67_729083_c1 3300050509 Bacteria 787
305 nmdc:mga06r32_1098325_c1 3300050510 Unclassified 745
306 nmdc:mga06r32_23912_c1 3300050510 Bacteria 5663
307 nmdc:mga06r32_577084_c1 3300050510 Bacteria 1097
308 nmdc:mga08y16_1053726_c1 3300050511 Unclassified 790
309 nmdc:mga08y16_129827_c1 3300050511 Bacteria 2621
310 nmdc:mga08y16_1639_c1 3300050511 Bacteria 22669
311 nmdc:mga08y16_209_c1 3300050511 Bacteria 52522
312 nmdc:mga08y16_3777_c1 3300050511 Bacteria 15774
313 nmdc:mga08y16_42717_c1 3300050511 Bacteria 4747
314 nmdc:mga08y16_432247_c1 3300050511 Bacteria 1344
315 nmdc:mga08y16_433387_c1 3300050511 Bacteria 1342
316 nmdc:mga0a205_704572_c1 3300050515 Bacteria 859
317 Ga0500611_058266 3300053727 Unclassified 907
318 Ga0501084_0016787 3300054114 Bacteria 6083
319 Ga0501084_0934132 3300054114 Unclassified 729
320 Ga0590071_000327 3300059421 Bacteria 13956
321 Ga0590071_011794 3300059421 Bacteria 2045
322 Ga0590074_000879 3300059423 Bacteria 4679
323 Ga0590074_021161 3300059423 Bacteria 1121
324 Ga0590075_001063 3300059424 Bacteria 7102
325 Ga0590077_000141 3300059426 Bacteria 19753
326 Ga0590077_041283 3300059426 Unclassified 1025
327 Ga0590077_044696 3300059426 Bacteria 989
328 Ga0501082_0064365 3300060353 Bacteria 3158
329 Ga0501082_0137590 3300060353 Bacteria 2119
330 Ga0501082_0182589 3300060353 Bacteria 1825
331 Ga0307408_100138885
332 SwRhRL3b_contig_1764455
333 Ga0065714_10333863
334 Ga0065712_10067865
335 Ga0065712_10282317
336 Ga0065712_10311799
337 Ga0065715_10045497
338 Ga0065715_10100051
339 Ga0065715_10202491
340 Ga0065715_10229751
341 Ga0065707_10103748
342 Ga0065707_10137776
343 Ga0065707_10645132
344 Ga0070676_10290389
345 Ga0070690_100057265
346 Ga0070670_100141806
347 Ga0070670_100229073
348 Ga0070677_10008414
349 Ga0070677_10167847
350 Ga0070677_10258295
351 Ga0068869_100324848
352 Ga0070666_10226140
353 Ga0070666_10813830
354 Ga0070682_100179102
355 Ga0070689_100059798
356 Ga0070689_100078391
357 Ga0070689_101183018
358 Ga0070687_100135711
359 Ga0070661_100043218
360 Ga0070661_100236542
361 Ga0070668_100126342
362 Ga0070669_100035610
363 Ga0070669_100213918
364 Ga0070669_100291759
365 Ga0070669_100608710
366 Ga0070675_100014210
367 Ga0070675_100018104
368 Ga0070675_100179284
369 Ga0070675_100291739
370 Ga0070671_100076526
371 Ga0070671_100414617
372 Ga0070674_100004591
373 Ga0070674_100237351
374 Ga0070674_100368901
375 Ga0070674_100382573
376 Ga0070674_100718349
377 Ga0070673_100069232
378 Ga0070673_100092462
379 Ga0070688_100002573
380 Ga0070688_100065921
381 Ga0070659_100127395
382 Ga0070701_10256983
383 Ga0070700_100490608
384 Ga0070700_100927106
385 Ga0070694_100810539
386 Ga0070678_100154104
387 Ga0070678_100279126
388 Ga0070678_100399478
389 Ga0070662_100165795
390 Ga0070662_100309919
391 Ga0070662_100327074
392 Ga0070662_100410904
393 Ga0070679_100502758
394 Ga0070684_100409300
395 Ga0070672_100008673
396 Ga0070672_100082977
397 Ga0070686_100107641
398 Ga0070704_100449842
399 Ga0070664_100384737
400 Ga0068857_100032486
401 Ga0068859_100137763
402 Ga0068859_100165285
403 Ga0068859_100194396
404 Ga0068859_100808443
405 Ga0068864_100007371
406 Ga0068864_100252730
407 Ga0068870_10008073
408 Ga0068870_10133006
409 Ga0068858_101765850
410 Ga0068860_100626833
411 Ga0068862_100064094
412 Ga0068862_100113408
413 Ga0068862_100417649
414 Ga0068862_100580142
415 Ga0068862_100638510
416 Ga0081539_10086420
417 Ga0075365_10021852
418 Ga0075368_10013257
419 Ga0075364_10006647
420 Ga0097621_100630636
421 Ga0075370_10007423
422 Ga0075428_100002848
423 Ga0075428_100016851
424 Ga0075428_101399152
425 Ga0075430_100125278
426 Ga0075430_100151845
427 Ga0075430_100238216
428 Ga0075431_100006322
429 Ga0075431_100303641
430 Ga0075431_100666683
431 Ga0075429_100067921
432 Ga0075429_100791278
433 Ga0068865_100116269
434 Ga0068865_100117281
435 Ga0097620_100137755
436 Ga0097620_100165282
437 Ga0097620_100194377
438 Ga0097620_100808397
439 Ga0111539_10000733
440 Ga0111539_10001942
441 Ga0111539_10012522
442 Ga0111539_10027018
443 Ga0111539_10085282
444 Ga0111539_10248254
445 Ga0111539_10255242
446 Ga0111539_12133596
447 Ga0114129_10004998
448 Ga0114129_10026704
449 Ga0114129_10105928
450 Ga0114129_11605855
451 Ga0105243_10350993
452 Ga0105243_10626560
453 Ga0105248_12274447
454 Ga0105249_10012774
455 Ga0105249_10322764
456 Ga0105249_10623143
457 Ga0157378_12212997
458 Ga0163162_11317248
459 Ga0157375_10087322
460 Ga0157375_10317819
461 Ga0157375_12605154
462 Ga0163163_10129826
463 Ga0157380_10008079
464 Ga0157380_10099406
465 Ga0157380_10100851
466 Ga0157380_10266740
467 Ga0157380_10813648
468 Ga0157380_11404423
469 Ga0157377_10196835
470 Ga0157377_10259108
471 Ga0157376_10035331
472 Ga0163161_10036764
473 Ga0207697_10204475
474 Ga0207682_10010173
475 Ga0207682_10106542
476 Ga0207688_10052057
477 Ga0207680_10050816
478 Ga0207645_10045941
479 Ga0207645_10217519
480 Ga0207645_10321671
481 Ga0207643_10009126
482 Ga0207662_10300770
483 Ga0207662_10642727
484 Ga0207681_10030130
485 Ga0207681_10090083
486 Ga0207681_10112731
487 Ga0207681_10267046
488 Ga0207681_10471365
489 Ga0207650_10189536
490 Ga0207659_10004417
491 Ga0207659_10011444
492 Ga0207659_10039889
493 Ga0207659_10066899
494 Ga0207659_10552443
495 Ga0207659_10566252
496 Ga0207659_10675380
497 Ga0207706_10186567
498 Ga0207706_10189578
499 Ga0207706_10206994
500 Ga0207706_10373746
501 Ga0207706_10745137
502 Ga0207670_10024234
503 Ga0207670_10363222
504 Ga0207669_10003637
505 Ga0207669_10165418
506 Ga0207669_10894426
507 Ga0207691_10005322
508 Ga0207691_10008570
509 Ga0207689_11276392
510 Ga0207679_10430840
511 Ga0207679_10818753
512 Ga0207651_10067545
513 Ga0207651_10581046
514 Ga0207651_10868862
515 Ga0207651_11655229
516 Ga0207712_10036135
517 Ga0207712_10493996
518 Ga0207668_11341207
519 Ga0207658_10410361
520 Ga0207677_10377873
521 Ga0207648_10125466
522 Ga0207676_10064711
523 Ga0207676_10155653
524 Ga0207674_10042870
525 Ga0207675_101154265
526 Ga0207683_10119213
527 Ga0207683_10215478
528 Ga0207428_10004907
529 Ga0207428_10019492
530 Ga0207428_10027178
531 Ga0207428_10081403
532 Ga0268265_10290944
533 Ga0268265_10497772
534 Ga0268264_10289490
535 Ga0307408_100291171
536 Ga0307408_101371681
537 Ga0307413_10308320
538 Ga0307413_10669786
539 Ga0307413_10912151
540 Ga0307413_11179535
541 Ga0307410_10752078
542 Ga0307406_10107555
543 Ga0307407_10078362
544 Ga0307412_10211961
545 Ga0307409_100713567
546 Ga0307416_100020005
547 Ga0307416_100207296
548 Ga0307414_10245568
549 Ga0307411_10065280
550 Ga0307411_10450797
551 Ga0450914_036213
552 Ga0439434_0079399
553 Ga0439434_0099787
554 Ga0439435_0017682
555 Ga0439435_0193253
556 Ga0439460_0033723
557 Ga0453684_0092399
558 Ga0495643_0388124
559 Ga0496113_0028697
560 Ga0501298_133754
561 Ga0501299_029242
562 Ga0501031_0172163
563 Ga0501031_0644206
564 Ga0501032_0621478
565 Ga0501036_0028789
566 Ga0501036_0144194
567 Ga0501036_0889352
568 Ga0501036_1205045
569 Ga0501038_0140863
570 Ga0501038_0200276
571 Ga0501038_0260510
572 Ga0501039_0280433
573 Ga0501040_0031477
574 Ga0501040_0227957
575 Ga0501040_0637772
576 Ga0501040_0748057
577 Ga0501041_0024835
578 Ga0501042_0011792
579 Ga0501042_0048890
580 Ga0501042_0514882
581 Ga0501046_0351522
582 Ga0501046_0459671
583 Ga0501048_0175209
584 Ga0501048_0271993
585 Ga0501068_0070410
586 Ga0501071_0003662
587 Ga0501071_0074137
588 Ga0501071_0112693
589 Ga0501071_0839847
590 Ga0501072_0000990
591 Ga0501072_0022573
592 Ga0501072_0102855
593 Ga0501072_0217119
594 Ga0501074_0167876
595 Ga0501074_0345570
596 Ga0501074_0369684
597 Ga0501075_0024621
598 Ga0501075_0202016
599 Ga0501076_0020971
600 Ga0501076_0021744
601 Ga0501076_0027498
602 Ga0501076_1472106
603 Ga0501077_0074086
604 Ga0501077_0075365
605 Ga0501217_040404
606 Ga0501079_0041408
607 Ga0501079_0654877
608 Ga0501080_0109362
609 Ga0501080_0217819
610 Ga0501080_0351469
611 Ga0501081_0008752
612 Ga0501081_0021841
613 Ga0501081_0376928
614 Ga0501081_0811786
615 Ga0501081_0939423
616 Ga0501083_0183459
617 Ga0501045_0021599
618 Ga0501045_0128787
619 Ga0501045_0664536
620 Ga0501045_1010860
621 nmdc:mga0yw44_36713_c1
622 nmdc:mga06z11_14879_c1
623 nmdc:mga07m45_70807_c1
624 nmdc:mga05p37_276795_c1
625 nmdc:mga05p37_4745_c1
626 nmdc:mga05p37_65817_c1
627 nmdc:mga09592_168182_c1
628 nmdc:mga09592_457457_c1
629 nmdc:mga09592_689081_c1
630 nmdc:mga0qj67_1348_c1
631 nmdc:mga0qj67_321006_c1
632 nmdc:mga0qj67_45085_c1
633 nmdc:mga0qj67_48271_c1
634 nmdc:mga0qj67_729083_c1
635 nmdc:mga06r32_1098325_c1
636 nmdc:mga06r32_23912_c1
637 nmdc:mga06r32_577084_c1
638 nmdc:mga08y16_1053726_c1
639 nmdc:mga08y16_129827_c1
640 nmdc:mga08y16_1639_c1
641 nmdc:mga08y16_209_c1
642 nmdc:mga08y16_3777_c1
643 nmdc:mga08y16_42717_c1
644 nmdc:mga08y16_432247_c1
645 nmdc:mga08y16_433387_c1
646 nmdc:mga0a205_704572_c1
647 Ga0500611_058266
648 Ga0501084_0016787
649 Ga0501084_0934132
650 Ga0590071_000327
651 Ga0590071_011794
652 Ga0590074_000879
653 Ga0590074_021161
654 Ga0590075_001063
655 Ga0590077_000141
656 Ga0590077_041283
657 Ga0590077_044696
658 Ga0501082_0064365
659 Ga0501082_0137590
660 Ga0501082_0182589

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16242

Pyrid_ox_like

Pyridoxamine 5'-phosphate oxidase like

2

158

0.93

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

5

90

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.8456 31 163
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.84 28 166
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8271 26 166
6vna-assembly1.cif.gz_C pden_1323 0.814 29 160
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.8107 31 163
ID Description Score Start End Superfamily
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8412 31 163 2.30.110.10
af_Q2FVN7_2_129_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8197 28 161 2.30.110.10
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8147 26 166 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.806 31 163 2.30.110.10
af_Q8I4W5_311_415_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8052 72 163 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A5C5SSI1-F1-model_v4 Pyridoxamine oxidase 0.9135 32 161
AF-A0A495NJJ6-F1-model_v4 deleted 0.9096 31 162
AF-A0A1W6E2U4-F1-model_v4 deleted 0.9003 45 161
AF-A0A4Q6C2E1-F1-model_v4 General stress protein FMN-binding split barrel domain-containing protein 0.896 32 164
AF-A0A1W6E2U4-F1-model_v4 deleted 0.8926 45 161

Map